Your browser is old and dusty. Try Google Chrome!

Details for slr0181

ORF slr0181
Accession NP_442000.2
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -358 -351 11.7405 0.0778
NP_441418.1_6 Forward -359 -340 -29.1065 0.216
NP_442291.1_5 Forward -214 -198 2.91013 0.117
NP_441453.1_4 Reverse -350 -358 4.73931 0.252
NP_441098.1_3 Reverse -288 -307 -6.02333 0.28
NP_440996.1_2 Reverse -86 -95 16.126 0.248
NP_442752.1_4 Forward -213 -206 10.8555 0.0846
NP_442975.1_10 Reverse -346 -360 6.68548 0.165
NP_442975.1_10 Forward -73 -59 5.01387 0.234
NP_441470.1_4 Reverse -45 -64 12.7825 0.201
NP_440110.1_4 Forward -383 -364 5.30933 0.172
NP_442581.1_1 Reverse -279 -293 7.57108 0.262
NP_442268.1_3 Forward -155 -136 16.6165 0.218
NP_440044.1_8 Reverse -205 -224 1.37609 0.175
NP_441594.1_6 Forward -27 -8 2.94938 0.239
NP_442276.1_1 Reverse -341 -360 10.9134 0.238
NP_440209.1_1 Forward -213 -205 5.0343 0.194
NP_440331.1_5 Reverse -255 -274 39.9218 0.000000253
NP_441716.1_1 Forward -213 -199 11.6026 0.0936
NP_441716.1_1 Reverse -227 -241 3.73617 0.259
NP_440906.1_5 Reverse -351 -358 9.47889 0.116
NP_440906.1_5 Reverse -205 -212 8.79057 0.149
NP_440906.1_5 Reverse -40 -47 5.64398 0.292
NP_440747.1_10 Forward -362 -350 -12.5474 0.297
NP_441847.1_9 Forward -343 -325 12.9005 0.218
NP_441486.1_1 Reverse -201 -215 1.67122 0.103
NP_441486.1_1 Forward -362 -348 -4.52363 0.201
NP_441486.1_1 Forward -216 -202 -6.39192 0.294
NP_440580.1_8 Forward -272 -253 12.6833 0.0832
NP_441077.1_6 Reverse -284 -300 2.60905 0.276
NP_442485.1_3 Reverse -339 -358 -5.21209 0.287
NP_442485.1_3 Forward -361 -342 -5.9004 0.296
NP_440533.1_1 Forward -353 -334 9.73422 0.219
NP_440667.1_2 Reverse -60 -79 -6.49039 0.273
NP_440318.1_1 Forward -378 -359 11.7992 0.103
NP_440203.1_5 Reverse -207 -217 10.9926 0.206
NP_440203.1_5 Reverse -187 -197 8.63269 0.29
NP_442690.1_1 Forward -71 -52 -8.85033 0.189
NP_440858.1_1 Reverse -271 -290 27.7288 0.000244
NP_442119.1_4 Forward -209 -190 24.4839 0.00929
NP_442536.1_4 Reverse -198 -216 16.3421 0.0902
NP_441294.1_7 Reverse -346 -360 10.9784 0.161
NP_440147.1_4 Forward -361 -348 0.805932 0.244
NP_442941.1_3 Reverse -351 -361 -0.0199663 0.244
NP_442941.1_3 Reverse -205 -215 -0.904945 0.274
NP_442941.1_5 Reverse -18 -32 16.8168 0.221
NP_442941.1_5 Reverse -7 -21 15.0024 0.272
NP_442281.1_1 Reverse -345 -359 2.26061 0.272
NP_443030.1_1 Reverse -42 -59 12.8219 0.148
NP_442215.1_2 Reverse -348 -364 -5.448 0.25
NP_442933.1_10 Reverse -350 -359 4.32629 0.257
NP_440382.1_2 Forward -119 -100 3.04693 0.274
NP_440382.1_2 Reverse -79 -98 1.76863 0.284
NP_442292.1_1 Reverse -205 -214 -0.590259 0.258
NP_442292.1_1 Reverse -351 -360 -0.68859 0.268
NP_442292.1_5 Forward -390 -371 2.16274 0.257
NP_442476.1_6 Reverse -205 -219 1.17956 0.228
NP_441726.1_7 Forward -268 -249 5.89931 0.248
NP_440777.1_9 Reverse -49 -68 4.916 0.255
NP_441016.2_6 Reverse -204 -223 5.50519 0.283
NP_441637.1_9 Reverse -4 -22 -2.53746 0.292
NP_442868.1_6 Forward -361 -351 0.0783647 0.248
NP_442719.1_2 Forward -299 -281 -7.35637 0.232
NP_442719.1_2 Forward -290 -272 -9.7163 0.267
NP_440785.1_2 Reverse -272 -291 6.58763 0.223
NP_442427.1_8 Reverse -53 -72 9.83255 0.173
NP_441911.1_7 Reverse -301 -320 9.53674 0.00114
NP_440145.1_4 Reverse -378 -388 17.2858 0.0863
NP_442718.1_2 Reverse -263 -282 -6.88371 0.295
NP_441557.1_5 Forward -359 -350 -0.885252 0.26
NP_442347.1_2 Reverse -351 -360 5.01461 0.244
NP_442347.1_2 Forward -212 -203 3.53964 0.284
NP_440136.1_2 Reverse -205 -212 3.97235 0.288
NP_442998.1_5 Forward -313 -303 12.1731 0.176
NP_442998.1_5 Reverse -280 -290 11.8781 0.176
NP_442998.1_5 Reverse -281 -291 10.6981 0.206
NP_442998.1_10 Reverse -206 -213 6.0373 0.205
NP_440299.1_1 Reverse -200 -213 2.18201 0.294
NP_440299.1_3 Forward -355 -336 9.83255 0.244
NP_441559.1_8 Forward -198 -184 1.76955 0.153
NP_441559.1_8 Forward -25 -11 -7.37523 0.291
NP_442860.1_7 Reverse -68 -86 18.1768 0.179
NP_440915.1_6 Reverse -143 -157 -3.04867 0.29
NP_441464.1_10 Forward -398 -384 9.83269 0.262
NP_440695.1_6 Reverse -302 -316 11.6718 0.265
NP_441199.1_10 Forward -61 -43 14.0393 0.232
NP_442993.1_1 Forward -386 -370 -9.5779 0.188
NP_442950.1_1 Reverse -293 -312 0.392778 0.206
NP_439996.1_6 Forward -396 -377 5.87257 0.3
NP_439984.1_8 Forward -92 -74 18.3087 0.265
NP_440372.1_3 Reverse -322 -336 15.4813 0.165
NP_440819.1_5 Reverse -280 -288 7.59091 0.272
NP_442384.1_10 Reverse -350 -363 1.00259 0.271
NP_440699.1_1 Reverse -72 -91 1.95716 0.288
NP_440344.1_10 Reverse -343 -360 -9.99092 0.163
NP_440531.1_6 Forward -367 -348 -2.16383 0.246
NP_441060.1_2 Reverse -63 -82 19.2723 0.101
NP_440350.1_5 Reverse -3 -22 -5.9004 0.295
NP_441896.1_3 Forward -395 -376 0.982764 0.222
NP_441894.1_2 Reverse -339 -357 33.9433 0.00000119
NP_440999.1_9 Reverse -346 -360 5.89945 0.105
NP_441748.1_3 Forward -367 -348 14.256 0.221
NP_441543.1_2 Forward -358 -349 10.8161 0.0666
NP_441543.1_2 Reverse -351 -360 4.0313 0.293
NP_441929.1_3 Forward -312 -293 2.75272 0.266
NP_441601.1_2 Reverse -371 -390 -4.03212 0.28
NP_440519.1_8 Reverse -338 -354 8.02334 0.199
NP_442428.1_5 Reverse -351 -358 3.77569 0.277
NP_440673.1_3 Forward -52 -45 5.54565 0.288
NP_440673.1_7 Reverse -352 -371 3.53937 0.198
NP_441670.1_2 Forward -212 -193 12.3892 0.286
NP_441052.1_2 Reverse -350 -360 -0.314959 0.273
NP_442219.1_9 Reverse -351 -360 4.81794 0.196
NP_440436.1_4 Reverse -205 -214 4.22755 0.277
NP_442366.1_5 Forward -216 -206 16.9908 0.0268
NP_440508.1_4 Forward -392 -373 13.4708 0.229
NP_441851.1_10 Forward -214 -204 4.0116 0.291
NP_441982.1_6 Reverse -279 -288 11.6259 0.288
NP_442689.1_8 Forward -85 -68 0.333834 0.191
NP_442689.1_8 Reverse -72 -89 -7.53264 0.292
NP_442689.1_8 Forward -68 -51 -7.72931 0.292
NP_442843.1_1 Forward -358 -339 -6.39206 0.244
NP_441124.1_5 Reverse -324 -334 12.7217 0.215
NP_442006.1_2 Forward -246 -229 -18.2507 0.289
NP_441570.1_1 Forward -213 -195 -16.2055 0.24
NP_441078.1_4 Forward -359 -350 -1.27858 0.246
NP_440793.1_1 Reverse -225 -239 8.84875 0.295
NP_441432.1_8 Forward -360 -351 12.4878 0.0383
NP_441432.1_9 Forward -278 -265 13.931 0.157
NP_442320.1_8 Reverse -335 -349 -5.40861 0.225
NP_440199.1_10 Forward -362 -352 7.05986 0.242
NP_442298.1_2 Reverse -381 -400 15.4366 0.202
NP_442400.1_10 Reverse -130 -143 14.0991 0.173
NP_442400.1_10 Forward -19 -6 11.1388 0.243
NP_440386.1_3 Reverse -51 -70 -4.72043 0.221
NP_440559.1_1 Reverse -205 -214 4.42462 0.277
NP_441659.2_8 Forward -213 -203 1.65166 0.233
NP_442913.1_10 Reverse -195 -214 5.11266 0.0777
NP_442346.1_5 Forward -360 -350 9.12481 0.118
NP_442346.1_5 Forward -214 -204 4.40493 0.29
NP_441126.1_5 Forward -240 -221 1.27776 0.299
NP_440847.1_3 Reverse -378 -392 15.1419 0.18
NP_441833.1_4 Reverse -205 -212 4.56234 0.248
NP_441329.1_6 Reverse -281 -300 -0.143661 0.266
NP_441329.1_6 Reverse -283 -302 -2.53096 0.294
NP_441895.1_3 Reverse -340 -359 40.2168 0.000000267
NP_441895.1_9 Reverse -360 -379 39.3318 0.000000479
NP_441895.1_10 Reverse -277 -296 39.0369 0.000000369
NP_441609.1_1 Forward -192 -173 -1.57384 0.271
NP_440590.1_4 Reverse -205 -218 -1.45568 0.22
NP_440821.1_4 Reverse -202 -212 4.79825 0.123
NP_440227.1_2 Reverse -69 -85 7.04003 0.295
NP_440156.1_4 Forward -292 -282 14.8275 0.176
NP_442568.1_8 Reverse -284 -298 15.8309 0.192
NP_442082.1_7 Forward -361 -343 15.8504 0.0643
NP_442669.1_1 Reverse -251 -270 31.7604 0.00000199
NP_442669.1_1 Reverse -108 -127 0.786102 0.26
NP_441874.1_1 Forward -398 -384 15.3392 0.165
NP_440863.1_1 Reverse -280 -294 14.3865 0.236
NP_441541.1_1 Forward -91 -73 -4.58163 0.279
NP_442284.1_5 Forward -77 -63 16.4202 0.294
NP_442899.1_1 Reverse -109 -127 18.702 0.0317
NP_442499.1_4 Reverse -354 -368 12.9793 0.226
NP_442402.1_4 Forward -298 -279 -9.34271 0.288
NP_442402.1_10 Forward -289 -279 13.9425 0.182
NP_442402.1_10 Forward -299 -289 11.091 0.269
NP_442402.1_10 Reverse -380 -390 10.6976 0.282
NP_441848.1_4 Reverse -70 -86 15.19 0.154
NP_441848.1_4 Reverse -276 -292 12.8027 0.195
NP_441848.1_4 Forward -345 -329 7.64616 0.288
NP_442039.1_4 Forward -385 -378 7.02061 0.269
NP_442039.1_7 Reverse -277 -287 8.33817 0.263
NP_442679.1_3 Forward -124 -106 1.88744 0.239
NP_440825.1_6 Reverse -100 -119 7.57094 0.285
NP_440505.1_3 Forward -215 -205 4.60159 0.277
NP_442844.1_5 Reverse -5 -24 1.76863 0.263
NP_440914.1_1 Reverse -147 -157 7.05364 0.254
NP_440914.1_1 Forward -123 -113 6.85846 0.263
NP_441011.1_8 Forward -358 -349 5.80125 0.227
NP_442101.1_10 Reverse -213 -232 -7.17871 0.209
NP_442533.1_6 Forward -359 -350 3.93297 0.197
NP_439944.1_9 Forward -212 -202 5.09324 0.277
NP_441697.1_5 Reverse -90 -109 -10.1703 0.278
NP_440816.1_2 Reverse -280 -299 6.82221 0.27
NP_440816.1_2 Forward -34 -15 6.33814 0.281
NP_441028.1_6 Forward -288 -278 7.15773 0.23
NP_441527.1_4 Reverse -285 -304 -9.50187 0.259
NP_441527.1_4 Reverse -283 -302 -12.1756 0.285
NP_440115.1_6 Reverse -144 -154 14.0414 0.0615
NP_440115.1_6 Forward -216 -206 6.76487 0.167
NP_443045.1_5 Forward -198 -185 14.6294 0.261
NP_439903.1_6 Forward -196 -177 0.883656 0.256
NP_441286.1_1 Forward -214 -202 -0.157684 0.126
NP_440670.1_8 Reverse -204 -213 3.53964 0.257
NP_442614.1_2 Forward -248 -234 5.99778 0.295
NP_442264.1_2 Forward -223 -206 4.6604 0.295
NP_439967.1_7 Forward -214 -196 12.3105 0.164
NP_441626.1_2 Forward -247 -240 7.6106 0.119
NP_441962.1_4 Reverse -358 -377 -14.5535 0.29
NP_440387.1_1 Forward -193 -177 -6.03799 0.262
NP_441836.1_10 Reverse -272 -291 8.16093 0.197
NP_442090.1_2 Forward -92 -73 12.2703 0.214
NP_442090.1_2 Reverse -74 -93 10.3605 0.243
NP_442090.1_2 Forward -90 -71 7.68668 0.281
NP_441510.2_2 Reverse -373 -392 2.45694 0.272
NP_440287.1_5 Forward -289 -270 7.07848 0.286
NP_439988.1_10 Reverse -282 -301 10.942 0.213
NP_441237.1_9 Reverse -205 -215 9.81313 0.265
NP_442743.1_1 Forward -72 -53 16.3215 0.209
NP_440324.1_10 Forward -191 -172 25.3688 0.00211
NP_440502.1_7 Reverse -362 -381 11.3075 0.291
NP_442509.1_6 Reverse -268 -287 6.09597 0.294
YP_003858595.1_4 Forward -333 -314 25.5646 0.000449
YP_003858595.1_6 Forward -300 -281 23.4997 0.000638
YP_003858595.1_8 Forward -392 -373 22.0256 0.00337
NP_440185.1_9 Forward -396 -379 12.3302 0.264
NP_441885.1_5 Forward -213 -203 -0.0199663 0.186
NP_441885.1_5 Forward -359 -349 -0.511621 0.202
NP_442341.1_7 Forward -360 -346 6.48943 0.126
NP_441173.1_9 Forward -287 -279 14.3753 0.161
NP_441173.1_9 Forward -376 -368 12.9004 0.206
NP_441173.1_9 Forward -83 -75 11.0321 0.228
NP_441173.1_9 Reverse -74 -82 11.0321 0.228
NP_443000.1_7 Forward -361 -351 7.25653 0.0927
NP_441842.1_10 Forward -393 -379 6.78443 0.272
NP_440091.1_1 Reverse -200 -212 3.97222 0.144
NP_440149.1_8 Forward -365 -346 0.0977854 0.141
NP_441105.1_3 Forward -370 -351 -8.45701 0.272
NP_440216.1_9 Reverse -388 -397 5.70292 0.29
NP_442015.1_10 Reverse -200 -213 0.0192843 0.245
NP_439971.2_8 Forward -242 -228 12.4876 0.285
NP_442116.1_6 Reverse -52 -69 9.9833 0.227
NP_440261.1_5 Reverse -378 -391 -5.29059 0.19
NP_440261.1_5 Reverse -351 -364 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACTTTTTGCTTGGGGGAGATTGGATTCTACCAATTGCTACTGGCTATCACTGATGTCGCTGCTGTAAAATTCTCTCAGTATCATTACGGTGAAAATTCTATATTCTTCACCATTTTTCCCAATTATGCCGACTTTTCAAACACGCTCTTATATGCGACAGGGAGGAGAAGCACCATCTTGTTATGTTGGCGATCCTAATCCATCCGAGGCATTTGACTTAGTTTTAGAATGTAGGGCTTCTATACCGGATTGCTACGTTGTCAGTTAATTTAGACTAGACAAACACAATCTAAATAGTCTGGAAGTTATTTTTCGATTTTTGCAAAAATGACACTTTCTCCTAAAATTTCGTTGCTATCATATAGTTTAGAGAACTGGCAGAGAATAACCAGAAACTAAT

CDS

TTGAGCCGTACTTATCAAACCCTAGGCATTGTTGTGAAAGGTATGGCCTTTGGGGAATCTGATCGCCTAGTGACCATTTTCTCGCCGGAGTATGGTTTGATCCGAGCCATTGCGCCGGGGGCTAGAAAACCAAAATCTAGTCTCAGGGGTCGCACCGAACTATTTGTAGTTAACCAATTTCTGCTATTTGCGGGAAAAAGTTTGGACCGTATCAACCAAGCGGAAACCCAATATTCCTACCCTGGCCTGGGGCAAAATGTTTGTAATTTGGCGGCGGGTCAGTACTTAATCGAGCTAATCCTGGCCCTCGGGACAGAGGCCAGTGCCCAAACATCCCTGTATGAACTGTTTACCGAACATCTACGACGGTTAGAAACGGAAGCCACAGTGGAAAATATCTATGGCCATCTAGCCCAAGCATTATTCCATTGCCTCGGGGCAGAGGGCATTGCCCCCCAATTTCATCACTGTGCCATCACGGCCCAAACTATTAGTCCCAATTTTTACGATCGCCAATGGCGGGTGGGCTTTAGCCCAGAATTGGGGGGCATTGTCGATCTTCGCAGTTCTAGGGACATGGGCCCCATTCCCCAAATGCGTCGCTTAACAGCTATGGAACTAAGTTTATTGCAACAACTCAACCAACCTGCCCTACCGGACCCCCAACAGTATCTACCAGTGATCGCCAGGAAAAATTTTCGCCTCTGGGATTGGGTAAAAGCGGAAAATCTGATGCGCTACTATGCCCAACGTCAATTGGGAAAAAGCTTCCGGGCCGCTGTTTTACTAGATAGCATGTGGGAGGTGGATTTTTAG

Protein

MSRTYQTLGIVVKGMAFGESDRLVTIFSPEYGLIRAIAPGARKPKSSLRGRTELFVVNQFLLFAGKSLDRINQAETQYSYPGLGQNVCNLAAGQYLIELILALGTEASAQTSLYELFTEHLRRLETEATVENIYGHLAQALFHCLGAEGIAPQFHHCAITAQTISPNFYDRQWRVGFSPELGGIVDLRSSRDMGPIPQMRRLTAMELSLLQQLNQPALPDPQQYLPVIARKNFRLWDWVKAENLMRYYAQRQLGKSFRAAVLLDSMWEVDF