Your browser is old and dusty. Try Google Chrome!

Details for slr0171

ORF slr0171
Accession NP_441979.1
Symbol ycf37
Category Photosystem I
Definition photosystem I assembly related protein Ycf37
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -290 -276 3.63784 0.161
NP_441061.1_2 Reverse -274 -288 2.2612 0.178
NP_441061.1_2 Reverse -292 -306 2.16287 0.178
NP_441061.1_3 Forward -86 -67 15.7316 0.186
NP_440795.1_7 Forward -88 -81 14.6904 0.0123
NP_440795.1_7 Reverse -81 -88 14.6904 0.0123
NP_441418.1_6 Reverse -273 -292 -12.5869 0.0672
NP_441418.1_6 Forward -89 -70 -19.9617 0.0997
NP_441418.1_6 Forward -76 -57 -21.3384 0.147
NP_441418.1_6 Forward -70 -51 -21.4367 0.149
NP_442291.1_5 Reverse -79 -95 9.20332 0.053
NP_441453.1_1 Forward -289 -271 3.65664 0.263
NP_441453.1_4 Forward -89 -81 16.6374 0.00633
NP_441453.1_4 Reverse -80 -88 16.539 0.00633
NP_441453.1_4 Reverse -170 -178 6.80426 0.121
NP_441453.1_4 Forward -282 -274 6.80426 0.121
NP_441453.1_4 Forward -291 -283 4.24765 0.259
NP_442151.1_6 Forward -89 -75 12.0943 0.0818
NP_442151.1_6 Forward -282 -268 6.58777 0.228
NP_441818.1_6 Forward -289 -275 11.2093 0.253
NP_441818.1_9 Forward -69 -50 -2.16383 0.202
NP_441818.1_9 Forward -57 -38 -9.14533 0.287
NP_440226.1_1 Forward -89 -70 8.75091 0.0823
NP_440226.1_1 Reverse -273 -292 3.14605 0.237
NP_440259.1_4 Forward -56 -42 9.59994 0.278
NP_440348.1_8 Forward -100 -81 13.5691 0.284
NP_440996.1_3 Reverse -67 -85 10.9339 0.245
NP_443002.1_5 Forward -290 -272 8.57317 0.297
NP_442173.1_1 Reverse -81 -89 17.3257 0.00633
NP_442173.1_1 Forward -88 -80 15.4574 0.00633
NP_442173.1_1 Reverse -274 -282 5.72262 0.203
NP_442173.1_1 Forward -178 -170 5.72262 0.203
NP_442173.1_3 Reverse -328 -338 16.2046 0.196
NP_442752.1_4 Forward -282 -275 13.8055 0.0199
NP_442752.1_4 Reverse -170 -177 13.8055 0.0199
NP_442752.1_4 Reverse -80 -87 13.8055 0.0199
NP_443027.1_4 Forward -284 -274 10.1081 0.144
NP_443027.1_4 Forward -91 -81 6.56821 0.275
NP_441225.1_4 Reverse -293 -312 -11.0136 0.284
NP_440784.1_7 Forward -88 -81 15.9687 0.0123
NP_440784.1_7 Reverse -81 -88 15.9687 0.0123
NP_440784.1_7 Forward -281 -274 6.23397 0.241
NP_440784.1_7 Reverse -171 -178 6.23397 0.241
NP_440784.1_7 Reverse -274 -281 6.13563 0.241
NP_440784.1_7 Forward -178 -171 6.13563 0.241
NP_442909.1_7 Reverse -81 -95 10.2254 0.14
NP_440061.1_9 Reverse -50 -64 10.8154 0.122
NP_440061.1_9 Reverse -78 -92 9.24208 0.149
NP_440061.1_9 Forward -91 -77 5.99717 0.264
NP_439979.1_2 Reverse -273 -292 6.88262 0.288
NP_440878.1_9 Reverse -70 -89 1.76941 0.177
NP_442062.1_8 Reverse -80 -90 17.0896 0.0025
NP_442062.1_8 Forward -89 -79 14.9263 0.0108
NP_442062.1_8 Forward -282 -272 6.66654 0.119
NP_442062.1_8 Reverse -170 -180 6.66654 0.119
NP_442062.1_8 Forward -291 -281 3.71661 0.256
NP_441900.1_2 Reverse -314 -332 -5.88141 0.288
NP_441859.1_3 Reverse -51 -70 2.35861 0.262
NP_440304.1_4 Forward -302 -292 4.0116 0.281
NP_440304.1_4 Reverse -265 -275 4.0116 0.281
NP_440304.1_4 Reverse -50 -60 4.0116 0.281
NP_440304.1_4 Reverse -78 -88 1.84832 0.299
NP_442242.1_4 Forward -88 -81 14.3954 0.0124
NP_442242.1_4 Reverse -81 -88 14.3954 0.0124
NP_442242.1_4 Reverse -274 -281 10.8555 0.127
NP_442242.1_4 Forward -178 -171 10.8555 0.127
NP_440044.1_8 Reverse -81 -100 8.55425 0.0739
NP_439918.1_2 Reverse -134 -153 -2.65548 0.248
NP_441619.1_8 Forward -95 -81 10.3237 0.185
NP_441208.1_1 Forward -303 -284 2.3594 0.224
NP_441594.1_6 Reverse -143 -162 0.982764 0.276
NP_441594.1_6 Reverse -55 -74 0.982764 0.276
NP_442110.1_7 Reverse -267 -281 2.2612 0.222
NP_440856.1_7 Forward -261 -242 -8.35868 0.27
NP_441083.1_5 Forward -89 -79 11.0914 0.0166
NP_441083.1_5 Reverse -80 -90 10.5014 0.0197
NP_441083.1_5 Forward -282 -272 1.06167 0.218
NP_441083.1_5 Reverse -170 -180 1.06167 0.218
NP_441083.1_5 Forward -179 -169 0.766681 0.218
NP_441083.1_5 Reverse -273 -283 0.766681 0.218
NP_441434.1_7 Reverse -275 -289 3.14618 0.259
NP_441141.1_4 Forward -99 -80 11.8975 0.292
NP_441738.1_2 Reverse -275 -282 15.28 0.0102
NP_441738.1_2 Forward -177 -170 15.28 0.0102
NP_441738.1_2 Forward -87 -80 15.28 0.0102
NP_441738.1_2 Reverse -82 -89 11.5435 0.084
NP_441558.1_5 Forward -91 -72 12.1925 0.0707
NP_441955.1_8 Reverse -276 -293 17.9351 0.112
NP_440209.1_1 Reverse -80 -88 18.1123 0.00295
NP_440209.1_1 Reverse -273 -281 11.9175 0.0184
NP_440209.1_1 Forward -179 -171 11.9175 0.0184
NP_440209.1_1 Forward -282 -274 8.57422 0.0425
NP_440209.1_1 Reverse -170 -178 8.57422 0.0425
NP_440209.1_1 Forward -89 -81 8.57422 0.0425
NP_442136.1_4 Reverse -275 -294 13.5683 0.196
NP_442889.1_8 Forward -285 -271 11.307 0.0733
NP_442889.1_8 Reverse -77 -91 8.84875 0.109
NP_440447.1_6 Reverse -72 -90 8.37728 0.14
NP_441713.1_1 Reverse -74 -93 -7.86702 0.139
NP_441770.1_5 Forward -97 -78 -0.295539 0.245
NP_442706.1_10 Reverse -102 -120 13.4905 0.255
NP_442570.1_3 Reverse -245 -264 -7.57203 0.272
NP_442570.1_3 Forward -97 -78 -7.96535 0.279
NP_441716.1_1 Reverse -170 -184 9.04604 0.127
NP_442111.1_4 Forward -180 -166 10.4227 0.0544
NP_442111.1_4 Forward -90 -76 9.83269 0.0575
NP_442111.1_4 Reverse -272 -286 2.94952 0.259
NP_441163.1_1 Forward -283 -266 4.75801 0.285
NP_441163.1_1 Reverse -274 -291 4.46302 0.287
NP_441495.1_1 Reverse -44 -63 9.83255 0.208
NP_440343.1_3 Reverse -287 -305 3.36165 0.281
NP_440906.1_5 Forward -88 -81 15.8704 0.0124
NP_440906.1_5 Reverse -81 -88 15.8704 0.0124
NP_440906.1_5 Forward -281 -274 6.23397 0.234
NP_440906.1_5 Reverse -171 -178 6.23397 0.234
NP_440906.1_5 Reverse -274 -281 6.13563 0.241
NP_440906.1_5 Forward -178 -171 6.13563 0.241
NP_440747.1_10 Forward -182 -170 6.92215 0.012
NP_440747.1_10 Forward -92 -80 5.25052 0.0154
NP_440747.1_10 Reverse -77 -89 5.05386 0.019
NP_440747.1_10 Reverse -270 -282 -4.68091 0.115
NP_441130.1_10 Forward -302 -288 4.52282 0.281
NP_441486.1_1 Forward -92 -78 22.5174 0.00162
NP_441486.1_1 Reverse -77 -91 16.1259 0.00562
NP_441486.1_1 Reverse -270 -284 -5.60527 0.248
NP_441880.2_10 Reverse -283 -301 8.47561 0.273
NP_442634.1_2 Forward -346 -327 2.16274 0.285
NP_442634.1_2 Forward -332 -313 1.67108 0.285
NP_440842.1_6 Reverse -287 -306 11.11 0.261
NP_441014.1_8 Reverse -54 -73 -9.047 0.289
NP_442848.1_1 Forward -95 -81 4.32615 0.106
NP_442848.1_1 Reverse -74 -88 -0.393733 0.263
NP_441012.1_4 Reverse -245 -258 6.1158 0.286
NP_443018.1_3 Forward -88 -81 14.8871 0.0123
NP_443018.1_3 Reverse -81 -88 14.8871 0.0123
NP_443018.1_3 Forward -281 -274 12.6255 0.0471
NP_443018.1_3 Reverse -171 -178 12.6255 0.0471
NP_443018.1_3 Forward -290 -283 10.7572 0.0907
NP_443018.1_3 Reverse -352 -359 8.39725 0.147
NP_443018.1_3 Forward -178 -171 5.25066 0.214
NP_443018.1_3 Reverse -274 -281 5.25066 0.214
NP_443018.1_3 Reverse -283 -290 4.56234 0.241
NP_441634.1_8 Forward -72 -58 3.8345 0.143
NP_440376.1_1 Forward -89 -80 9.73449 0.0365
NP_440376.1_1 Reverse -80 -89 9.63616 0.0385
NP_440376.1_1 Reverse -52 -61 4.22796 0.166
NP_440376.1_1 Forward -95 -86 3.44131 0.203
NP_440376.1_1 Forward -282 -273 0.0980582 0.285
NP_440376.1_1 Reverse -170 -179 0.0980582 0.285
NP_440376.1_1 Reverse -273 -282 -0.196935 0.285
NP_440376.1_1 Forward -179 -170 -0.196935 0.285
NP_441588.1_4 Forward -87 -77 15.9097 0.0369
NP_441588.1_4 Forward -177 -167 14.238 0.0773
NP_441588.1_4 Reverse -82 -92 9.61647 0.14
NP_442687.1_7 Reverse -79 -89 7.94484 0.121
NP_442485.1_3 Forward -72 -53 6.68596 0.161
NP_442485.1_3 Reverse -286 -305 -4.42544 0.28
NP_441846.1_10 Forward -316 -297 -21.24 0.256
NP_442530.1_2 Reverse -367 -377 13.1564 0.263
NP_440642.1_10 Reverse -311 -325 10.717 0.162
NP_441950.1_7 Forward -306 -287 -6.1954 0.243
NP_440360.1_10 Reverse -54 -68 2.5562 0.262
NP_442658.1_1 Reverse -280 -290 14.1392 0.0252
NP_442658.1_1 Forward -284 -274 9.02601 0.169
NP_442658.1_1 Reverse -78 -88 6.76441 0.214
NP_442658.1_1 Reverse -168 -178 6.17443 0.235
NP_442658.1_1 Forward -91 -81 5.87944 0.246
NP_442658.1_1 Forward -302 -292 5.19112 0.28
NP_442198.1_7 Forward -182 -163 7.86512 0.298
NP_442782.1_2 Reverse -68 -82 6.19444 0.229
NP_442782.1_2 Forward -82 -68 2.35953 0.275
NP_442205.1_9 Forward -95 -79 4.58176 0.149
NP_440656.1_8 Forward -302 -283 -7.76869 0.264
NP_441414.1_9 Forward -179 -160 2.65439 0.0642
NP_442300.1_10 Reverse -289 -308 18.0924 0.114
NP_442937.1_5 Reverse -75 -94 14.3558 0.0786
NP_442321.1_4 Reverse -257 -276 -9.24366 0.296
NP_441958.1_5 Reverse -79 -89 10.9931 0.00875
NP_441958.1_5 Forward -90 -80 2.53664 0.0409
NP_441958.1_5 Reverse -169 -179 -6.31315 0.28
NP_441958.1_5 Forward -283 -273 -6.31315 0.28
NP_441127.1_1 Reverse -58 -72 12.291 0.215
NP_439905.1_2 Reverse -292 -306 12.3893 0.208
NP_443001.1_7 Forward -142 -123 7.86593 0.217
NP_440995.1_8 Forward -99 -80 6.68596 0.264
NP_440984.1_7 Reverse -290 -304 6.09611 0.227
NP_440984.1_7 Forward -100 -86 6.09611 0.227
NP_439990.1_5 Reverse -75 -88 20.4721 0.00366
NP_439990.1_5 Reverse -165 -178 7.98409 0.183
NP_442911.1_2 Reverse -160 -179 -5.99873 0.172
NP_441580.1_6 Reverse -69 -88 -8.45701 0.262
NP_440153.1_8 Reverse -291 -304 -3.71729 0.299
NP_443055.1_3 Forward -69 -50 15.2287 0.103
NP_443055.1_6 Reverse -265 -283 0.411736 0.243
NP_443055.1_6 Forward -263 -245 0.411736 0.243
NP_443055.1_6 Forward -290 -272 -2.24319 0.291
NP_441348.1_3 Reverse -95 -114 7.7676 0.256
NP_441099.1_5 Forward -189 -170 1.86774 0.0602
NP_441099.1_5 Reverse -263 -282 0.294447 0.0807
NP_441099.1_5 Reverse -70 -89 -11.3086 0.276
NP_442002.1_9 Forward -283 -276 10.7572 0.185
NP_442002.1_9 Reverse -169 -176 10.7572 0.185
NP_441294.1_7 Forward -93 -79 17.0257 0.0103
NP_442438.1_10 Forward -94 -80 11.406 0.0463
NP_442438.1_10 Forward -290 -276 1.17956 0.204
NP_441000.1_6 Reverse -281 -295 -5.31028 0.273
NP_441000.1_6 Reverse -79 -93 -5.31028 0.273
NP_440147.1_4 Forward -91 -78 9.36073 0.041
NP_440147.1_4 Reverse -78 -91 9.36073 0.041
NP_440147.1_4 Reverse -168 -181 1.59258 0.224
NP_440147.1_4 Reverse -50 -63 0.805932 0.244
NP_440147.1_4 Reverse -271 -284 0.215946 0.261
NP_441550.1_8 Reverse -78 -88 14.6309 0.0132
NP_441550.1_8 Forward -91 -81 9.81266 0.0836
NP_441916.1_7 Forward -89 -79 10.9931 0.0261
NP_441916.1_7 Reverse -80 -90 8.23984 0.0476
NP_441916.1_7 Reverse -273 -283 6.96153 0.0784
NP_441916.1_7 Forward -179 -169 6.96153 0.0784
NP_441916.1_7 Reverse -52 -62 2.92996 0.235
NP_440206.1_9 Reverse -128 -147 12.0942 0.272
NP_440465.1_10 Forward -303 -284 0.491109 0.29
NP_441041.1_4 Forward -297 -278 -5.60541 0.155
NP_441041.1_4 Forward -89 -70 -8.35868 0.2
NP_441041.1_4 Forward -306 -287 -10.817 0.237
NP_442396.1_5 Reverse -76 -89 13.0973 0.0913
NP_442004.1_6 Reverse -80 -94 16.0275 0.0577
NP_442004.1_6 Forward -89 -75 1.27789 0.294
NP_441725.1_5 Forward -290 -280 2.92996 0.115
NP_441725.1_5 Forward -88 -78 2.04498 0.115
NP_441725.1_5 Reverse -274 -284 -0.806614 0.271
NP_439966.1_7 Forward -181 -171 13.7459 0.024
NP_439966.1_7 Forward -284 -274 7.74772 0.15
NP_439966.1_7 Reverse -78 -88 7.25606 0.15
NP_439966.1_7 Reverse -271 -281 5.68278 0.214
NP_439966.1_7 Reverse -280 -290 4.60114 0.265
NP_439966.1_7 Reverse -289 -299 4.40448 0.273
NP_439966.1_9 Forward -284 -275 10.7178 0.0863
NP_439966.1_9 Reverse -168 -177 0.884706 0.253
NP_442941.1_3 Forward -88 -78 11.0914 0.0116
NP_442941.1_3 Reverse -81 -91 8.53483 0.0348
NP_442941.1_3 Reverse -171 -181 0.0783647 0.231
NP_440289.1_2 Forward -285 -272 -0.865694 0.213
NP_440983.1_5 Reverse -276 -295 1.0811 0.214
NP_440983.1_5 Reverse -55 -74 1.0811 0.214
NP_440260.1_8 Forward -98 -80 -4.79907 0.273
NP_440260.1_8 Reverse -264 -282 -7.35568 0.295
NP_440260.1_8 Reverse -251 -269 -7.45401 0.295
NP_441514.1_6 Forward -327 -320 14.2971 0.248
NP_441678.1_9 Reverse -134 -153 -4.72043 0.296
NP_442281.1_1 Reverse -346 -360 7.47213 0.0993
NP_442281.1_1 Reverse -47 -61 3.24392 0.238
NP_442901.1_4 Forward -142 -123 10.9142 0.278
NP_440177.1_1 Forward -68 -50 5.03403 0.272
NP_440177.1_9 Forward -314 -295 16.6174 0.165
NP_441457.1_2 Reverse -287 -306 17.109 0.111
NP_441457.1_7 Reverse -280 -299 1.67108 0.276
NP_441556.1_10 Forward -66 -52 11.2925 0.231
NP_441556.1_10 Forward -184 -170 10.8058 0.257
NP_441644.1_6 Forward -89 -79 15.0242 0.00766
NP_441644.1_6 Forward -61 -51 10.6976 0.0628
NP_441644.1_6 Reverse -80 -90 7.94438 0.113
NP_441644.1_6 Forward -282 -272 4.01116 0.253
NP_441644.1_6 Reverse -170 -180 4.01116 0.253
NP_441644.1_6 Reverse -61 -71 3.22451 0.293
NP_443049.1_6 Forward -283 -273 13.6904 0.149
NP_443049.1_6 Reverse -169 -179 13.6904 0.149
NP_442215.1_2 Forward -91 -75 -1.71142 0.187
NP_442215.1_2 Reverse -78 -94 -5.25134 0.248
NP_442215.1_2 Forward -284 -268 -5.448 0.25
NP_442215.1_2 Reverse -65 -81 -6.7263 0.278
NP_442029.1_6 Forward -76 -57 5.211 0.255
NP_442029.1_6 Forward -300 -281 3.93269 0.274
NP_442247.1_8 Reverse -78 -92 7.76774 0.294
NP_440253.1_2 Reverse -273 -291 3.95239 0.109
NP_440253.1_2 Forward -89 -71 -3.6191 0.297
NP_440929.1_8 Forward -89 -80 9.93116 0.0249
NP_440929.1_8 Reverse -80 -89 9.83282 0.0254
NP_440780.1_1 Forward -169 -150 9.88299 0.272
NP_442933.1_10 Forward -89 -80 17.601 0.00325
NP_442933.1_10 Reverse -80 -89 17.601 0.00325
NP_442933.1_10 Reverse -273 -282 6.48957 0.119
NP_442933.1_10 Forward -179 -170 6.48957 0.119
NP_441751.2_8 Reverse -81 -95 -2.36035 0.132
NP_441751.2_8 Reverse -274 -288 -6.09693 0.252
NP_442554.1_8 Forward -88 -78 15.3197 0.00882
NP_442554.1_8 Reverse -274 -284 6.17489 0.125
NP_442554.1_8 Reverse -81 -91 5.68323 0.141
NP_442554.1_8 Forward -178 -168 3.42162 0.226
NP_441762.1_7 Forward -292 -280 5.74217 0.0331
NP_441762.1_7 Forward -90 -78 2.20226 0.0676
NP_441762.1_7 Forward -283 -271 1.90727 0.0721
NP_441762.1_7 Reverse -272 -284 -4.87757 0.183
NP_441762.1_7 Reverse -169 -181 -5.27089 0.195
NP_441762.1_7 Reverse -79 -91 -7.04085 0.285
NP_441762.1_7 Forward -180 -168 -7.13918 0.285
NP_442142.1_4 Forward -182 -169 10.1468 0.079
NP_442142.1_4 Reverse -279 -292 8.67183 0.111
NP_442142.1_4 Reverse -270 -283 7.59019 0.135
NP_442142.1_9 Reverse -275 -294 18.879 0.105
NP_442292.1_1 Forward -88 -79 18.486 0.00229
NP_442292.1_1 Reverse -81 -90 9.53783 0.0183
NP_442292.1_1 Forward -281 -272 -0.0986038 0.239
NP_442292.1_1 Reverse -171 -180 -0.0986038 0.239
NP_442292.1_1 Reverse -274 -283 -0.196935 0.239
NP_442292.1_1 Forward -178 -169 -0.196935 0.239
NP_440511.1_1 Forward -295 -277 7.98396 0.228
NP_442476.1_6 Reverse -274 -288 2.75286 0.174
NP_442476.1_6 Reverse -81 -95 1.67122 0.207
NP_443009.1_2 Forward -87 -68 10.7175 0.216
NP_443009.1_5 Reverse -79 -90 7.82632 0.118
NP_443009.1_5 Forward -90 -79 4.8764 0.226
NP_441715.1_4 Forward -88 -78 7.94484 0.107
NP_441715.1_4 Reverse -81 -91 6.66654 0.132
NP_440357.1_3 Forward -293 -274 0.294447 0.285
NP_440015.1_9 Reverse -80 -98 0.117479 0.255
NP_440183.1_9 Forward -74 -55 -12.2919 0.256
NP_440464.1_10 Forward -88 -78 13.0082 0.169
NP_441468.1_1 Forward -88 -81 15.8704 0.0124
NP_441468.1_1 Reverse -81 -88 15.8704 0.0124
NP_441468.1_1 Forward -281 -274 6.13563 0.209
NP_441468.1_1 Reverse -171 -178 6.13563 0.209
NP_441468.1_1 Reverse -274 -281 6.0373 0.223
NP_441468.1_1 Forward -178 -171 6.0373 0.223
NP_441468.1_1 Reverse -283 -290 4.07068 0.263
NP_441015.1_10 Forward -75 -56 -5.60541 0.228
NP_441673.1_1 Forward -89 -80 11.1111 0.0121
NP_441673.1_1 Reverse -80 -89 11.0128 0.018
NP_441673.1_1 Forward -282 -273 1.37636 0.114
NP_441673.1_1 Reverse -170 -179 1.37636 0.114
NP_441673.1_1 Reverse -273 -282 1.1797 0.163
NP_441673.1_1 Forward -179 -170 1.1797 0.163
NP_441731.1_9 Forward -316 -299 11.6419 0.257
NP_441826.1_2 Forward -297 -283 7.76774 0.0848
NP_441826.1_2 Reverse -74 -88 -3.54032 0.286
NP_441826.1_2 Reverse -267 -281 -4.4253 0.296
NP_441637.1_9 Forward -350 -332 -2.93078 0.292
NP_442490.1_9 Forward -294 -275 -1.08219 0.179
NP_442868.1_6 Reverse -78 -88 9.81313 0.038
NP_442868.1_6 Forward -181 -171 9.12481 0.0539
NP_442868.1_6 Forward -91 -81 0.963343 0.205
NP_442868.1_6 Reverse -295 -305 -0.314959 0.284
NP_442868.1_6 Reverse -271 -281 -0.314959 0.284
NP_442719.1_2 Forward -350 -332 -1.45654 0.175
NP_441056.1_1 Forward -282 -263 -6.09707 0.267
NP_441056.1_1 Reverse -170 -189 -9.24366 0.295
NP_441056.1_7 Forward -218 -199 20.8456 0.146
NP_442808.1_1 Reverse -272 -282 7.74772 0.0697
NP_442808.1_1 Forward -180 -170 7.74772 0.0697
NP_442808.1_1 Reverse -60 -70 1.15957 0.292
NP_440145.1_3 Forward -99 -80 -3.93378 0.214
NP_442050.1_5 Forward -181 -171 9.321 0.193
NP_442050.1_5 Reverse -78 -88 7.64939 0.243
NP_442050.1_5 Forward -91 -81 6.76441 0.282
NP_442050.1_8 Reverse -61 -80 19.8235 0.272
NP_440342.1_1 Forward -310 -291 11.1109 0.279
NP_440558.1_2 Reverse -288 -307 5.40766 0.145
NP_440558.1_2 Forward -64 -45 -6.49039 0.275
NP_442789.1_4 Reverse -247 -266 -4.32711 0.259
NP_441878.1_6 Forward -62 -52 2.14332 0.0501
NP_441878.1_6 Forward -301 -291 1.35667 0.101
NP_441878.1_6 Forward -90 -80 0.668351 0.139
NP_441878.1_6 Reverse -79 -89 0.57002 0.14
NP_441878.1_6 Reverse -296 -306 -0.806614 0.18
NP_441878.1_6 Reverse -51 -61 -7.19813 0.21
NP_441036.1_8 Forward -90 -80 8.04317 0.177
NP_441036.1_8 Forward -283 -273 7.05986 0.21
NP_441036.1_8 Reverse -169 -179 7.05986 0.21
NP_442650.1_2 Reverse -80 -94 6.09611 0.134
NP_442721.1_4 Reverse -70 -89 18.7807 0.238
NP_441557.1_5 Reverse -80 -89 18.6826 0.0015
NP_441557.1_5 Forward -89 -80 10.5211 0.00695
NP_441557.1_5 Forward -282 -273 1.08137 0.0794
NP_441557.1_5 Reverse -170 -179 1.08137 0.0794
NP_441557.1_5 Forward -179 -170 0.589713 0.134
NP_441557.1_5 Reverse -273 -282 0.589713 0.134
NP_441557.1_8 Reverse -87 -97 11.7793 0.239
NP_441445.1_1 Forward -98 -79 3.04771 0.22
NP_441445.1_1 Forward -70 -51 0.491109 0.275
NP_441445.1_1 Reverse -71 -90 -0.0988766 0.286
NP_441590.1_4 Reverse -53 -72 5.89851 0.265
NP_442066.2_4 Reverse -282 -301 -9.14533 0.296
NP_442066.2_9 Forward -286 -273 14.6706 0.12
NP_440738.1_5 Reverse -84 -103 0.982764 0.297
NP_441458.1_10 Forward -188 -169 3.73603 0.24
NP_441458.1_10 Reverse -71 -90 2.16274 0.273
NP_442183.1_1 Forward -291 -277 5.40779 0.218
NP_441459.1_8 Reverse -163 -176 10.934 0.286
NP_441574.1_1 Forward -294 -275 3.73603 0.142
NP_442347.1_2 Forward -88 -79 12.4878 0.056
NP_442347.1_2 Reverse -274 -283 10.9145 0.0571
NP_442347.1_2 Forward -178 -169 10.9145 0.0571
NP_442347.1_2 Reverse -81 -90 2.94966 0.292
NP_442645.1_2 Forward -97 -78 -4.6221 0.0598
NP_442645.1_2 Reverse -265 -284 -6.49039 0.0893
NP_442645.1_2 Reverse -72 -91 -14.5535 0.175
NP_442645.1_2 Forward -187 -168 -14.8485 0.183
NP_441037.1_4 Reverse -78 -88 7.9999 0.237
NP_441037.1_4 Forward -284 -274 7.22024 0.237
NP_442047.1_2 Forward -267 -253 12.8809 0.247
NP_441633.1_3 Reverse -271 -284 1.00259 0.11
NP_441633.1_3 Forward -91 -78 -6.17557 0.238
NP_441633.1_3 Forward -181 -168 -6.47056 0.253
NP_441633.1_3 Reverse -50 -63 -6.96221 0.283
NP_440136.1_1 Forward -384 -368 14.3158 0.238
NP_440136.1_2 Forward -88 -81 15.9687 0.0123
NP_440136.1_2 Reverse -81 -88 15.9687 0.0123
NP_440136.1_2 Forward -281 -274 6.23397 0.171
NP_440136.1_2 Reverse -171 -178 6.23397 0.171
NP_440136.1_2 Reverse -274 -281 6.13563 0.193
NP_440136.1_2 Forward -178 -171 6.13563 0.193
NP_442590.1_10 Forward -73 -54 10.2259 0.183
NP_442590.1_10 Reverse -285 -304 5.89931 0.257
NP_442998.1_10 Reverse -275 -282 15.5754 0.0102
NP_442998.1_10 Forward -177 -170 15.5754 0.0102
NP_442998.1_10 Forward -87 -80 15.5754 0.0102
NP_442998.1_10 Reverse -82 -89 5.74231 0.255
NP_440899.1_1 Reverse -40 -59 14.5557 0.11
NP_440299.1_1 Reverse -76 -89 22.8314 0.000547
NP_440299.1_1 Forward -93 -80 12.8017 0.0348
NP_440299.1_1 Reverse -166 -179 8.18017 0.0964
NP_441799.1_1 Forward -93 -79 17.6985 0.0109
NP_441799.1_1 Reverse -76 -90 6.19383 0.179
NP_441799.1_1 Forward -295 -281 4.32555 0.255
NP_441007.1_10 Forward -287 -274 1.69091 0.203
NP_441007.1_10 Forward -66 -53 1.19926 0.207
NP_441007.1_10 Forward -311 -298 -0.767364 0.293
NP_441007.1_10 Reverse -277 -290 -0.865694 0.295
NP_440256.1_1 Forward -92 -73 -9.73531 0.287
NP_441229.1_10 Forward -99 -80 12.5858 0.084
NP_441559.1_1 Reverse -275 -294 25.1722 0.0134
NP_441559.1_8 Forward -184 -170 -7.17857 0.287
NP_441704.1_8 Reverse -69 -88 10.9134 0.146
NP_442866.1_1 Forward -296 -277 2.3594 0.158
NP_442031.1_5 Forward -296 -277 12.3892 0.157
NP_441494.1_6 Forward -66 -53 11.229 0.225
NP_442386.1_9 Forward -90 -81 14.8472 0.0287
NP_442386.1_9 Reverse -79 -88 13.8639 0.0289
NP_442386.1_9 Reverse -281 -290 11.8973 0.0799
NP_442386.1_9 Reverse -272 -281 6.09583 0.23
NP_442386.1_9 Forward -180 -171 6.09583 0.23
NP_442386.1_9 Forward -283 -274 5.9975 0.23
NP_442386.1_9 Reverse -169 -178 5.9975 0.23
NP_442386.1_9 Forward -292 -283 5.70251 0.241
NP_441340.1_5 Forward -88 -81 15.6737 0.0124
NP_441340.1_5 Reverse -81 -88 15.6737 0.0124
NP_441340.1_5 Forward -281 -274 6.23397 0.132
NP_441340.1_5 Reverse -171 -178 6.23397 0.132
NP_441340.1_5 Reverse -274 -281 5.84064 0.208
NP_441340.1_5 Forward -178 -171 5.84064 0.208
NP_441340.1_5 Forward -290 -283 3.97235 0.274
NP_442186.1_9 Reverse -52 -71 5.70265 0.24
NP_442484.1_2 Reverse -69 -88 17.994 0.0304
NP_442791.1_5 Forward -97 -78 -10.6203 0.279
NP_440168.1_8 Reverse -285 -304 5.211 0.216
NP_440168.1_9 Reverse -271 -290 5.80098 0.227
NP_442714.1_5 Forward -299 -280 1.96607 0.238
NP_440586.1_1 Forward -298 -279 -5.60541 0.286
NP_440586.1_1 Forward -301 -282 -5.70374 0.288
NP_440586.1_8 Forward -281 -274 14.69 0.026
NP_440586.1_8 Reverse -171 -178 14.69 0.026
NP_440586.1_8 Forward -88 -81 13.2151 0.026
NP_440586.1_8 Reverse -81 -88 13.2151 0.026
NP_440586.1_8 Reverse -352 -359 7.21693 0.27
NP_442251.1_6 Forward -88 -81 15.2804 0.0124
NP_442251.1_6 Reverse -81 -88 15.2804 0.0124
NP_442251.1_6 Reverse -274 -281 12.0355 0.0627
NP_442251.1_6 Forward -178 -171 12.0355 0.0627
NP_440684.1_9 Forward -95 -81 11.0127 0.183
NP_440684.1_9 Forward -76 -62 8.06273 0.24
NP_441262.1_3 Reverse -170 -177 14.7888 0.0223
NP_441262.1_3 Reverse -80 -87 14.7888 0.0223
NP_441262.1_3 Forward -282 -275 14.7888 0.0223
NP_441262.1_3 Forward -89 -82 13.9038 0.0336
NP_440027.1_3 Reverse -51 -69 11.0314 0.159
NP_440027.1_3 Reverse -282 -300 6.60656 0.225
NP_440027.1_3 Forward -268 -250 5.22993 0.245
NP_440027.1_3 Reverse -281 -299 3.45998 0.272
NP_443051.1_1 Reverse -79 -88 10.4228 0.00754
NP_443051.1_1 Forward -90 -81 1.08137 0.123
NP_443051.1_1 Reverse -169 -178 0.884706 0.125
NP_443051.1_1 Forward -283 -274 0.884706 0.125
NP_439984.1_3 Forward -77 -63 15.5352 0.149
NP_439937.1_8 Forward -293 -274 -4.03212 0.276
NP_439937.1_8 Forward -305 -286 -4.6221 0.286
NP_439937.1_9 Forward -180 -163 -9.49991 0.192
NP_442294.1_3 Reverse -250 -264 11.897 0.297
NP_442239.1_8 Forward -83 -64 13.9625 0.231
NP_439943.1_7 Reverse -75 -94 3.14605 0.29
NP_440372.1_2 Forward -88 -81 16.3621 0.0124
NP_440372.1_2 Reverse -81 -88 16.3621 0.0124
NP_440372.1_2 Forward -281 -274 6.82395 0.0854
NP_440372.1_2 Reverse -171 -178 6.82395 0.0854
NP_440372.1_2 Reverse -274 -281 6.52896 0.188
NP_440372.1_2 Forward -178 -171 6.52896 0.188
NP_441789.1_7 Reverse -85 -104 -5.1145 0.293
NP_440316.1_10 Forward -307 -297 5.38824 0.299
NP_441803.1_2 Forward -287 -268 5.01433 0.171
NP_441803.1_2 Forward -69 -50 -0.590531 0.282
NP_439977.1_5 Reverse -285 -304 -1.18052 0.244
NP_439977.1_5 Reverse -115 -134 -2.26216 0.273
NP_440139.1_1 Forward -297 -278 3.44025 0.205
NP_440139.1_1 Forward -95 -76 0.392004 0.292
NP_441572.1_7 Forward -82 -63 -6.58872 0.296
NP_442887.1_5 Reverse -66 -85 -11.8003 0.27
NP_442384.1_10 Forward -89 -76 17.2272 0.00641
NP_442384.1_10 Reverse -80 -93 8.18076 0.0685
NP_442384.1_10 Forward -76 -63 2.47756 0.224
NP_442384.1_10 Reverse -170 -183 1.39592 0.26
NP_442114.1_4 Reverse -273 -284 11.3667 0.129
NP_441877.1_7 Forward -287 -268 0.392004 0.266
NP_441018.1_7 Forward -99 -80 10.6192 0.201
NP_441018.1_7 Forward -74 -55 7.7676 0.265
NP_441018.1_7 Reverse -76 -95 6.58763 0.285
NP_440530.1_2 Forward -255 -236 11.7008 0.216
NP_442790.1_4 Forward -291 -272 -5.11376 0.138
NP_442262.1_10 Forward -88 -81 14.1988 0.0123
NP_442262.1_10 Reverse -81 -88 14.1988 0.0123
NP_442262.1_10 Forward -281 -274 12.9205 0.0422
NP_442262.1_10 Reverse -171 -178 12.9205 0.0422
NP_442262.1_10 Reverse -352 -359 10.7572 0.124
NP_442262.1_10 Forward -290 -283 9.87221 0.164
NP_442262.1_10 Forward -129 -122 8.20058 0.25
NP_441689.1_5 Forward -91 -81 8.04271 0.166
NP_441689.1_5 Reverse -78 -88 5.78111 0.197
NP_440344.1_10 Reverse -163 -180 0.628827 0.0349
NP_440344.1_10 Reverse -266 -283 -8.90928 0.135
NP_440344.1_10 Reverse -73 -90 -10.1876 0.17
NP_440344.1_10 Forward -289 -272 -13.5308 0.287
NP_440282.1_10 Forward -280 -261 -8.65367 0.263
NP_440531.1_6 Forward -97 -78 -5.31042 0.296
NP_440531.1_6 Reverse -72 -91 -5.40875 0.297
NP_440531.1_8 Reverse -249 -268 3.44104 0.269
NP_442910.1_1 Reverse -73 -92 -6.68705 0.254
NP_441965.1_3 Forward -99 -80 1.57275 0.22
NP_440297.1_9 Reverse -122 -132 -0.0199663 0.282
NP_440297.1_9 Forward -88 -78 -0.118297 0.282
NP_440297.1_9 Reverse -352 -362 -0.511621 0.289
NP_441592.1_4 Forward -282 -263 9.93088 0.124
NP_441592.1_4 Reverse -80 -99 7.57094 0.124
NP_440894.1_10 Reverse -301 -320 4.52268 0.252
NP_440894.1_10 Reverse -262 -281 2.94938 0.279
NP_440999.1_9 Reverse -57 -71 2.45787 0.149
NP_440999.1_9 Reverse -302 -316 -2.45868 0.27
NP_440888.1_2 Forward -89 -75 9.83206 0.113
NP_440888.1_2 Reverse -254 -268 6.0955 0.249
NP_440888.1_2 Reverse -80 -94 5.70218 0.267
NP_440600.1_4 Forward -97 -79 6.11567 0.103
NP_440600.1_4 Reverse -72 -90 0.805796 0.135
NP_440179.1_6 Reverse -53 -72 5.40766 0.24
NP_440052.1_5 Reverse -159 -178 0.392778 0.175
NP_442033.1_10 Reverse -168 -187 -7.37537 0.186
NP_441543.1_2 Forward -88 -79 16.9127 0.00359
NP_441543.1_2 Reverse -81 -90 13.8644 0.021
NP_441543.1_2 Reverse -274 -283 8.65285 0.0968
NP_441543.1_2 Forward -178 -169 8.65285 0.0968
NP_441543.1_2 Reverse -171 -180 5.50626 0.197
NP_441543.1_2 Forward -281 -272 5.50626 0.197
NP_442845.1_2 Forward -95 -81 18.9775 0.0608
NP_442845.1_2 Reverse -267 -281 5.21113 0.24
NP_442845.1_2 Forward -76 -62 5.1128 0.243
NP_442845.1_2 Reverse -74 -88 4.52282 0.258
NP_441834.1_10 Forward -281 -262 0.687771 0.287
NP_441551.1_5 Reverse -287 -303 10.2842 0.193
NP_441469.1_8 Reverse -281 -290 11.7011 0.152
NP_441469.1_8 Reverse -79 -88 6.48957 0.227
NP_441469.1_8 Forward -283 -274 6.39124 0.227
NP_441469.1_8 Reverse -169 -178 6.39124 0.227
NP_442315.1_1 Forward -78 -60 5.82068 0.256
NP_442315.1_3 Reverse -68 -87 8.94757 0.2
NP_443064.1_6 Forward -89 -79 9.75513 0.199
NP_443064.1_6 Reverse -80 -90 8.97947 0.254
NP_442578.1_7 Forward -281 -274 14.6904 0.026
NP_442578.1_7 Reverse -171 -178 14.6904 0.026
NP_442578.1_7 Forward -88 -81 14.5921 0.026
NP_442578.1_7 Reverse -81 -88 14.5921 0.026
NP_440071.1_5 Forward -261 -242 8.84924 0.276
NP_441462.1_2 Reverse -80 -90 10.5998 0.0068
NP_441462.1_2 Forward -89 -79 1.84832 0.081
NP_441462.1_2 Reverse -170 -180 -0.0199663 0.177
NP_441462.1_2 Forward -282 -272 -0.0199663 0.177
NP_441462.1_2 Reverse -52 -62 -0.806614 0.254
NP_441621.1_7 Forward -293 -279 8.45605 0.0612
NP_443062.1_1 Forward -179 -161 17.3216 0.0254
NP_443062.1_6 Forward -237 -218 0.491109 0.294
NP_441601.1_7 Forward -299 -280 8.25926 0.269
NP_440349.1_3 Forward -281 -262 11.5033 0.282
NP_442204.1_1 Forward -183 -172 -0.334653 0.295
NP_441351.1_6 Forward -329 -310 17.109 0.165
NP_441351.1_8 Forward -284 -265 22.6156 0.017
NP_440516.1_2 Reverse -74 -92 0.904127 0.213
NP_440516.1_6 Reverse -101 -115 7.17714 0.284
NP_440516.1_8 Forward -282 -273 10.5211 0.00816
NP_440516.1_8 Reverse -170 -179 10.5211 0.00816
NP_440516.1_8 Reverse -80 -89 9.4395 0.0183
NP_440516.1_8 Forward -89 -80 7.17789 0.0754
NP_440516.1_8 Forward -70 -61 -0.295266 0.232
NP_442428.1_5 Forward -88 -81 15.8704 0.0124
NP_442428.1_5 Reverse -81 -88 15.8704 0.0124
NP_442428.1_5 Forward -281 -274 6.13563 0.209
NP_442428.1_5 Reverse -171 -178 6.13563 0.209
NP_442428.1_5 Reverse -274 -281 6.0373 0.212
NP_442428.1_5 Forward -178 -171 6.0373 0.212
NP_442428.1_5 Reverse -283 -290 4.46401 0.267
NP_440818.1_1 Forward -272 -253 -3.04881 0.276
NP_442120.1_10 Forward -149 -130 -6.78538 0.217
NP_442120.1_10 Reverse -134 -153 -16.1268 0.296
NP_441835.1_3 Reverse -170 -184 20.3541 0.031
NP_440673.1_2 Forward -301 -282 12.8284 0.134
NP_440673.1_2 Reverse -57 -76 10.9749 0.19
NP_440673.1_3 Reverse -82 -89 14.0021 0.0426
NP_440673.1_3 Forward -177 -170 12.4288 0.0426
NP_440673.1_3 Forward -87 -80 12.4288 0.0426
NP_440673.1_3 Reverse -275 -282 12.4288 0.0426
NP_440673.1_3 Forward -289 -282 9.67555 0.179
NP_440673.1_3 Forward -59 -52 6.23397 0.283
NP_441714.1_3 Forward -96 -78 14.5713 0.177
NP_441052.1_2 Forward -89 -79 11.4848 0.0285
NP_441052.1_2 Reverse -80 -90 10.1081 0.0295
NP_441052.1_2 Reverse -170 -180 6.8632 0.0857
NP_441052.1_2 Forward -282 -272 6.8632 0.0857
NP_441052.1_2 Reverse -86 -96 5.97822 0.0968
NP_441052.1_2 Reverse -273 -283 1.25834 0.249
NP_441052.1_2 Forward -179 -169 1.25834 0.249
NP_442219.1_8 Forward -286 -267 14.1584 0.139
NP_442219.1_8 Reverse -263 -282 9.32671 0.233
NP_442219.1_8 Reverse -70 -89 7.39404 0.267
NP_442219.1_9 Reverse -81 -90 18.486 0.00718
NP_442219.1_9 Forward -88 -79 17.7976 0.00718
NP_442219.1_9 Forward -281 -272 8.65285 0.0681
NP_442219.1_9 Reverse -171 -180 8.65285 0.0681
NP_440436.1_4 Forward -88 -79 17.2072 0.00233
NP_440436.1_4 Reverse -81 -90 15.9289 0.00508
NP_440436.1_4 Reverse -274 -283 8.55409 0.0997
NP_440436.1_4 Forward -178 -169 8.55409 0.0997
NP_441884.1_8 Reverse -79 -98 -10.522 0.268
NP_441884.1_9 Reverse -264 -283 -20.2567 0.178
NP_441884.1_9 Forward -303 -284 -23.1083 0.284
NP_441884.1_9 Reverse -270 -289 -25.2716 0.29
NP_440041.1_6 Reverse -379 -398 8.65176 0.285
NP_442907.1_9 Reverse -52 -71 -0.000545616 0.212
NP_442577.1_7 Reverse -339 -358 16.3215 0.131
NP_441719.1_4 Forward -88 -81 16.3621 0.0124
NP_441719.1_4 Reverse -81 -88 16.3621 0.0124
NP_441719.1_4 Forward -281 -274 13.5105 0.026
NP_441719.1_4 Reverse -171 -178 13.5105 0.026
NP_441719.1_4 Reverse -274 -281 6.52896 0.188
NP_441719.1_4 Forward -178 -171 6.52896 0.188
NP_441733.1_10 Forward -285 -272 7.29578 0.156
NP_441004.1_1 Reverse -261 -280 -15.5368 0.275
NP_442366.1_3 Forward -283 -265 -3.52077 0.251
NP_442366.1_3 Reverse -66 -84 -5.09406 0.281
NP_442366.1_5 Reverse -77 -87 15.4175 0.0374
NP_442366.1_5 Reverse -167 -177 13.3526 0.0775
NP_442366.1_5 Forward -92 -82 13.2542 0.0831
NP_442873.1_9 Forward -265 -246 3.44025 0.289
NP_441115.1_4 Reverse -169 -187 10.9331 0.158
NP_442206.1_1 Reverse -52 -71 -10.227 0.219
NP_443054.1_2 Reverse -91 -105 3.14618 0.24
NP_442430.1_2 Forward -71 -52 1.17943 0.285
NP_441851.1_10 Reverse -79 -89 16.9913 0.00552
NP_441851.1_10 Forward -90 -80 6.56821 0.161
NP_441851.1_10 Forward -283 -273 4.60159 0.259
NP_441851.1_10 Reverse -169 -179 4.60159 0.259
NP_440611.1_6 Reverse -274 -293 15.1424 0.112
NP_442011.1_1 Reverse -79 -98 1.86774 0.258
NP_441668.1_4 Forward -339 -320 1.17943 0.22
NP_442515.1_1 Reverse -272 -286 -3.73699 0.297
NP_442515.1_1 Reverse -51 -65 -4.32697 0.298
NP_440593.1_3 Reverse -75 -94 2.94938 0.165
NP_440593.1_3 Forward -94 -75 0.786102 0.193
NP_440165.1_5 Reverse -169 -188 -7.76869 0.276
NP_441349.1_10 Forward -99 -80 10.8159 0.0232
NP_440432.1_9 Reverse -274 -289 0.176559 0.159
NP_440432.1_9 Forward -60 -45 -6.21495 0.29
NP_442843.1_1 Forward -88 -69 -5.01543 0.239
NP_442843.1_1 Forward -359 -340 -6.98204 0.245
NP_442843.1_1 Forward -299 -280 -7.08038 0.245
NP_442843.1_1 Reverse -274 -293 -9.93197 0.272
NP_442843.1_1 Forward -60 -41 -11.0136 0.285
NP_440474.1_8 Reverse -274 -288 13.5686 0.0696
NP_440474.1_8 Reverse -283 -297 8.06211 0.193
NP_440396.1_10 Reverse -274 -290 11.2676 0.186
NP_440431.1_3 Forward -90 -71 -0.0988766 0.138
NP_442450.1_5 Reverse -78 -88 7.55152 0.13
NP_442450.1_5 Reverse -271 -281 5.78156 0.227
NP_440588.1_2 Forward -98 -79 -0.4922 0.15
NP_440588.1_2 Reverse -286 -305 -1.18052 0.155
NP_440588.1_2 Reverse -264 -283 -3.04881 0.177
NP_440195.1_4 Reverse -68 -87 17.699 0.0452
NP_440943.1_6 Forward -298 -279 14.6508 0.253
NP_442006.1_2 Forward -291 -274 -6.746 0.168
NP_442006.1_2 Reverse -194 -211 -18.5457 0.292
NP_441570.1_1 Reverse -249 -267 -8.14232 0.104
NP_441570.1_1 Reverse -80 -98 -14.3372 0.226
NP_441570.1_1 Reverse -170 -188 -15.8121 0.234
NP_441078.1_4 Forward -89 -80 9.93116 0.0203
NP_441078.1_4 Reverse -80 -89 9.83282 0.0226
NP_441078.1_4 Reverse -170 -179 0.196389 0.205
NP_441078.1_4 Forward -282 -273 0.196389 0.205
NP_441078.1_4 Reverse -273 -282 -0.000272808 0.205
NP_441078.1_4 Forward -179 -170 -0.000272808 0.205
NP_441078.1_4 Reverse -52 -61 -1.37691 0.254
NP_440526.1_3 Forward -88 -77 1.04151 0.267
NP_441432.1_8 Reverse -79 -88 16.8143 0.00595
NP_441432.1_8 Forward -90 -81 7.07956 0.105
NP_441432.1_8 Reverse -51 -60 5.50626 0.151
NP_442320.1_8 Reverse -164 -178 -1.96703 0.0847
NP_442320.1_8 Reverse -74 -88 -2.95034 0.1
NP_442320.1_8 Forward -288 -274 -4.13031 0.148
NP_441732.1_2 Reverse -76 -92 -6.92296 0.0558
NP_441732.1_2 Forward -93 -77 -17.4444 0.258
NP_441990.1_8 Forward -302 -283 20.3531 0.0676
NP_442003.1_4 Reverse -81 -100 9.3409 0.3
NP_442815.1_2 Forward -305 -287 4.14905 0.244
NP_440760.1_1 Forward -89 -70 -15.6352 0.152
NP_440760.1_1 Forward -179 -160 -20.0601 0.22
NP_442797.1_7 Reverse -290 -308 0.805796 0.271
NP_442797.1_7 Forward -283 -265 -0.865831 0.288
NP_442353.1_4 Reverse -74 -93 9.34008 0.135
NP_440913.1_1 Reverse -50 -68 6.11567 0.23
NP_440713.1_4 Forward -99 -80 4.62101 0.226
NP_442489.1_7 Forward -89 -80 10.4228 0.0151
NP_442489.1_7 Reverse -80 -89 10.3245 0.0193
NP_442489.1_7 Forward -179 -170 7.47288 0.0613
NP_442489.1_7 Reverse -273 -282 7.47288 0.0613
NP_442489.1_7 Forward -282 -273 0.688044 0.152
NP_442489.1_7 Reverse -170 -179 0.688044 0.152
NP_442489.1_7 Reverse -52 -61 -1.37691 0.195
NP_442489.1_7 Forward -61 -52 -1.6719 0.235
NP_442079.1_7 Reverse -274 -293 11.9958 0.0886
NP_442079.1_7 Forward -178 -159 6.39097 0.161
NP_442079.1_7 Forward -88 -69 0.58944 0.277
NP_440559.1_1 Reverse -81 -90 17.5026 0.00658
NP_440559.1_1 Forward -88 -79 17.4043 0.00658
NP_440559.1_1 Forward -281 -272 6.19458 0.134
NP_440559.1_1 Reverse -171 -180 6.19458 0.134
NP_441659.2_8 Forward -89 -79 15.9097 0.00467
NP_441659.2_8 Reverse -80 -90 8.53483 0.0412
NP_440786.1_10 Reverse -284 -303 17.2074 0.252
NP_440363.1_9 Reverse -52 -70 12.0155 0.3
NP_442913.1_10 Forward -118 -99 -2.75381 0.192
NP_441040.1_2 Reverse -238 -257 -15.7335 0.286
NP_441040.1_5 Reverse -165 -184 4.71934 0.245
NP_441040.1_5 Reverse -75 -94 3.73603 0.268
NP_442849.1_1 Forward -328 -314 19.0758 0.123
NP_442008.1_2 Reverse -290 -309 2.3594 0.289
NP_442776.1_8 Reverse -73 -92 12.9783 0.272
NP_442346.1_2 Forward -100 -81 6.09597 0.281
NP_442346.1_5 Reverse -79 -89 16.2046 0.00277
NP_442346.1_5 Forward -90 -80 14.533 0.0127
NP_442346.1_5 Reverse -51 -61 8.92815 0.121
NP_442346.1_10 Reverse -280 -299 -3.54046 0.294
NP_440352.1_6 Forward -293 -275 18.407 0.0694
NP_440545.1_3 Forward -304 -287 4.3654 0.0717
NP_440545.1_3 Reverse -48 -65 -0.157821 0.149
NP_440545.1_5 Forward -74 -57 8.69197 0.21
NP_440831.1_1 Reverse -134 -153 17.699 0.198
NP_441629.1_9 Forward -280 -261 17.5015 0.217
NP_441786.1_10 Forward -98 -79 9.0459 0.233
NP_440459.1_2 Forward -181 -164 8.20031 0.267
NP_440010.1_4 Reverse -51 -70 7.07848 0.197
NP_440010.1_10 Forward -57 -38 5.89931 0.226
NP_442551.1_4 Forward -63 -48 -3.56002 0.292
NP_442603.1_7 Reverse -170 -184 11.012 0.125
NP_442603.1_7 Forward -89 -75 8.84875 0.162
NP_440946.1_4 Forward -257 -238 10.5209 0.229
NP_441833.1_4 Forward -88 -81 15.9687 0.0124
NP_441833.1_4 Reverse -81 -88 15.9687 0.0124
NP_441833.1_4 Reverse -274 -281 6.52896 0.0924
NP_441833.1_4 Forward -178 -171 6.52896 0.0924
NP_441833.1_4 Forward -281 -274 6.23397 0.163
NP_441833.1_4 Reverse -171 -178 6.23397 0.163
NP_441329.1_6 Reverse -368 -387 -2.91293 0.294
NP_442162.1_9 Forward -88 -81 16.2637 0.0124
NP_442162.1_9 Reverse -81 -88 16.2637 0.0124
NP_442162.1_9 Forward -281 -274 6.62729 0.142
NP_442162.1_9 Reverse -171 -178 6.62729 0.142
NP_442162.1_9 Reverse -274 -281 6.52896 0.178
NP_442162.1_9 Forward -178 -171 6.52896 0.178
NP_440772.1_6 Reverse -274 -293 10.7175 0.23
NP_442199.1_7 Reverse -363 -382 3.24359 0.245
NP_442140.1_3 Forward -88 -78 12.2714 0.0632
NP_442140.1_3 Reverse -81 -91 11.9764 0.0673
NP_442140.1_3 Reverse -274 -284 7.94484 0.124
NP_442140.1_3 Forward -178 -168 6.66654 0.159
NP_442140.1_3 Reverse -283 -293 6.56821 0.162
NP_442140.1_3 Forward -290 -280 6.27322 0.176
NP_442140.1_3 Forward -281 -271 4.79825 0.238
NP_441671.1_10 Forward -332 -313 0.786102 0.281
NP_440875.1_9 Reverse -275 -285 9.44274 0.233
NP_440875.1_9 Reverse -284 -294 7.496 0.262
NP_441813.1_5 Reverse -78 -88 8.63316 0.0367
NP_441813.1_5 Forward -181 -171 8.53483 0.0394
NP_441813.1_5 Forward -91 -81 7.84651 0.0573
NP_441813.1_5 Forward -284 -274 0.275027 0.206
NP_441813.1_5 Reverse -168 -178 0.176696 0.215
NP_440594.1_6 Reverse -267 -286 16.2232 0.169
NP_440590.1_4 Forward -88 -75 19.5871 0.00651
NP_440590.1_4 Forward -178 -165 10.639 0.0261
NP_440590.1_4 Forward -281 -268 0.510939 0.153
NP_440590.1_4 Reverse -81 -94 -0.177378 0.179
NP_440590.1_4 Reverse -171 -184 -3.91395 0.256
NP_440590.1_4 Reverse -52 -65 -5.97891 0.296
NP_440567.1_1 Reverse -81 -95 17.7975 0.0153
NP_440567.1_1 Reverse -274 -288 11.0127 0.0305
NP_440567.1_1 Forward -281 -267 4.52282 0.118
NP_440567.1_1 Forward -178 -164 3.34284 0.145
NP_440567.1_1 Reverse -283 -297 1.76955 0.194
NP_442497.1_10 Forward -88 -79 10.4228 0.0087
NP_442497.1_10 Reverse -81 -90 8.55452 0.0294
NP_442497.1_10 Reverse -274 -283 0.589713 0.153
NP_442497.1_10 Forward -178 -169 0.589713 0.153
NP_440821.1_4 Reverse -78 -88 9.41981 0.0286
NP_440821.1_4 Forward -284 -274 9.02648 0.0364
NP_440821.1_4 Forward -91 -81 0.668351 0.159
NP_440821.1_4 Reverse -168 -178 0.471689 0.174
NP_441239.1_9 Reverse -280 -292 11.8387 0.0547
NP_441239.1_9 Reverse -289 -301 9.77374 0.0972
NP_441239.1_9 Reverse -59 -71 4.46387 0.253
NP_441951.1_3 Reverse -290 -309 14.7491 0.286
NP_441892.1_1 Reverse -71 -88 -2.41943 0.221
NP_441892.1_1 Forward -98 -81 -3.10775 0.233
NP_441892.1_1 Forward -69 -52 -6.15601 0.298
NP_441892.1_4 Forward -71 -52 -0.197208 0.28
NP_442399.1_3 Forward -177 -158 13.3438 0.142
NP_442270.1_9 Reverse -262 -281 7.17762 0.0966
NP_442270.1_9 Reverse -69 -88 -5.31042 0.205
NP_441017.1_6 Reverse -347 -361 11.012 0.285
NP_440900.1_5 Forward -66 -47 18.5356 0.0957
NP_440949.1_7 Forward -290 -271 9.7334 0.258
NP_440546.1_4 Reverse -80 -90 11.6943 0.0748
NP_440546.1_4 Forward -89 -79 10.8217 0.104
NP_440462.1_6 Forward -284 -274 14.7297 0.0186
NP_440462.1_6 Reverse -168 -178 5.78156 0.138
NP_440462.1_6 Reverse -78 -88 1.35667 0.294
NP_442592.1_3 Reverse -277 -296 12.5858 0.184
NP_442592.1_3 Forward -57 -38 8.84924 0.278
NP_440868.1_4 Forward -93 -81 7.80712 0.0637
NP_440868.1_4 Forward -183 -171 7.70879 0.0648
NP_440868.1_4 Forward -286 -274 2.39892 0.156
NP_440868.1_4 Reverse -278 -290 0.825626 0.199
NP_440868.1_4 Reverse -76 -88 -0.944332 0.284
NP_440868.1_4 Reverse -269 -281 -1.14099 0.296
NP_442479.1_5 Forward -165 -146 12.3827 0.222
NP_442402.1_4 Reverse -78 -97 -6.58946 0.259
NP_442039.1_4 Forward -88 -81 15.1821 0.0124
NP_442039.1_4 Reverse -81 -88 15.1821 0.0124
NP_442039.1_7 Forward -298 -288 6.76487 0.299
NP_441811.1_8 Forward -95 -81 15.1426 0.162
NP_441811.1_8 Reverse -74 -88 11.406 0.218
NP_442679.1_1 Reverse -38 -57 -1.37718 0.231
NP_440825.1_7 Reverse -81 -91 15.3494 0.152
NP_440825.1_7 Forward -88 -78 12.9096 0.152
NP_440825.1_7 Forward -178 -168 12.5193 0.155
NP_442837.1_3 Forward -88 -81 15.7721 0.0124
NP_442837.1_3 Reverse -81 -88 15.7721 0.0124
NP_442837.1_3 Reverse -274 -281 12.1338 0.0702
NP_442837.1_3 Forward -178 -171 12.1338 0.0702
NP_442837.1_3 Forward -281 -274 6.0373 0.25
NP_442837.1_3 Reverse -171 -178 6.0373 0.25
NP_442053.1_1 Reverse -273 -282 14.1594 0.0136
NP_442053.1_1 Forward -179 -170 14.1594 0.0136
NP_442053.1_1 Reverse -80 -89 9.24284 0.068
NP_442053.1_1 Forward -89 -80 8.94785 0.07
NP_442053.1_1 Forward -282 -273 7.86621 0.0863
NP_442053.1_1 Reverse -170 -179 7.86621 0.0863
NP_440505.1_3 Reverse -78 -88 9.22315 0.122
NP_440505.1_3 Forward -97 -87 6.66654 0.172
NP_440505.1_3 Forward -284 -274 5.28991 0.236
NP_441701.1_3 Forward -300 -283 6.13536 0.294
NP_440013.1_2 Forward -96 -82 12.4876 0.294
NP_442532.1_7 Forward -300 -286 3.04785 0.21
NP_440914.1_1 Forward -89 -79 16.3248 0.00196
NP_440914.1_1 Reverse -80 -90 8.51751 0.186
NP_440914.1_1 Forward -282 -272 6.66328 0.269
NP_440914.1_1 Reverse -170 -180 6.66328 0.269
NP_441011.1_8 Reverse -81 -90 9.53783 0.123
NP_441011.1_8 Forward -88 -79 8.25953 0.144
NP_441011.1_8 Reverse -274 -283 7.07956 0.179
NP_441011.1_8 Forward -178 -169 7.07956 0.179
NP_441011.1_8 Reverse -283 -292 5.11294 0.283
NP_440037.1_9 Forward -195 -176 17.5998 0.292
NP_442533.1_1 Forward -318 -299 -15.2418 0.253
NP_442533.1_1 Forward -79 -60 -15.3402 0.254
NP_442533.1_6 Reverse -80 -89 15.1427 0.00675
NP_442533.1_6 Forward -89 -80 7.47288 0.0898
NP_442533.1_6 Forward -61 -52 5.60459 0.137
NP_442533.1_6 Forward -306 -297 1.57302 0.294
NP_442541.1_10 Reverse -291 -305 2.26061 0.263
NP_442232.1_3 Forward -97 -78 -3.73712 0.163
NP_442232.1_3 Forward -299 -280 -8.94866 0.239
NP_442322.1_4 Reverse -289 -306 -8.8116 0.286
NP_441219.1_6 Forward -301 -283 9.16393 0.276
NP_441482.1_7 Reverse -74 -88 -0.885388 0.0612
NP_441482.1_7 Forward -185 -171 -10.4235 0.209
NP_439944.1_9 Forward -88 -78 10.5014 0.0887
NP_439944.1_9 Reverse -81 -91 8.82982 0.101
NP_441028.1_6 Forward -47 -37 5.48612 0.255
NP_440116.1_8 Forward -88 -69 6.68596 0.0533
NP_440116.1_8 Forward -281 -262 -4.91709 0.182
NP_440115.1_6 Forward -92 -82 7.05986 0.161
NP_440007.1_2 Forward -76 -57 16.2241 0.181
NP_442728.1_7 Reverse -93 -107 10.816 0.295
NP_441680.1_4 Reverse -53 -72 -1.86883 0.266
NP_441347.1_9 Reverse -155 -168 22.0257 0.129
NP_441961.1_4 Forward -299 -280 5.70265 0.27
NP_441602.1_3 Reverse -286 -305 -5.9004 0.3
NP_441972.1_3 Forward -105 -86 16.3224 0.146
NP_441972.1_5 Forward -88 -69 -2.16383 0.178
NP_441106.1_1 Reverse -79 -88 9.63616 0.0311
NP_441106.1_1 Forward -90 -81 8.75118 0.0469
NP_441106.1_1 Forward -283 -274 8.45619 0.0548
NP_441106.1_1 Reverse -169 -178 8.45619 0.0548
NP_441106.1_1 Forward -307 -298 3.14632 0.243
NP_441106.1_1 Reverse -51 -60 2.85133 0.255
NP_440429.1_2 Forward -88 -69 10.3242 0.267
NP_440797.1_2 Forward -100 -81 13.6412 0.224
NP_441286.1_1 Forward -90 -78 3.77555 0.0435
NP_441286.1_1 Reverse -79 -91 3.67722 0.0467
NP_441286.1_1 Reverse -272 -284 -4.28759 0.154
NP_441286.1_1 Reverse -169 -181 -7.04085 0.3
NP_441286.1_1 Forward -283 -271 -7.04085 0.3
NP_440670.1_8 Reverse -80 -89 8.94785 0.0606
NP_440670.1_8 Forward -89 -80 8.84951 0.0606
NP_440886.1_7 Forward -283 -273 6.86274 0.113
NP_440886.1_7 Reverse -169 -179 6.86274 0.113
NP_440886.1_7 Reverse -60 -70 5.78111 0.163
NP_440886.1_7 Reverse -66 -76 4.01116 0.255
NP_440886.1_7 Reverse -294 -304 3.32285 0.287
NP_442614.1_2 Reverse -80 -94 12.1926 0.166
NP_442382.1_7 Reverse -67 -86 6.68596 0.229
NP_440907.2_8 Reverse -274 -284 8.04271 0.117
NP_440907.2_8 Forward -88 -78 7.64939 0.117
NP_440907.2_8 Forward -178 -168 4.7978 0.243
NP_440907.2_8 Reverse -81 -91 4.7978 0.243
NP_441021.1_1 Reverse -292 -311 -9.83364 0.223
NP_441626.1_2 Forward -88 -81 15.7721 0.0124
NP_441626.1_2 Reverse -81 -88 15.7721 0.0124
NP_441626.1_2 Forward -281 -274 6.13563 0.177
NP_441626.1_2 Reverse -171 -178 6.13563 0.177
NP_441626.1_2 Reverse -274 -281 5.93897 0.231
NP_441626.1_2 Forward -178 -171 5.93897 0.231
NP_442211.1_3 Forward -88 -69 6.98569 0.29
NP_442794.1_1 Reverse -76 -88 19.1152 0.00716
NP_442794.1_1 Forward -183 -171 11.937 0.0721
NP_442794.1_1 Reverse -269 -281 4.36554 0.266
NP_442615.1_1 Forward -98 -80 6.214 0.0362
NP_442615.1_1 Reverse -71 -89 -4.99573 0.201
NP_441962.1_4 Reverse -268 -287 10.7175 0.0495
NP_441962.1_4 Forward -305 -286 3.73603 0.102
NP_441962.1_4 Forward -296 -277 -2.85214 0.138
NP_441962.1_4 Forward -94 -75 -4.91709 0.162
NP_441962.1_4 Reverse -292 -311 -11.7019 0.244
NP_440387.1_1 Reverse -80 -96 4.48343 0.0417
NP_440387.1_1 Forward -282 -266 3.89344 0.0503
NP_440387.1_1 Reverse -273 -289 -4.36636 0.185
NP_440387.1_1 Forward -89 -73 -4.95634 0.208
NP_440855.1_4 Reverse -281 -300 14.7491 0.203
NP_441431.1_2 Forward -294 -280 13.5686 0.0869
NP_441431.1_2 Reverse -58 -72 13.372 0.0918
NP_441431.1_2 Forward -92 -78 8.16044 0.222
NP_441431.1_2 Forward -64 -50 6.48882 0.269
NP_441431.1_2 Reverse -279 -293 5.70218 0.291
NP_441488.1_7 Forward -288 -269 1.86774 0.285
NP_441488.1_8 Reverse -75 -89 9.93039 0.146
NP_441488.1_8 Reverse -268 -282 9.6354 0.148
NP_441488.1_8 Forward -184 -170 8.16044 0.204
NP_441836.1_2 Forward -95 -76 2.94938 0.163
NP_441174.1_2 Forward -294 -280 14.6509 0.156
NP_440814.1_4 Reverse -71 -90 -11.5053 0.225
NP_440114.1_10 Reverse -80 -94 5.99778 0.289
NP_440114.1_10 Reverse -282 -296 5.89945 0.292
NP_442437.1_8 Reverse -274 -293 3.83436 0.281
NP_442324.1_1 Reverse -314 -333 13.6675 0.251
NP_440287.1_6 Reverse -71 -90 4.32602 0.206
NP_440293.1_3 Forward -308 -289 -0.295539 0.228
NP_440293.1_10 Forward -104 -85 5.70265 0.207
NP_440766.1_4 Reverse -269 -283 6.19444 0.104
NP_440766.1_4 Forward -183 -169 5.89945 0.108
NP_439988.1_7 Reverse -275 -289 13.077 0.292
NP_441237.1_9 Forward -88 -78 14.828 0.0242
NP_441237.1_9 Forward -281 -271 12.3697 0.125
NP_441237.1_9 Reverse -52 -62 10.3048 0.237
NP_441979.1_6 Forward -334 -315 18.9773 0.214
NP_442867.1_3 Forward -149 -130 14.2574 0.073
NP_440457.1_1 Forward -134 -122 1.61227 0.232
NP_440457.1_1 Forward -306 -294 1.51394 0.236
NP_441801.1_4 Forward -272 -262 2.63497 0.29
NP_442680.1_5 Reverse -354 -373 0.3653 0.268
NP_441332.1_6 Reverse -59 -69 12.5181 0.223
NP_442514.1_5 Forward -185 -166 -1.37794 0.199
NP_440554.1_4 Reverse -274 -284 4.3066 0.195
NP_440554.1_4 Reverse -81 -91 1.84832 0.287
NP_441885.1_5 Reverse -80 -90 19.6462 0.00179
NP_441885.1_5 Forward -89 -79 11.1898 0.00775
NP_441885.1_5 Forward -282 -272 2.33998 0.0799
NP_441885.1_5 Reverse -170 -180 2.33998 0.0799
NP_440478.1_10 Reverse -168 -182 6.48943 0.291
NP_442341.1_7 Forward -180 -166 10.9143 0.0591
NP_442341.1_7 Reverse -272 -286 9.43936 0.0751
NP_442341.1_7 Forward -90 -76 7.66941 0.0994
NP_442341.1_9 Forward -304 -290 7.86545 0.185
NP_440423.1_6 Forward -290 -271 -13.4719 0.22
NP_443000.1_7 Reverse -78 -88 10.3048 0.0345
NP_443000.1_7 Forward -91 -81 9.61647 0.0437
NP_443000.1_7 Forward -181 -171 1.06167 0.274
NP_440076.1_5 Forward -292 -273 12.6833 0.256
NP_440507.2_3 Reverse -264 -283 8.84842 0.241
NP_441842.1_1 Reverse -82 -95 13.0967 0.171
NP_441842.1_10 Forward -289 -275 13.4709 0.0753
NP_441842.1_10 Reverse -163 -177 7.37441 0.258
NP_440275.1_3 Forward -284 -274 8.4365 0.0602
NP_440275.1_3 Reverse -78 -88 8.04317 0.0602
NP_440091.1_1 Forward -93 -81 10.5604 0.0458
NP_440091.1_1 Forward -295 -283 2.20226 0.197
NP_440679.1_10 Reverse -275 -294 1.76941 0.092
NP_440679.1_10 Forward -298 -279 -20.0601 0.283
NP_442451.1_2 Forward -284 -265 -0.39387 0.158
NP_442451.1_2 Reverse -283 -302 -5.60541 0.226
NP_439962.1_4 Forward -299 -280 14.8474 0.106
NP_439962.1_4 Reverse -274 -293 -3.54046 0.253
NP_440149.1_8 Forward -89 -70 7.66927 0.0628
NP_440149.1_8 Forward -76 -57 -7.96535 0.296
NP_441875.1_7 Forward -345 -335 15.5163 0.227
NP_441105.1_3 Forward -100 -81 11.0125 0.038
NP_441105.1_3 Forward -311 -292 -3.54046 0.181
NP_441105.1_3 Reverse -69 -88 -9.047 0.283
NP_441105.1_3 Reverse -159 -178 -9.44032 0.289
NP_441105.1_3 Reverse -255 -274 -9.83364 0.297
NP_440216.1_1 Reverse -80 -94 -10.0302 0.145
NP_440216.1_9 Forward -267 -258 13.8644 0.184
NP_440172.1_1 Reverse -80 -90 17.2863 0.00544
NP_440172.1_1 Reverse -170 -180 6.27322 0.107
NP_440172.1_1 Forward -282 -272 6.27322 0.107
NP_440172.1_1 Forward -89 -79 5.28991 0.146
NP_442015.1_10 Forward -183 -170 4.44418 0.169
NP_442015.1_10 Forward -93 -80 3.5592 0.179
NP_442015.1_10 Reverse -63 -76 1.49425 0.204
NP_442015.1_10 Reverse -76 -89 1.39592 0.204
NP_441226.1_7 Forward -88 -81 14.4934 0.0123
NP_441226.1_7 Reverse -81 -88 14.4934 0.0123
NP_441226.1_7 Forward -69 -62 9.77352 0.131
NP_442834.1_9 Reverse -144 -163 13.0775 0.113
NP_441111.1_7 Forward -88 -80 18.7023 0.00294
NP_441111.1_7 Reverse -274 -282 8.86921 0.0589
NP_441111.1_7 Forward -178 -170 8.86921 0.0589
NP_441111.1_7 Reverse -81 -89 8.86921 0.0589
NP_442379.1_10 Forward -96 -79 -0.256152 0.223
NP_441766.1_2 Reverse -80 -89 17.896 0.00297
NP_441766.1_2 Forward -89 -80 9.4395 0.0285
NP_441766.1_2 Reverse -273 -282 8.55452 0.054
NP_441766.1_2 Forward -179 -170 8.55452 0.054
NP_443052.1_9 Reverse -82 -101 -0.590531 0.213
NP_443052.1_9 Reverse -290 -309 -5.31042 0.266
NP_440591.1_9 Reverse -266 -284 13.1955 0.0931
NP_442154.1_1 Forward -78 -60 -15.7138 0.224
NP_440261.1_5 Reverse -53 -66 -2.73398 0.0924
NP_440261.1_5 Reverse -274 -287 -10.7971 0.21
NP_440261.1_5 Forward -88 -75 -12.1738 0.272
NP_440988.1_10 Reverse -59 -73 5.18926 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGGCGGAAAAGTCTGCCTCTATCAATATTTTGCAGGTTAGTTCCATCGGTAGTTTTGGTCGACTTTACCTGGGAGGGGAAGAAAGGGATATTAAGGCGGGGGCGCGGGCAGCCATTGCGGCGATCGAGAATGCCCCAGGCAAAGTGCCCACCCTGGAAGGTAAAAATGAATAATGGAGGCTCGTCACAATACATTTCACCGTAGGCTGCTTCTCTATCCCTCTCGATCGCCGAAGAAACGTTAACAACCTAGGCCAGAGCATTTTCCTAGTGAGATGGAAGCGTAACCACGTACAATGGGCTTCTGGGGTTAGCGATCGCCAAAGATGTTGGCCGTCGGGGCCGTTGCCTATTTTGTCGCCCGTTAATTCTTTCACCGAAGTATTAAGTTCACTGTTCCC

CDS

ATGACTGAGTCTCTACCCATTGTTTATCTTTCCGTCTTATTGATTATTTTGGGGGGACTGGGCATATTTGTCTTCAGTCAGGTGTTAAAGGCCCGTCGCCTAGAAAATACCTTTAGCAAACTACAAAAGAAGCTACAAAACACCAAAGGTACCGCCCAGGAATATTATCAATTGGGTAGCATTTATTTAGACAAAAAATTATATTCCCAATCGATTAATTTATTTCAAAAAGCCCTCAAAATGGCCGAGCAAGTGGAGCCAGAAAACCAAGCTTTGATTTACAATGCTATGGGCTATGCCTGTTTCGCTCAGGAGCAATTTGATCTGGCCATTCGCCATTACAAAGATGCCTTGAAACTATACCCAGATTATGTCATTGCTTTAAATAACTTAGCCAATGTTTATGAAAAAAAACAAATGGTTAACAAGGCGTTGGAAACCTACCAAGAAACTTTAGCAATAGAACCCAACAATAAAGTAGCTCAACGGCGGGCCAATTCCTTGAAAAAACGGCTTGTCGAGACTTAG

Protein

MTESLPIVYLSVLLIILGGLGIFVFSQVLKARRLENTFSKLQKKLQNTKGTAQEYYQLGSIYLDKKLYSQSINLFQKALKMAEQVEPENQALIYNAMGYACFAQEQFDLAIRHYKDALKLYPDYVIALNNLANVYEKKQMVNKALETYQETLAIEPNNKVAQRRANSLKKRLVET