Your browser is old and dusty. Try Google Chrome!

Details for slr0163

ORF slr0163
Accession NP_441888.1
Symbol pilC'
Category Chemotaxis
Definition a part of pilC, pilin biogenesis protein, required for twitching motility
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -220 -234 11.8976 0.23
NP_441061.1_2 Forward -208 -194 0.982901 0.196
NP_441061.1_2 Forward -385 -371 -1.5737 0.265
NP_440815.1_5 Reverse -68 -87 10.1275 0.225
NP_442291.1_5 Forward -78 -62 -0.629782 0.187
NP_441453.1_4 Reverse -200 -208 14.7691 0.0119
NP_441453.1_4 Reverse -68 -76 7.29591 0.0589
NP_441453.1_4 Forward -209 -201 6.80426 0.121
NP_441453.1_4 Forward -77 -69 6.70593 0.121
NP_441960.1_2 Reverse -267 -286 16.5191 0.272
NP_440226.1_1 Reverse -200 -219 20.1573 0.0103
NP_440226.1_1 Reverse -68 -87 8.16093 0.0926
NP_440226.1_1 Forward -77 -58 6.98095 0.115
NP_442655.1_10 Reverse -211 -230 -19.5684 0.282
NP_442173.1_1 Forward -208 -200 12.0158 0.0316
NP_442173.1_1 Reverse -201 -209 12.0158 0.0316
NP_442173.1_1 Forward -76 -68 7.59091 0.163
NP_442173.1_1 Reverse -69 -77 5.82095 0.2
NP_442752.1_4 Forward -209 -202 13.8055 0.0199
NP_442752.1_4 Forward -77 -70 13.8055 0.0199
NP_442752.1_4 Reverse -377 -384 5.44732 0.202
NP_443027.1_4 Forward -79 -69 9.32148 0.166
NP_442975.1_10 Reverse -64 -78 1.67063 0.293
NP_441225.1_1 Reverse -202 -221 -3.63879 0.191
NP_440784.1_7 Forward -208 -201 6.23397 0.241
NP_440784.1_7 Reverse -69 -76 6.23397 0.241
NP_440784.1_7 Reverse -201 -208 6.13563 0.241
NP_440784.1_7 Forward -76 -69 6.13563 0.241
NP_442909.1_7 Forward -208 -194 17.3052 0.0694
NP_442062.1_8 Reverse -377 -387 11.9764 0.0377
NP_442062.1_8 Reverse -200 -210 9.61647 0.0587
NP_442062.1_8 Forward -209 -199 8.23984 0.0793
NP_442062.1_8 Forward -77 -67 7.84651 0.0871
NP_442062.1_8 Reverse -68 -78 5.19158 0.181
NP_441859.1_3 Forward -210 -191 10.52 0.12
NP_440304.1_4 Reverse -198 -208 8.1415 0.0859
NP_440304.1_4 Reverse -375 -385 7.35486 0.118
NP_442242.1_4 Forward -76 -69 12.4288 0.0393
NP_440044.1_8 Forward -322 -303 0.786102 0.191
NP_441208.1_9 Reverse -197 -211 18.2892 0.0647
NP_442742.1_9 Reverse -378 -397 -14.1602 0.293
NP_442110.1_7 Reverse -68 -82 -0.197071 0.276
NP_442110.1_7 Reverse -254 -268 -0.492064 0.291
NP_442367.1_10 Reverse -375 -389 7.57108 0.279
NP_442726.1_1 Reverse -261 -280 8.75091 0.268
NP_441925.1_4 Reverse -48 -67 -16.4225 0.282
NP_441083.1_5 Forward -209 -199 16.7946 0.00546
NP_441083.1_5 Reverse -200 -210 10.1081 0.0208
NP_441083.1_5 Reverse -68 -78 1.84832 0.198
NP_441083.1_5 Forward -77 -67 -0.118297 0.256
NP_442827.1_8 Forward -217 -198 9.83173 0.0665
NP_441738.1_2 Reverse -202 -209 15.28 0.0102
NP_441738.1_2 Reverse -70 -77 15.28 0.0102
NP_441738.1_2 Forward -384 -377 10.2652 0.101
NP_441558.1_5 Forward -79 -60 9.53756 0.118
NP_441558.1_5 Reverse -198 -217 8.75091 0.141
NP_441558.1_5 Reverse -312 -331 8.45592 0.15
NP_440209.1_1 Forward -77 -69 14.8674 0.012
NP_440209.1_1 Forward -209 -201 8.57422 0.0425
NP_440209.1_1 Reverse -200 -208 8.47588 0.0457
NP_440209.1_3 Reverse -193 -212 15.3391 0.202
NP_442136.1_4 Reverse -202 -221 4.91521 0.295
NP_440056.1_1 Forward -274 -255 13.6675 0.146
NP_441713.1_1 Forward -83 -64 -11.3086 0.225
NP_441713.1_5 Reverse -70 -89 5.30933 0.286
NP_441770.1_4 Reverse -267 -286 -12.0953 0.291
NP_440178.1_7 Reverse -199 -218 -11.2103 0.088
NP_440178.1_7 Reverse -67 -86 -21.4367 0.223
NP_440178.1_7 Forward -78 -59 -22.5183 0.267
NP_441716.1_1 Reverse -86 -100 8.75105 0.133
NP_442111.1_4 Reverse -199 -213 8.65272 0.0709
NP_442111.1_4 Reverse -44 -58 3.14618 0.253
NP_441624.1_7 Reverse -260 -274 10.816 0.217
NP_441163.1_1 Reverse -192 -209 10.1662 0.217
NP_440906.1_5 Forward -76 -69 12.0355 0.0724
NP_440906.1_5 Reverse -69 -76 12.0355 0.0724
NP_440906.1_5 Forward -208 -201 6.23397 0.234
NP_440906.1_5 Reverse -201 -208 6.13563 0.241
NP_440747.1_10 Forward -212 -200 -2.02597 0.0196
NP_440747.1_10 Forward -80 -68 -2.4193 0.0434
NP_440747.1_10 Reverse -197 -209 -11.7607 0.142
NP_440747.1_10 Reverse -65 -77 -12.0557 0.199
NP_441130.1_5 Reverse -77 -96 20.944 0.131
NP_441130.1_10 Forward -211 -197 11.111 0.107
NP_441130.1_10 Forward -79 -65 7.37441 0.162
NP_441130.1_10 Reverse -198 -212 5.89945 0.211
NP_442634.1_4 Reverse -198 -212 2.94952 0.124
NP_442634.1_4 Reverse -66 -80 -5.11362 0.235
NP_440403.1_10 Reverse -110 -129 1.0811 0.291
NP_440057.1_4 Forward -274 -255 15.4548 0.184
NP_442848.1_1 Reverse -194 -208 -2.65535 0.263
NP_443018.1_3 Reverse -201 -208 11.7405 0.0655
NP_443018.1_3 Forward -208 -201 5.44732 0.193
NP_443018.1_3 Forward -76 -69 5.34899 0.212
NP_443018.1_3 Reverse -69 -76 5.34899 0.212
NP_441316.1_7 Reverse -375 -390 -1.20007 0.228
NP_440376.1_1 Forward -209 -200 15.7327 0.00625
NP_440376.1_1 Reverse -200 -209 9.63616 0.0385
NP_440376.1_1 Reverse -377 -386 3.7363 0.195
NP_440376.1_1 Reverse -68 -77 -0.000272808 0.285
NP_440376.1_1 Forward -77 -68 -0.0986038 0.285
NP_442687.1_7 Forward -210 -200 13.5497 0.0466
NP_442687.1_7 Reverse -199 -209 8.73149 0.101
NP_442687.1_7 Forward -78 -68 6.37155 0.171
NP_442485.1_3 Reverse -108 -127 -5.99873 0.297
NP_441422.1_7 Reverse -66 -83 -0.157821 0.16
NP_441422.1_7 Reverse -198 -215 -5.46769 0.247
NP_441029.1_8 Forward -275 -256 15.7316 0.242
NP_441950.1_7 Forward -66 -47 -0.0988766 0.191
NP_441950.1_7 Forward -85 -66 -8.94866 0.287
NP_440887.1_8 Reverse -266 -280 18.7808 0.0868
NP_440360.1_10 Reverse -47 -61 3.44117 0.232
NP_442658.1_1 Reverse -66 -76 11.7793 0.0727
NP_442658.1_1 Forward -388 -378 10.0093 0.136
NP_442658.1_1 Forward -211 -201 9.02601 0.169
NP_442658.1_1 Forward -90 -80 8.53436 0.189
NP_442658.1_1 Reverse -198 -208 8.04271 0.199
NP_442782.1_2 Reverse -113 -127 2.16287 0.277
NP_442496.1_5 Reverse -29 -47 15.6538 0.139
NP_441414.1_9 Forward -209 -190 1.86774 0.0705
NP_440720.1_4 Forward -162 -143 15.1416 0.286
NP_442937.1_5 Reverse -267 -286 7.7676 0.241
NP_442937.1_5 Forward -214 -195 7.17762 0.26
NP_442937.1_5 Reverse -120 -139 6.09597 0.288
NP_442321.1_4 Reverse -161 -180 -8.45701 0.289
NP_441958.1_5 Reverse -199 -209 10.6981 0.0112
NP_441958.1_5 Forward -210 -200 10.0098 0.0167
NP_441958.1_5 Forward -78 -68 1.455 0.0956
NP_441958.1_5 Reverse -67 -77 1.06167 0.116
NP_442836.1_5 Reverse -194 -213 1.17943 0.287
NP_440203.1_5 Reverse -71 -81 9.91099 0.245
NP_440984.1_7 Reverse -195 -209 11.111 0.122
NP_442911.1_2 Reverse -190 -209 10.8159 0.0141
NP_442911.1_2 Forward -219 -200 -2.95047 0.105
NP_442911.1_2 Forward -396 -377 -5.9004 0.17
NP_442911.1_2 Forward -87 -68 -5.9004 0.17
NP_441580.1_6 Reverse -75 -94 -7.76869 0.246
NP_440153.1_5 Forward -208 -194 2.35953 0.225
NP_443055.1_6 Forward -283 -265 -1.84987 0.284
NP_440993.1_2 Reverse -195 -211 2.22182 0.269
NP_440993.1_3 Forward -105 -86 14.8466 0.0527
NP_440138.1_6 Forward -208 -189 7.07848 0.215
NP_440138.1_6 Forward -273 -254 5.99684 0.227
NP_442002.1_9 Forward -210 -203 10.7572 0.185
NP_440809.1_9 Reverse -289 -307 -6.4707 0.225
NP_441294.1_7 Reverse -64 -78 12.8982 0.08
NP_442438.1_10 Forward -82 -68 12.4876 0.0412
NP_441000.1_6 Reverse -199 -213 3.14618 0.118
NP_441000.1_6 Forward -78 -64 -5.11362 0.261
NP_440147.1_4 Forward -211 -198 11.3273 0.0326
NP_440147.1_4 Reverse -66 -79 8.18076 0.0546
NP_440147.1_4 Reverse -198 -211 2.2809 0.209
NP_441550.1_8 Reverse -198 -208 18.8591 0.00654
NP_441550.1_8 Forward -211 -201 9.22267 0.103
NP_441550.1_8 Forward -79 -69 7.45273 0.159
NP_441916.1_7 Reverse -200 -210 8.82982 0.0409
NP_441916.1_7 Forward -209 -199 7.15819 0.0745
NP_441916.1_7 Forward -77 -67 4.99491 0.15
NP_441916.1_7 Reverse -68 -78 1.455 0.285
NP_440465.1_10 Reverse -197 -216 -0.983855 0.29
NP_441041.1_4 Reverse -254 -273 -10.7186 0.236
NP_441041.1_4 Reverse -200 -219 -11.5053 0.248
NP_441041.1_7 Reverse -65 -77 15.4833 0.025
NP_441041.1_7 Forward -212 -200 12.6652 0.0611
NP_441041.1_7 Forward -389 -377 11.6934 0.0733
NP_440569.1_10 Forward -166 -147 8.06865 0.231
NP_442004.1_6 Reverse -68 -82 7.9644 0.15
NP_441725.1_5 Forward -208 -198 9.02648 0.0553
NP_441725.1_5 Reverse -378 -388 6.17489 0.115
NP_441725.1_5 Forward -385 -375 1.65166 0.13
NP_441725.1_5 Reverse -69 -79 -0.708283 0.267
NP_441725.1_5 Reverse -201 -211 -0.806614 0.271
NP_439966.1_7 Forward -211 -201 7.74772 0.15
NP_439966.1_7 Reverse -198 -208 7.15773 0.154
NP_439966.1_7 Forward -79 -69 4.99446 0.248
NP_439966.1_9 Forward -211 -202 10.7178 0.0863
NP_439966.1_9 Forward -79 -70 0.884706 0.253
NP_442941.1_3 Reverse -69 -79 1.25834 0.15
NP_440289.1_2 Forward -212 -199 3.26421 0.0811
NP_440289.1_2 Reverse -65 -78 3.26421 0.0811
NP_440289.1_2 Reverse -197 -210 -4.9956 0.294
NP_440983.1_5 Forward -281 -262 -0.000545616 0.217
NP_440983.1_5 Reverse -68 -87 -5.21209 0.265
NP_442281.1_1 Reverse -63 -77 11.5037 0.0462
NP_442281.1_1 Reverse -195 -209 8.16044 0.0845
NP_441334.1_7 Reverse -66 -85 -13.2752 0.201
NP_440437.1_1 Forward -215 -196 -2.65548 0.22
NP_442012.1_1 Reverse -194 -213 7.86593 0.108
NP_442012.1_1 Forward -83 -64 2.0644 0.205
NP_442288.1_3 Reverse -253 -270 6.43035 0.269
NP_441556.1_4 Reverse -74 -93 10.1015 0.286
NP_441644.1_6 Reverse -200 -210 9.81266 0.0678
NP_441644.1_6 Reverse -68 -78 6.17443 0.165
NP_441644.1_6 Forward -209 -199 6.0761 0.167
NP_442029.1_6 Forward -197 -178 8.45592 0.207
NP_440253.1_2 Reverse -200 -218 1.49411 0.159
NP_440929.1_8 Reverse -200 -209 16.5193 0.00413
NP_440929.1_8 Forward -209 -200 9.53783 0.0296
NP_442933.1_10 Forward -77 -68 13.9627 0.0192
NP_442933.1_10 Reverse -68 -77 8.1612 0.0885
NP_442933.1_10 Reverse -200 -209 8.06287 0.0885
NP_442933.1_10 Forward -209 -200 7.96454 0.0937
NP_441751.2_8 Reverse -69 -83 5.21113 0.0448
NP_441751.2_8 Forward -385 -371 -4.91696 0.187
NP_441751.2_8 Forward -208 -194 -6.39192 0.265
NP_442554.1_8 Forward -208 -198 14.6313 0.0129
NP_442554.1_8 Reverse -69 -79 8.33817 0.0754
NP_442554.1_8 Reverse -201 -211 6.17489 0.125
NP_442554.1_9 Reverse -262 -281 12.6925 0.279
NP_442970.1_1 Forward -165 -151 10.9932 0.269
NP_441762.1_7 Reverse -199 -211 11.1504 0.0142
NP_441762.1_7 Reverse -67 -79 3.2839 0.0676
NP_441762.1_7 Forward -210 -198 2.0056 0.0705
NP_442142.1_4 Reverse -76 -89 5.42692 0.192
NP_442142.1_4 Reverse -65 -78 5.32859 0.194
NP_442292.1_1 Reverse -69 -78 8.75118 0.0306
NP_442292.1_1 Forward -208 -199 -0.196935 0.239
NP_442292.1_1 Reverse -201 -210 -0.196935 0.239
NP_442476.1_6 Forward -208 -194 8.65272 0.0982
NP_442476.1_6 Reverse -69 -83 8.65272 0.0982
NP_442476.1_6 Reverse -378 -392 0.0979218 0.274
NP_443009.1_5 Reverse -376 -387 11.0712 0.068
NP_443009.1_5 Reverse -199 -210 10.9729 0.0699
NP_443009.1_5 Forward -387 -376 5.95804 0.18
NP_443009.1_5 Forward -78 -67 4.8764 0.226
NP_443009.1_5 Reverse -67 -78 4.18809 0.259
NP_440357.1_3 Forward -211 -192 8.25926 0.206
NP_441448.1_1 Forward -56 -37 6.98095 0.236
NP_440158.1_8 Forward -388 -369 9.63589 0.268
NP_440183.1_1 Reverse -255 -274 12.6841 0.244
NP_441198.1_8 Forward -388 -378 13.955 0.101
NP_441198.1_8 Reverse -375 -385 10.2438 0.289
NP_441468.1_1 Forward -208 -201 6.13563 0.209
NP_441468.1_1 Reverse -69 -76 6.13563 0.209
NP_441468.1_1 Reverse -201 -208 6.0373 0.223
NP_441468.1_1 Forward -76 -69 6.0373 0.223
NP_441020.2_6 Forward -211 -194 10.6586 0.139
NP_441673.1_1 Forward -209 -200 11.1111 0.0121
NP_441673.1_1 Reverse -200 -209 11.0128 0.018
NP_441673.1_1 Reverse -68 -77 1.37636 0.114
NP_441673.1_1 Forward -77 -68 1.1797 0.163
NP_441826.1_2 Reverse -194 -208 -1.47537 0.248
NP_442811.1_2 Forward -271 -252 -2.85214 0.281
NP_441637.1_9 Reverse -162 -180 -1.55415 0.292
NP_441637.1_9 Reverse -265 -283 -2.63579 0.292
NP_442868.1_6 Forward -79 -69 7.64985 0.0726
NP_442868.1_6 Reverse -198 -208 6.96153 0.0919
NP_442868.1_6 Forward -388 -378 1.65166 0.205
NP_442868.1_6 Reverse -66 -76 -0.0199663 0.255
NP_441612.1_2 Reverse -110 -120 7.29072 0.256
NP_442427.1_8 Reverse -59 -78 8.35759 0.203
NP_442808.1_1 Forward -276 -266 12.1726 0.0481
NP_442808.1_1 Reverse -199 -209 9.321 0.0481
NP_442808.1_1 Forward -210 -200 8.73102 0.0481
NP_441882.1_6 Reverse -258 -277 -2.75381 0.25
NP_442692.1_10 Reverse -151 -164 16.8074 0.213
NP_440145.1_3 Forward -219 -200 7.47261 0.0466
NP_440145.1_3 Forward -87 -68 -1.57384 0.154
NP_442542.1_2 Forward -211 -198 10.639 0.125
NP_442050.1_5 Reverse -198 -208 12.7626 0.0516
NP_442050.1_5 Forward -388 -378 8.92768 0.206
NP_441937.1_1 Forward -100 -81 13.3725 0.0738
NP_440558.1_2 Forward -86 -67 -6.78538 0.28
NP_441518.1_3 Forward -87 -68 -13.8652 0.264
NP_441878.1_6 Reverse -199 -209 10.4031 0.0176
NP_441878.1_6 Reverse -67 -77 0.766681 0.134
NP_441878.1_6 Forward -210 -200 0.668351 0.139
NP_441878.1_6 Reverse -376 -386 -7.49312 0.231
NP_441036.1_8 Forward -210 -200 16.4996 0.00407
NP_441036.1_8 Reverse -67 -77 6.56821 0.225
NP_441557.1_5 Forward -209 -200 10.2261 0.0144
NP_441557.1_5 Reverse -200 -209 10.1278 0.0188
NP_441557.1_5 Forward -77 -68 8.84951 0.0343
NP_441557.1_5 Reverse -68 -77 0.786375 0.106
NP_441445.1_1 Forward -218 -199 12.9791 0.0621
NP_441445.1_1 Forward -86 -67 3.6377 0.21
NP_441590.1_4 Forward -234 -215 4.22689 0.29
NP_440101.1_10 Reverse -254 -273 4.22769 0.222
NP_442183.1_1 Forward -209 -195 15.3392 0.022
NP_442183.1_1 Reverse -377 -391 5.1128 0.231
NP_440440.1_2 Reverse -116 -135 17.6982 0.163
NP_441549.1_9 Reverse -196 -214 -0.669169 0.148
NP_442347.1_2 Reverse -201 -210 8.94785 0.0718
NP_442347.1_2 Forward -368 -359 4.0313 0.284
NP_442347.1_2 Reverse -69 -78 3.93297 0.284
NP_442347.1_2 Forward -36 -27 3.7363 0.284
NP_442645.1_2 Reverse -71 -90 -16.7168 0.24
NP_442645.1_2 Forward -85 -66 -22.8133 0.296
NP_441037.1_4 Reverse -198 -208 14.9194 0.028
NP_441037.1_4 Forward -79 -69 8.48718 0.237
NP_441037.1_4 Forward -211 -201 7.22024 0.237
NP_441037.1_4 Forward -388 -378 5.95329 0.289
NP_442594.1_8 Reverse -188 -207 3.83436 0.279
NP_441633.1_3 Forward -211 -198 5.72248 0.0481
NP_441633.1_3 Reverse -198 -211 -5.88057 0.236
NP_440136.1_2 Reverse -378 -385 11.1505 0.0519
NP_440136.1_2 Forward -208 -201 6.23397 0.171
NP_440136.1_2 Reverse -69 -76 6.23397 0.171
NP_440136.1_2 Reverse -201 -208 6.13563 0.193
NP_440136.1_2 Forward -76 -69 6.13563 0.193
NP_442590.1_9 Forward -66 -47 3.53937 0.285
NP_442590.1_10 Forward -111 -92 3.34271 0.294
NP_442998.1_10 Reverse -202 -209 15.5754 0.0102
NP_442998.1_10 Reverse -70 -77 15.5754 0.0102
NP_442998.1_10 Forward -207 -200 5.84064 0.235
NP_440299.1_1 Forward -81 -68 14.375 0.0259
NP_440299.1_1 Reverse -282 -295 11.4251 0.0489
NP_441799.1_1 Reverse -196 -210 16.0269 0.0153
NP_441007.1_10 Reverse -195 -208 8.86907 0.108
NP_441007.1_10 Forward -82 -69 8.67241 0.112
NP_440256.1_1 Forward -95 -76 -7.17871 0.231
NP_440256.1_1 Forward -80 -61 -9.34199 0.278
NP_441957.1_7 Reverse -225 -244 18.3873 0.137
NP_440087.1_1 Forward -82 -63 -7.08038 0.266
NP_441559.1_8 Reverse -4 -18 1.96621 0.151
NP_441559.1_8 Forward -214 -200 -7.17857 0.287
NP_440915.1_6 Forward -213 -199 13.4709 0.0187
NP_440915.1_6 Forward -81 -67 0.0979218 0.176
NP_440997.1_6 Forward -262 -243 10.7175 0.263
NP_441179.1_9 Forward -277 -267 9.41933 0.28
NP_440748.1_5 Reverse -70 -89 3.34271 0.21
NP_440748.1_5 Reverse -11 -30 -2.36049 0.273
NP_441464.1_8 Forward -209 -195 15.2409 0.104
NP_441464.1_10 Forward -68 -54 12.7826 0.201
NP_440787.1_7 Reverse -352 -368 15.6932 0.283
NP_441939.1_3 Forward -76 -57 7.17762 0.21
NP_441199.1_6 Forward -245 -226 0.687771 0.237
NP_441199.1_6 Forward -213 -194 0.0977854 0.254
NP_441494.1_6 Forward -50 -37 5.62415 0.298
NP_442386.1_9 Forward -210 -201 5.9975 0.23
NP_440570.1_5 Forward -273 -254 -1.27885 0.267
NP_441340.1_5 Forward -208 -201 13.5105 0.0314
NP_441340.1_5 Forward -76 -69 6.13563 0.175
NP_441340.1_5 Reverse -69 -76 5.93897 0.198
NP_441340.1_5 Reverse -201 -208 5.84064 0.208
NP_440168.1_9 Reverse -189 -208 -1.27885 0.273
NP_440327.1_6 Reverse -254 -273 20.649 0.0435
NP_440327.1_6 Reverse -17 -36 11.1109 0.188
NP_440327.1_6 Reverse -18 -37 2.16274 0.299
NP_442240.1_1 Reverse -192 -211 6.1935 0.258
NP_442240.1_2 Reverse -201 -220 -14.2585 0.177
NP_441160.1_5 Reverse -209 -228 -6.09707 0.288
NP_440586.1_1 Reverse -216 -235 0.196116 0.237
NP_440586.1_8 Forward -76 -69 11.4451 0.0645
NP_440586.1_8 Reverse -201 -208 9.47853 0.146
NP_440586.1_8 Forward -222 -215 7.1186 0.272
NP_440586.1_8 Reverse -315 -322 5.8403 0.283
NP_440586.1_8 Forward -208 -201 5.74197 0.283
NP_442251.1_6 Reverse -69 -76 12.0355 0.0627
NP_440192.1_3 Forward -259 -240 15.4374 0.109
NP_441262.1_3 Forward -209 -202 14.7888 0.0223
NP_441262.1_3 Forward -77 -70 14.7888 0.0223
NP_440027.1_3 Forward -98 -80 6.01657 0.23
NP_443051.1_1 Reverse -199 -208 8.25953 0.0414
NP_443051.1_1 Forward -210 -201 7.47288 0.0571
NP_443051.1_1 Forward -78 -69 0.786375 0.125
NP_443051.1_1 Reverse -67 -76 -0.983583 0.269
NP_439937.1_8 Forward -268 -249 4.71934 0.2
NP_439937.1_9 Reverse -376 -393 0.726459 0.0972
NP_439937.1_9 Forward -210 -193 -6.74666 0.157
NP_439937.1_9 Reverse -199 -216 -7.82829 0.168
NP_439937.1_9 Forward -122 -105 -13.1381 0.28
NP_439937.1_9 Reverse -67 -84 -15.6947 0.287
NP_440439.1_1 Forward -212 -199 16.5389 0.0126
NP_440439.1_1 Reverse -197 -210 8.67241 0.0513
NP_440439.1_1 Forward -80 -67 1.69091 0.147
NP_440372.1_2 Forward -208 -201 13.8055 0.0214
NP_440372.1_2 Forward -76 -69 6.72562 0.0929
NP_440372.1_2 Reverse -69 -76 6.62729 0.151
NP_440372.1_2 Reverse -201 -208 6.52896 0.188
NP_440819.1_5 Reverse -108 -116 7.98423 0.228
NP_439977.1_5 Forward -392 -373 -2.16383 0.272
NP_440139.1_1 Reverse -62 -81 3.83357 0.197
NP_440267.1_2 Reverse -63 -77 10.8154 0.13
NP_442384.1_10 Reverse -68 -81 6.4108 0.102
NP_442384.1_10 Forward -209 -196 1.88757 0.243
NP_441018.1_7 Forward -64 -45 11.4058 0.185
NP_442262.1_10 Reverse -201 -208 13.2155 0.0213
NP_440344.1_10 Reverse -193 -210 -13.2358 0.278
NP_442123.1_3 Forward -209 -190 15.1424 0.125
NP_442910.1_1 Forward -84 -65 -6.39206 0.254
NP_440189.1_2 Reverse -192 -211 -0.197208 0.285
NP_440297.1_9 Reverse -9 -19 1.25834 0.282
NP_440297.1_9 Forward -385 -375 0.766681 0.282
NP_440297.1_9 Forward -208 -198 -0.216628 0.282
NP_440999.1_9 Forward -213 -199 1.17956 0.169
NP_440999.1_9 Forward -233 -219 -3.147 0.287
NP_440888.1_2 Reverse -200 -214 12.3887 0.046
NP_440888.1_2 Reverse -68 -82 5.70218 0.267
NP_440491.1_1 Forward -98 -79 11.595 0.167
NP_440052.1_5 Reverse -174 -193 -1.86883 0.205
NP_442033.1_10 Reverse -198 -217 -7.76869 0.186
NP_442033.1_10 Forward -211 -192 -13.8652 0.291
NP_441949.1_6 Reverse -51 -70 11.6017 0.146
NP_441543.1_2 Reverse -201 -210 8.65285 0.0968
NP_441543.1_2 Reverse -69 -78 7.17789 0.131
NP_441543.1_5 Forward -84 -65 3.73603 0.2
NP_442845.1_2 Forward -263 -249 7.9644 0.195
NP_442845.1_2 Forward -83 -69 7.27608 0.195
NP_441551.1_5 Reverse -196 -212 7.92432 0.241
NP_441551.1_5 Forward -81 -65 6.74435 0.258
NP_441918.1_7 Forward -324 -305 5.60432 0.262
NP_441918.1_7 Reverse -199 -218 -3.44213 0.297
NP_440982.1_1 Forward -200 -181 5.40686 0.294
NP_441469.1_8 Forward -387 -378 11.0128 0.189
NP_441469.1_8 Forward -210 -201 6.39124 0.227
NP_442315.1_2 Forward -64 -52 8.39711 0.294
NP_443064.1_6 Forward -209 -199 12.6639 0.0796
NP_443064.1_6 Reverse -68 -78 8.6886 0.276
NP_442337.1_6 Reverse -265 -284 12.5678 0.286
NP_442578.1_7 Forward -208 -201 6.0373 0.18
NP_442578.1_7 Forward -76 -69 5.93897 0.183
NP_441462.1_2 Forward -209 -199 18.3679 0.0036
NP_441462.1_2 Forward -77 -67 9.7148 0.0149
NP_441462.1_2 Reverse -200 -210 1.74999 0.0811
NP_441621.1_7 Reverse -198 -212 14.2576 0.0266
NP_441621.1_7 Forward -211 -197 -3.34366 0.188
NP_443062.1_1 Reverse -200 -218 4.93815 0.244
NP_443062.1_6 Reverse -192 -211 3.04771 0.245
NP_442204.1_5 Reverse -190 -209 6.19431 0.147
NP_442204.1_6 Reverse -211 -230 7.66927 0.235
NP_440544.1_5 Forward -117 -110 14.5681 0.264
NP_440516.1_6 Reverse -260 -274 7.07881 0.284
NP_440516.1_8 Forward -209 -200 16.9127 0.00442
NP_440516.1_8 Reverse -200 -209 14.8477 0.00685
NP_440516.1_8 Forward -77 -68 8.1612 0.0417
NP_442428.1_5 Forward -208 -201 6.13563 0.209
NP_442428.1_5 Reverse -69 -76 6.13563 0.209
NP_442428.1_5 Reverse -201 -208 6.0373 0.212
NP_442428.1_5 Forward -76 -69 6.0373 0.212
NP_442779.1_10 Reverse -117 -135 15.7513 0.273
NP_442120.1_10 Reverse -113 -132 -8.45701 0.237
NP_440673.1_3 Reverse -202 -209 12.4288 0.0426
NP_440673.1_3 Reverse -70 -77 12.4288 0.0426
NP_441052.1_2 Reverse -68 -78 1.74999 0.229
NP_441052.1_2 Forward -209 -199 0.865012 0.256
NP_441052.1_2 Reverse -200 -210 0.668351 0.256
NP_441052.1_2 Forward -98 -88 -0.609952 0.288
NP_442219.1_9 Reverse -69 -78 8.06287 0.0696
NP_440436.1_4 Reverse -69 -78 13.9623 0.0193
NP_440436.1_4 Forward -76 -67 11.4057 0.0527
NP_440436.1_4 Reverse -201 -210 8.55409 0.0997
NP_440436.1_4 Forward -208 -199 6.39082 0.162
NP_441884.1_8 Forward -210 -191 -6.98204 0.241
NP_441884.1_9 Forward -212 -193 -15.7335 0.138
NP_441884.1_9 Reverse -302 -321 -23.6983 0.284
NP_441719.1_4 Forward -208 -201 6.82395 0.0855
NP_441719.1_4 Forward -76 -69 6.72562 0.093
NP_441719.1_4 Reverse -69 -76 6.62729 0.151
NP_441719.1_4 Reverse -201 -208 6.52896 0.188
NP_441733.1_10 Forward -212 -199 14.1789 0.0816
NP_441733.1_10 Forward -80 -67 7.49244 0.153
NP_441733.1_10 Forward -389 -376 4.24752 0.27
NP_441004.1_1 Reverse -185 -204 -8.26035 0.2
NP_441004.1_2 Reverse -180 -199 1.37609 0.22
NP_441004.1_4 Reverse -188 -198 7.94484 0.282
NP_441004.1_5 Reverse -187 -201 7.37441 0.292
NP_442813.1_4 Reverse -257 -276 3.93269 0.197
NP_443054.1_2 Reverse -198 -212 4.03116 0.24
NP_443054.1_2 Reverse -108 -122 -0.492064 0.295
NP_441851.1_10 Reverse -376 -386 14.3364 0.0179
NP_441851.1_10 Reverse -199 -209 7.64985 0.135
NP_441851.1_10 Forward -78 -68 7.25653 0.144
NP_441851.1_10 Forward -210 -200 6.37155 0.172
NP_441851.1_10 Forward -387 -377 4.3066 0.277
NP_441668.1_4 Reverse -190 -209 7.17762 0.151
NP_442515.1_1 Forward -210 -196 4.71948 0.107
NP_442515.1_1 Forward -387 -373 1.08123 0.172
NP_442515.1_1 Reverse -376 -390 -4.22864 0.298
NP_442515.1_1 Reverse -199 -213 -4.52363 0.298
NP_441982.1_6 Forward -162 -153 11.6259 0.288
NP_441046.1_2 Reverse -209 -228 8.75091 0.221
NP_441349.1_10 Reverse -190 -209 -7.57203 0.254
NP_440432.1_9 Forward -76 -61 9.41967 0.0427
NP_442843.1_1 Forward -322 -303 -3.04881 0.22
NP_442843.1_1 Reverse -192 -211 -4.91709 0.239
NP_439960.1_6 Reverse -73 -92 19.0757 0.0955
NP_440726.1_2 Forward -273 -254 6.4893 0.2
NP_441124.1_5 Reverse -145 -155 11.6713 0.246
NP_442168.1_5 Reverse -69 -88 8.25926 0.159
NP_440588.1_2 Reverse -191 -210 -1.18052 0.155
NP_440588.1_2 Forward -65 -46 -6.78538 0.292
NP_441031.1_1 Reverse -278 -297 10.3898 0.205
NP_442006.1_2 Forward -275 -258 -8.41762 0.196
NP_442006.1_3 Reverse -185 -203 -6.86402 0.298
NP_441570.1_1 Reverse -68 -86 -17.6804 0.287
NP_441078.1_4 Forward -209 -200 9.93116 0.0203
NP_441078.1_4 Reverse -200 -209 9.83282 0.0226
NP_441078.1_4 Reverse -68 -77 0.196389 0.205
NP_441078.1_4 Forward -77 -68 -0.000272808 0.205
NP_441078.1_4 Forward -386 -377 -1.96689 0.282
NP_442729.1_8 Reverse -373 -386 8.37742 0.125
NP_440526.1_3 Reverse -69 -80 14.9061 0.0646
NP_440526.1_3 Forward -208 -197 2.12315 0.267
NP_441432.1_8 Forward -78 -69 7.17789 0.102
NP_441432.1_8 Forward -210 -201 5.50626 0.151
NP_442320.1_8 Forward -83 -69 -2.16369 0.0867
NP_441732.1_2 Forward -213 -197 -15.9694 0.164
NP_441732.1_2 Forward -267 -251 -16.5594 0.174
NP_440629.1_6 Forward -215 -196 14.75 0.162
NP_440760.1_1 Forward -209 -190 -14.1602 0.125
NP_440760.1_1 Reverse -68 -87 -14.3569 0.129
NP_440578.1_8 Reverse -368 -387 12.6841 0.238
NP_440913.1_1 Forward -79 -61 13.9821 0.131
NP_442400.1_10 Reverse -150 -163 9.41998 0.271
NP_440713.1_4 Forward -87 -68 5.01433 0.218
NP_442489.1_7 Reverse -200 -209 10.5211 0.0102
NP_442489.1_7 Forward -209 -200 10.4228 0.0151
NP_442489.1_7 Reverse -68 -77 0.884706 0.145
NP_442489.1_7 Forward -77 -68 0.491382 0.178
NP_442489.1_7 Reverse -377 -386 -1.86856 0.259
NP_440559.1_1 Forward -208 -199 14.5527 0.0154
NP_440559.1_1 Reverse -69 -78 14.1594 0.0317
NP_440559.1_1 Forward -76 -67 7.96454 0.0739
NP_440559.1_1 Forward -385 -376 4.22796 0.292
NP_441659.2_8 Forward -209 -199 9.81313 0.0269
NP_441659.2_8 Reverse -200 -210 8.82982 0.0393
NP_441659.2_8 Forward -77 -67 6.37155 0.0774
NP_441659.2_8 Reverse -68 -78 6.37155 0.0774
NP_441022.1_1 Forward -400 -391 12.6973 0.232
NP_442913.1_10 Reverse -59 -78 5.80098 0.0678
NP_442913.1_10 Reverse -191 -210 -3.63879 0.214
NP_440708.1_4 Reverse -255 -274 5.80098 0.259
NP_442776.1_1 Forward -133 -114 7.66927 0.206
NP_442346.1_5 Forward -78 -68 14.828 0.00967
NP_442346.1_5 Reverse -313 -323 10.6981 0.0888
NP_442346.1_5 Reverse -199 -209 8.1415 0.146
NP_442346.1_5 Reverse -67 -77 6.07655 0.216
NP_440545.1_3 Forward -213 -196 7.61033 0.0489
NP_440545.1_3 Reverse -196 -213 0.0388413 0.146
NP_441653.1_2 Reverse -57 -76 11.5502 0.111
NP_442603.1_7 Forward -209 -195 13.8636 0.0785
NP_442603.1_7 Forward -192 -178 8.45543 0.174
NP_441585.1_2 Reverse -189 -208 19.5673 0.201
NP_441888.1_2 Forward -35 -16 15.7324 0.105
NP_440946.1_6 Reverse -180 -199 4.71934 0.294
NP_441833.1_4 Reverse -69 -76 14.1004 0.0258
NP_441833.1_4 Reverse -201 -208 6.52896 0.0924
NP_441833.1_4 Forward -208 -201 6.23397 0.163
NP_441833.1_4 Forward -76 -69 6.13563 0.198
NP_442162.1_9 Forward -208 -201 12.9205 0.0282
NP_442162.1_9 Reverse -201 -208 12.9205 0.0282
NP_442162.1_9 Reverse -69 -76 6.62729 0.142
NP_442162.1_9 Forward -76 -69 6.52896 0.178
NP_440671.1_4 Forward -215 -201 6.98109 0.23
NP_443026.1_5 Forward -64 -45 0.392778 0.283
NP_442140.1_3 Reverse -201 -211 15.418 0.0393
NP_442140.1_3 Forward -76 -66 9.81313 0.0992
NP_442140.1_3 Reverse -315 -325 5.68323 0.198
NP_442140.1_3 Forward -208 -198 5.5849 0.202
NP_442140.1_3 Reverse -69 -79 4.10993 0.261
NP_440875.1_9 Reverse -202 -212 18.3004 0.0104
NP_440875.1_9 Reverse -70 -80 9.3454 0.233
NP_441813.1_5 Reverse -66 -76 8.04317 0.0491
NP_441813.1_5 Reverse -198 -208 5.78156 0.109
NP_441813.1_5 Forward -211 -201 0.275027 0.206
NP_439901.1_1 Reverse -183 -202 2.75272 0.269
NP_440590.1_4 Reverse -69 -82 0.117615 0.169
NP_440590.1_4 Reverse -201 -214 -4.01229 0.257
NP_440590.1_4 Forward -208 -195 -4.20895 0.258
NP_440567.1_1 Reverse -69 -83 12.3893 0.0236
NP_442497.1_10 Forward -208 -199 10.1278 0.0166
NP_442497.1_10 Forward -76 -67 8.1612 0.0625
NP_442497.1_10 Reverse -69 -78 0.688044 0.141
NP_442497.1_10 Reverse -201 -210 0.589713 0.153
NP_442497.1_10 Forward -385 -376 0.29472 0.199
NP_440821.1_4 Reverse -198 -208 9.7148 0.0274
NP_440821.1_4 Forward -211 -201 9.02648 0.0364
NP_440821.1_4 Forward -79 -69 8.1415 0.055
NP_440821.1_4 Reverse -375 -385 6.8632 0.0814
NP_440821.1_4 Forward -388 -378 -0.609952 0.279
NP_441239.1_9 Reverse -198 -210 15.7719 0.0186
NP_441239.1_9 Forward -211 -199 9.87208 0.0941
NP_441239.1_9 Forward -388 -376 6.33216 0.193
NP_441727.1_3 Reverse -193 -212 5.99764 0.248
NP_440604.1_6 Forward -209 -190 -2.75381 0.225
NP_442270.1_9 Reverse -78 -97 -7.96535 0.215
NP_440833.1_6 Forward -332 -318 7.07881 0.289
NP_442216.1_4 Reverse -173 -181 8.08217 0.255
NP_440354.1_5 Forward -212 -193 6.98095 0.174
NP_440546.1_4 Forward -209 -199 13.8273 0.0459
NP_440546.1_4 Forward -77 -67 12.4699 0.0679
NP_440546.1_4 Reverse -200 -210 9.27034 0.146
NP_440546.1_4 Reverse -314 -324 8.20381 0.199
NP_440675.1_3 Forward -77 -58 5.80098 0.277
NP_440462.1_6 Forward -211 -201 8.4365 0.062
NP_440462.1_6 Reverse -198 -208 7.45319 0.0788
NP_442340.1_3 Forward -273 -254 -6.29373 0.223
NP_440868.1_4 Forward -213 -201 14.1986 0.019
NP_440868.1_4 Forward -81 -69 4.8572 0.109
NP_440868.1_4 Reverse -196 -208 2.98891 0.142
NP_441868.1_4 Forward -84 -70 13.1759 0.282
NP_440036.1_10 Reverse -370 -382 12.9203 0.284
NP_441848.1_4 Forward -166 -150 7.1687 0.295
NP_441084.1_6 Forward -271 -257 13.7072 0.125
NP_440696.1_3 Forward -77 -59 -2.24246 0.274
NP_442039.1_4 Forward -208 -201 11.6422 0.0747
NP_442409.1_5 Reverse -73 -92 14.0608 0.238
NP_442837.1_3 Reverse -69 -76 6.13563 0.25
NP_442837.1_3 Forward -208 -201 6.0373 0.25
NP_442837.1_3 Reverse -201 -208 6.0373 0.25
NP_442837.1_3 Forward -76 -69 5.93897 0.265
NP_442053.1_1 Reverse -200 -209 16.6177 0.00257
NP_442053.1_1 Forward -209 -200 8.65285 0.0741
NP_440505.1_3 Forward -79 -69 15.3197 0.0131
NP_440505.1_3 Forward -211 -201 12.5664 0.0482
NP_440505.1_5 Forward -54 -40 16.4209 0.237
NP_442844.1_5 Forward -117 -98 6.1935 0.26
NP_440914.1_1 Reverse -68 -78 14.7634 0.00997
NP_440914.1_1 Forward -45 -35 7.93196 0.214
NP_440914.1_1 Reverse -200 -210 6.66328 0.269
NP_441011.1_8 Forward -208 -199 10.8161 0.094
NP_441011.1_8 Reverse -201 -210 7.07956 0.179
NP_441011.1_8 Forward -76 -67 5.89959 0.214
NP_442533.1_6 Reverse -200 -209 14.2577 0.0132
NP_442533.1_6 Forward -209 -200 7.47288 0.0898
NP_442533.1_6 Forward -77 -68 5.3096 0.145
NP_442232.1_3 Reverse -192 -211 2.3594 0.103
NP_441482.1_7 Reverse -194 -208 -2.65535 0.0979
NP_441482.1_7 Forward -269 -255 -11.3085 0.254
NP_439944.1_9 Reverse -69 -79 9.41981 0.1
NP_439944.1_9 Forward -208 -198 8.1415 0.116
NP_439944.1_9 Reverse -120 -130 6.17489 0.192
NP_439944.1_9 Forward -76 -66 5.19158 0.27
NP_442664.1_3 Reverse -262 -276 14.2576 0.246
NP_440116.1_8 Forward -76 -57 0.687771 0.0958
NP_440116.1_8 Reverse -315 -334 -8.65367 0.256
NP_440115.1_6 Forward -80 -70 18.9579 0.0139
NP_440115.1_6 Forward -212 -202 10.5998 0.115
NP_440115.1_6 Reverse -197 -207 8.4365 0.13
NP_440115.1_6 Forward -389 -379 6.37155 0.186
NP_439965.1_1 Forward -86 -67 -7.17871 0.222
NP_441680.1_4 Reverse -46 -65 0.786102 0.246
NP_441347.1_5 Forward -83 -69 9.53707 0.269
NP_441106.1_1 Forward -210 -201 8.45619 0.0548
NP_441106.1_1 Reverse -67 -76 5.50626 0.145
NP_441106.1_7 Reverse -68 -87 15.1416 0.205
NP_439903.1_7 Reverse -211 -230 2.16274 0.3
NP_442306.1_10 Reverse -195 -214 -10.9153 0.111
NP_441286.1_1 Forward -210 -198 5.25052 0.0259
NP_441286.1_1 Forward -78 -66 3.67722 0.0467
NP_441286.1_1 Reverse -199 -211 -4.48425 0.161
NP_441286.1_1 Forward -387 -375 -6.35254 0.26
NP_441286.1_1 Reverse -67 -79 -6.64753 0.271
NP_440670.1_8 Forward -209 -200 18.0926 0.00136
NP_440670.1_8 Reverse -200 -209 15.831 0.00494
NP_440670.1_8 Reverse -68 -77 6.98123 0.0882
NP_440670.1_8 Reverse -377 -386 3.34298 0.275
NP_441930.1_3 Reverse -147 -166 4.50265 0.269
NP_440886.1_7 Forward -210 -200 8.14104 0.0805
NP_440886.1_7 Reverse -199 -209 6.76441 0.114
NP_442614.1_2 Reverse -377 -391 10.3243 0.234
NP_442614.1_2 Forward -209 -195 7.76774 0.265
NP_442072.1_9 Reverse -199 -217 -13.6489 0.118
NP_442072.1_9 Forward -78 -60 -22.1053 0.22
NP_442213.1_5 Reverse -213 -232 -2.45882 0.296
NP_440907.2_8 Reverse -201 -211 15.7125 0.0168
NP_440907.2_8 Forward -208 -198 9.91099 0.103
NP_440907.2_8 Reverse -378 -388 4.7978 0.243
NP_441626.1_2 Forward -208 -201 12.2322 0.0511
NP_441626.1_2 Forward -76 -69 6.0373 0.212
NP_441626.1_2 Reverse -69 -76 6.0373 0.212
NP_441626.1_2 Reverse -201 -208 5.93897 0.231
NP_441988.1_5 Reverse -55 -74 10.6192 0.274
NP_441205.1_5 Reverse -266 -285 15.8299 0.295
NP_441401.1_5 Reverse -191 -210 9.7875 0.297
NP_442615.1_1 Forward -395 -377 -6.96235 0.271
NP_441962.1_4 Reverse -69 -88 -9.93197 0.222
NP_441962.1_4 Forward -59 -40 -11.1119 0.238
NP_440387.1_1 Forward -209 -193 -3.97304 0.171
NP_440387.1_1 Reverse -200 -216 -4.95634 0.208
NP_441431.1_2 Forward -212 -198 15.1419 0.0537
NP_441431.1_2 Reverse -197 -211 12.487 0.116
NP_441836.1_2 Forward -263 -244 1.86774 0.185
NP_441836.1_2 Reverse -217 -236 -6.39206 0.297
NP_440114.1_10 Forward -209 -195 14.2576 0.0429
NP_440114.1_10 Forward -77 -63 6.48943 0.269
NP_441156.1_5 Forward -22 -12 15.6819 0.251
NP_441510.2_7 Reverse -68 -82 9.83206 0.281
NP_441720.1_6 Forward -90 -71 11.2092 0.25
NP_441272.1_7 Reverse -266 -276 15.0247 0.2
NP_440293.1_3 Reverse -369 -388 -6.68705 0.291
NP_440766.1_4 Forward -213 -199 7.9644 0.0871
NP_441237.1_9 Forward -208 -198 14.533 0.0323
NP_441237.1_9 Reverse -378 -388 13.2547 0.0894
NP_441237.1_9 Reverse -69 -79 10.5998 0.224
NP_441311.1_4 Reverse -173 -190 14.1002 0.298
NP_440643.1_6 Forward -274 -255 5.50599 0.214
NP_439910.1_2 Reverse -60 -77 -4.48438 0.0788
NP_439910.1_2 Forward -217 -200 -13.6292 0.162
NP_439910.1_2 Forward -177 -160 -14.4158 0.183
NP_440457.1_1 Forward -58 -46 6.92215 0.108
NP_440457.1_1 Forward -81 -69 2.10393 0.217
NP_440457.1_1 Forward -213 -201 1.90727 0.223
NP_440457.1_1 Reverse -196 -208 0.137309 0.25
NP_440798.1_6 Reverse -201 -214 8.86907 0.11
NP_440798.1_6 Forward -208 -195 1.9859 0.188
NP_441981.1_3 Reverse -108 -122 14.4066 0.268
NP_442680.1_5 Forward -181 -162 5.24982 0.227
NP_442680.1_5 Forward -183 -164 1.63528 0.24
NP_442509.1_9 Forward -209 -199 14.6309 0.0263
NP_442509.1_9 Reverse -200 -210 13.4509 0.0553
NP_442509.1_9 Forward -386 -376 9.616 0.192
NP_441159.1_1 Reverse -267 -286 -2.26216 0.226
NP_440554.1_4 Reverse -201 -211 10.9931 0.0429
NP_441885.1_5 Forward -209 -199 9.12481 0.0238
NP_441885.1_5 Reverse -200 -210 1.65166 0.106
NP_441885.1_5 Reverse -68 -78 1.455 0.11
NP_441885.1_5 Forward -77 -67 0.57002 0.137
NP_442703.1_4 Reverse -49 -68 1.57197 0.284
NP_442310.1_1 Reverse -222 -241 13.7658 0.188
NP_442341.1_7 Forward -210 -196 11.5043 0.0549
NP_442341.1_7 Reverse -199 -213 8.06273 0.0947
NP_443000.1_7 Reverse -66 -76 1.25834 0.26
NP_443000.1_7 Forward -79 -69 0.57002 0.294
NP_443059.1_8 Reverse -70 -89 13.3725 0.233
NP_440275.1_3 Forward -211 -201 15.418 0.0178
NP_440275.1_3 Reverse -198 -208 9.91146 0.046
NP_440275.1_3 Forward -79 -69 8.04317 0.0602
NP_440275.1_3 Reverse -66 -76 5.5849 0.14
NP_440091.1_1 Reverse -64 -76 1.80894 0.197
NP_440091.1_1 Forward -213 -201 1.12062 0.212
NP_440091.1_1 Forward -81 -69 1.02229 0.218
NP_440091.1_1 Reverse -60 -72 -0.452677 0.273
NP_440679.1_10 Reverse -184 -203 -20.65 0.286
NP_443010.1_10 Forward -212 -195 12.4342 0.0877
NP_442214.1_7 Reverse -151 -170 14.6316 0.251
NP_441105.1_3 Reverse -366 -385 -5.50708 0.22
NP_441105.1_3 Reverse -249 -268 -8.752 0.278
NP_442373.1_2 Forward -65 -46 -10.9153 0.292
NP_440216.1_1 Forward -77 -63 6.29277 0.0156
NP_440216.1_1 Reverse -200 -214 3.44117 0.0284
NP_440216.1_1 Forward -209 -195 -11.0135 0.159
NP_440172.1_1 Forward -77 -67 8.73149 0.0586
NP_440172.1_1 Forward -209 -199 6.56821 0.102
NP_440172.1_1 Reverse -200 -210 5.78156 0.132
NP_442015.1_10 Reverse -196 -209 1.10092 0.213
NP_441226.1_7 Forward -208 -201 12.7234 0.0312
NP_441226.1_7 Reverse -201 -208 11.5435 0.0757
NP_441111.1_7 Forward -208 -200 8.96754 0.0463
NP_441111.1_7 Reverse -69 -77 8.96754 0.0463
NP_441111.1_7 Reverse -201 -209 8.86921 0.0589
NP_442379.1_10 Forward -84 -67 -1.23946 0.223
NP_441766.1_2 Reverse -200 -209 13.9627 0.0114
NP_441766.1_2 Forward -77 -68 8.06287 0.0691
NP_441766.1_2 Forward -209 -200 7.76787 0.0714
NP_440416.1_9 Forward -84 -65 -16.8151 0.223
NP_440416.1_9 Forward -99 -80 -19.6667 0.276
NP_442116.1_6 Forward -154 -137 13.5165 0.172
NP_442154.1_1 Reverse -258 -276 -11.3872 0.214
NP_442154.1_1 Forward -68 -50 -17.9754 0.273
NP_440261.1_5 Forward -208 -195 6.80412 0.0316
NP_440261.1_5 Reverse -378 -391 -3.22564 0.12
NP_440261.1_5 Reverse -201 -214 -3.4223 0.132
NP_440261.1_5 Reverse -69 -82 -10.8955 0.221
NP_440988.1_10 Forward -39 -25 11.4821 0.187
NP_440988.1_10 Reverse -72 -86 5.86695 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CATAAGTTTTTCGGTGCAATCCCCCTAATCATCTGACCCCAAACTATTAAGCTCGTAAAATTGTGACGGAGACAATTAACCATGGCTACGTTTGTCGCTCAAGTTAAAGATCGTAAAGGTAAAACCACCAAAGCCAAGGTGGAAGCCATGAGTCCAGAACAGGCTCGTACCATCCTCCGCCAACAATACGCGGCGATCGGCCCCATTAAGCCAGCCGGAGGGGAAATAAACCTCGAATTCCTGGAAAATTTACTTAACAACGTTAGTGTCAAGGACAAAGCGGTTTTCTCCCGACAGTTTTCCGTCATGATCAACGCTGGCGTGGCGATCGTTCGTTGTTTGGGGGTGCTGTCGGAACAATGTCCTAATCCCAAACTGAAAAGGGCATTAACGGGTATTA

CDS

GTGGGGAAGTTCAACAGGGCACTAACCTTTCTGAAGCCATGGGCAAATATCCCGAATGTTTTGATGACCTCTACGTCAGCATGGTGGAAGCAGGGGAAACGGGGGGGGGTTTTAGACGAAGTTCTCAACCGACTTTCCAAACTGCTGGAAGACATGGCCCGTCTGCAAAACCAAATTAAATCCGCCATGGCTTATCCGGTGGCAGTAGGTTTCTTGGCGGTGGTGGCTTTTCTCGGTATGACCATCTTCCTCATCCCTGTCTTTGCGGGAATTTTTGATGACCTGGGGGGAGAACTGCCCGCTTTAACCAAATTTATGGTCGGCCTAAGTAACTTTTTAAGAAGTCCAATGGCCGTCATCCCCGTAATTGTTATTGTGGTTGCCGTTTTTCTATTCAAAAAATATTACGGAACCTATGCTGGGCGGCGACAAGTCGATGCGGTGATGTTGAAACTACCTTTGTTTGGTCCCCTGAATGAAAAAACCGCTGTAGCTAGGTTTTGCCGGGTATTTGGCACCCTTACCCGTTCGGGGGTTCCCATTATTCAGTCTTTGGAAATTGTTTGTAATACTGTGCCCAATAAAGTGATTTCCGATGCGATCGCCGGGGCTATTAGTGAAATTCAACAGGGGGGCATGATGAGTTTGGCTCTGCAACAAAGTAAGGTTTTCCCCTCTTTGGCGATTCAAATGATTAGTATTGGGGAAGAAACGGGGGAACTGGATGCCATGATGATGAAAGTGGCGGACTTCTATGAAGACGAAGTAGAACAAACCGTCAAAGCGTTGACTAGTATTATAGAACCAGCTATGATGGTGCTGATTGCCGGTATGGTCGGGACAATTTTGCTTTCCATGTATCTACCCATGTTTGCCATCTTTGATCAGTTAGGTTAA

Protein

MGKFNRALTFLKPWANIPNVLMTSTSAWWKQGKRGGVLDEVLNRLSKLLEDMARLQNQIKSAMAYPVAVGFLAVVAFLGMTIFLIPVFAGIFDDLGGELPALTKFMVGLSNFLRSPMAVIPVIVIVVAVFLFKKYYGTYAGRRQVDAVMLKLPLFGPLNEKTAVARFCRVFGTLTRSGVPIIQSLEIVCNTVPNKVISDAIAGAISEIQQGGMMSLALQQSKVFPSLAIQMISIGEETGELDAMMMKVADFYEDEVEQTVKALTSIIEPAMMVLIAGMVGTILLSMYLPMFAIFDQLG