Your browser is old and dusty. Try Google Chrome!

Details for slr0157

ORF slr0157
Accession NP_441883.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -100 -86 0.196253 0.215
NP_441061.1_2 Reverse -127 -141 -2.26202 0.287
NP_442752.1_4 Reverse -249 -256 5.25066 0.256
NP_440878.1_9 Forward -302 -283 4.62101 0.174
NP_441859.1_5 Forward -174 -155 2.55606 0.295
NP_442762.1_10 Forward -276 -257 -12.4886 0.285
NP_441581.1_9 Forward -189 -170 8.16414 0.261
NP_440916.1_1 Reverse -148 -162 10.6193 0.206
NP_441925.1_2 Forward -121 -102 5.01433 0.262
NP_440273.1_1 Forward -186 -167 13.6072 0.243
NP_440769.1_8 Forward -186 -167 10.1275 0.188
NP_441738.1_2 Forward -256 -249 8.00357 0.235
NP_442445.1_2 Forward -216 -197 12.2908 0.288
NP_441327.1_1 Reverse -342 -361 2.86785 0.279
NP_440906.1_5 Reverse -250 -257 8.79057 0.149
NP_441486.1_1 Reverse -49 -63 -4.62196 0.204
NP_442145.1_4 Forward -26 -7 2.81659 0.299
NP_440470.1_5 Forward -187 -168 12.8432 0.16
NP_441014.1_10 Forward -302 -283 3.83357 0.206
NP_441014.1_10 Reverse -8 -27 -1.8696 0.267
NP_441634.1_5 Reverse -73 -87 20.4524 0.107
NP_441002.1_5 Reverse -299 -318 9.73422 0.296
NP_440642.1_10 Reverse -311 -325 1.76896 0.289
NP_440642.1_10 Reverse -68 -82 1.47397 0.293
NP_440360.1_10 Forward -256 -242 2.75286 0.261
NP_442198.1_3 Reverse -197 -216 4.81767 0.268
NP_442937.1_5 Forward -269 -250 8.35759 0.225
NP_440651.1_7 Reverse -250 -269 19.0757 0.135
NP_439990.1_8 Forward -200 -181 -1.18052 0.283
NP_442690.1_1 Reverse -166 -185 -11.7019 0.232
NP_440475.1_1 Reverse -181 -200 11.7516 0.23
NP_440569.1_7 Reverse -126 -145 10.6192 0.286
NP_442004.1_3 Reverse -278 -297 20.944 0.0764
NP_439966.1_9 Reverse -247 -256 6.68623 0.253
NP_440983.1_5 Reverse -126 -145 -8.55534 0.295
NP_442281.1_1 Forward -66 -52 2.06395 0.278
NP_441079.1_7 Reverse -168 -187 -3.24622 0.233
NP_440253.1_2 Forward -55 -37 -2.73412 0.274
NP_442933.1_10 Forward -267 -258 5.11294 0.204
NP_440430.1_4 Forward -268 -249 11.8967 0.276
NP_442142.1_4 Forward -274 -261 4.34528 0.223
NP_442142.1_4 Reverse -255 -268 2.47701 0.29
NP_441024.1_7 Reverse -218 -236 8.57317 0.3
NP_442476.1_6 Reverse -250 -264 2.75286 0.174
NP_440421.1_1 Reverse -181 -195 18.2892 0.122
NP_440357.1_3 Reverse -247 -266 0.0977854 0.285
NP_441448.1_7 Reverse -279 -298 5.60432 0.293
NP_441015.1_10 Forward -60 -41 -11.6036 0.298
NP_441876.1_9 Reverse -152 -162 10.3043 0.295
NP_440111.2_2 Forward -66 -47 -1.86883 0.247
NP_441520.1_8 Forward -208 -189 20.5506 0.0444
NP_441433.1_8 Forward -168 -149 -3.73712 0.283
NP_440084.1_8 Reverse -172 -186 11.6616 0.241
NP_441467.1_5 Forward -320 -310 14.4347 0.297
NP_441037.1_4 Reverse -247 -257 7.12278 0.237
NP_442998.1_5 Forward -158 -148 12.3697 0.174
NP_442998.1_10 Forward -197 -190 10.4622 0.0819
NP_440299.1_1 Reverse -48 -61 2.08368 0.299
NP_441007.1_10 Reverse -244 -257 9.06573 0.107
NP_442453.1_6 Reverse -156 -170 15.3055 0.286
NP_442993.1_1 Reverse -190 -206 -10.9545 0.231
NP_441262.1_3 Reverse -249 -256 5.15232 0.265
NP_439937.1_8 Forward -63 -44 2.3594 0.216
NP_442294.1_3 Reverse -143 -157 15.1419 0.213
NP_440408.1_7 Reverse -285 -304 10.0292 0.253
NP_441138.1_5 Reverse -3 -16 5.21834 0.272
NP_442384.1_10 Forward -291 -278 0.215946 0.297
NP_440948.1_5 Reverse -362 -381 17.1082 0.293
NP_442458.1_6 Forward -158 -139 10.4225 0.187
NP_440163.1_10 Forward -64 -54 14.533 0.102
NP_440189.1_2 Forward -207 -188 0.294447 0.279
NP_441965.1_10 Forward -294 -278 2.91013 0.28
NP_442701.1_2 Forward -87 -69 3.65739 0.282
NP_440982.1_7 Forward -270 -256 21.7307 0.0557
NP_442315.1_1 Forward -143 -125 2.67408 0.297
NP_440071.1_4 Reverse -46 -65 13.4708 0.234
NP_440544.1_5 Reverse -68 -75 13.8024 0.28
NP_442780.1_3 Reverse -165 -184 10.1695 0.221
NP_440783.1_5 Forward -383 -364 0.58944 0.209
NP_442120.1_10 Reverse -190 -209 -12.2919 0.27
NP_441052.1_2 Reverse -126 -136 1.94665 0.221
NP_441884.1_9 Reverse -246 -265 -24.19 0.284
NP_441733.1_10 Reverse -270 -283 4.64084 0.251
NP_441004.1_1 Reverse -80 -99 -13.0786 0.253
NP_442813.1_2 Forward -209 -190 11.8975 0.0909
NP_441034.1_4 Forward -282 -263 15.1329 0.235
NP_440328.1_4 Forward -288 -269 11.0125 0.0791
NP_440728.1_1 Forward -186 -167 13.175 0.216
NP_441851.1_10 Reverse -248 -258 4.69992 0.254
NP_440611.1_6 Reverse -269 -288 7.57094 0.281
NP_442843.1_1 Forward -382 -363 -10.6203 0.279
NP_440431.1_3 Forward -200 -181 -10.1286 0.271
NP_440431.1_4 Forward -78 -59 -7.974 0.275
NP_442168.1_5 Forward -281 -262 -2.36049 0.264
NP_440526.1_3 Forward -257 -246 15.8894 0.0646
NP_441432.1_8 Reverse -189 -198 5.50626 0.151
NP_443011.1_5 Reverse -69 -88 12.5858 0.256
NP_441022.1_1 Reverse -177 -186 10.9707 0.284
NP_440779.1_5 Forward -258 -241 -14.8091 0.274
NP_440283.1_9 Reverse -331 -345 20.2558 0.25
NP_441671.1_1 Forward -297 -278 -0.0988766 0.273
NP_442028.1_1 Forward -125 -112 10.9479 0.251
NP_440821.1_4 Reverse -247 -257 5.97822 0.101
NP_441239.1_9 Forward -288 -276 4.8572 0.239
NP_440665.1_1 Forward -255 -236 -16.7168 0.293
NP_441883.1_1 Forward -47 -28 30.5804 0.000177
NP_441883.1_2 Forward -304 -285 27.3355 0.000444
NP_441883.1_3 Forward -343 -325 30.8951 0.000328
NP_442340.1_3 Forward -293 -274 -6.09707 0.223
NP_440868.1_4 Forward -286 -274 2.39892 0.156
NP_441848.1_4 Forward -185 -169 11.1794 0.232
NP_441848.1_7 Reverse -145 -164 -1.37794 0.247
NP_441848.1_7 Reverse -144 -163 -3.34455 0.282
NP_441811.1_8 Forward -264 -250 7.27608 0.251
NP_441180.1_2 Forward -113 -94 13.4819 0.287
NP_442380.1_10 Forward -65 -47 11.3272 0.238
NP_440505.1_3 Reverse -188 -198 11.8781 0.0652
NP_441777.1_1 Reverse -27 -45 17.7635 0.167
NP_439944.1_9 Forward -304 -294 6.96153 0.162
NP_439944.1_9 Reverse -250 -260 5.19158 0.27
NP_442269.1_10 Reverse -59 -78 2.85105 0.264
NP_441697.1_5 Forward -187 -168 -9.02441 0.268
NP_441028.1_6 Reverse -152 -162 3.42118 0.296
NP_441527.1_4 Forward -85 -66 -4.15432 0.179
NP_441527.1_4 Forward -86 -67 -6.7326 0.224
NP_441527.1_4 Forward -83 -64 -12.8441 0.294
NP_442306.1_3 Forward -194 -175 17.0107 0.154
NP_441286.1_1 Forward -259 -247 -5.76255 0.223
NP_440083.1_7 Reverse -355 -374 9.14423 0.288
NP_440823.1_3 Forward -285 -266 19.3707 0.0263
NP_440907.2_8 Forward -257 -247 7.25606 0.123
NP_441993.1_1 Forward -277 -258 3.79838 0.228
NP_440114.1_10 Reverse -190 -204 8.55439 0.2
NP_441237.1_9 Reverse -250 -260 9.7148 0.272
NP_442930.1_1 Forward -155 -145 14.3359 0.239
NP_441984.1_3 Forward -281 -263 5.13236 0.295
NP_442509.1_9 Forward -258 -248 8.82935 0.192
NP_442862.1_3 Forward -399 -382 6.52869 0.263
NP_440409.1_1 Forward -266 -247 3.83436 0.18
NP_440750.1_5 Forward -83 -69 13.1759 0.159
NP_441842.1_1 Reverse -251 -264 12.3101 0.219
NP_440275.1_3 Forward -260 -250 5.09324 0.165
NP_442451.1_2 Forward -266 -247 -3.83545 0.2
NP_440175.1_7 Reverse -82 -100 11.6077 0.23
NP_441105.1_3 Forward -210 -191 -8.65367 0.275
NP_440216.1_9 Reverse -287 -296 9.14451 0.286
NP_440216.1_9 Reverse -161 -170 8.55452 0.286
NP_442371.1_1 Forward -77 -67 13.1559 0.21
NP_443052.1_9 Forward -99 -80 -3.14714 0.245
NP_442116.1_6 Forward -186 -169 14.3759 0.16
NP_442116.1_6 Forward -184 -167 8.93289 0.238
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATTATTTTCCATACGTTGAAACGGGATGAGTTGCGTCGCATTGTCGTCCTACAAATTAAACGCATCGAGAAGTTATTAGACGAGCAAAAAATCACGCTTTCTCTTTCCGATGCTGCCCTGGATCACATCGTCAGTGCTGGTTACGATCCCACCTACGGAGCAAGACCTTTAAAACGTGCTATTCAACGACAGTTGGAAAATCCTATTGCCACTAAAATCTTAGAAAATACTTTCGTTGCAGGGGACAAAATTCTCATTGATTGTGTGGATGGTCAGTTAATCTTTGATAAAGAAATAGAGCCCACAACATTACCAGAAGAGCCAGAAGAAAATATCACAGCGGTGGAAGTCGAGGTTCTTTCTTCATAATATTAACTCTAAGTAAATCAACATAAGACT

CDS

ATGGCTATCTCTCTAGATGAAGATAATCAAAAAATAATAGAAATTCATCAAGTGATAAATACGAATAGTCGTTTTTACGGACATTTAGTAAATTGGTATGAGGGCGTTTCTTGGCATTATGGCATTGGACTCGATGAAAATCTGATTTTTGACACAGGCGGGCTTTCGATTTTTACGAGAAATCCAAGCGAGTTCTTTATTGTCCCAGACGTGCAAAAGTTTTCTCCATATCAGACAATCGAGCGGCTCTGTTACGCTTTGATTTGCTTTAAAGATTGGGATTATGGGCTTTTGGGATGGAATTGTGAACATGTTGCTCGTCTAGTTGCATCGGATTCAGCCGTATCTTATGAAATTAAAAAACTGCCATTTCCTATTCCACAAATGAATCATGGTGCTTGGCACCCTAATGCCAGAAACATCTTGGATAGCTTTATAGATCAAAACAAATACCTAATCAATGACACACTAACTACATTTCCTAGCTGA

Protein

MAISLDEDNQKIIEIHQVINTNSRFYGHLVNWYEGVSWHYGIGLDENLIFDTGGLSIFTRNPSEFFIVPDVQKFSPYQTIERLCYALICFKDWDYGLLGWNCEHVARLVASDSAVSYEIKKLPFPIPQMNHGAWHPNARNILDSFIDQNKYLINDTLTTFPS