Your browser is old and dusty. Try Google Chrome!

Details for slr0116

ORF slr0116
Accession NP_442583.1
Symbol pcyA
Category Other
Definition phycocyanobilin:ferredoxin oxidoreductase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -265 -279 4.62115 0.146
NP_441418.1_6 Forward -88 -69 -30.1882 0.262
NP_441453.1_7 Reverse -246 -253 13.4121 0.23
NP_441453.1_7 Reverse -374 -381 11.9372 0.298
NP_441453.1_8 Reverse -24 -41 9.97027 0.239
NP_440761.1_4 Forward -349 -330 -20.3551 0.287
NP_440304.1_7 Forward -84 -66 18.8987 0.201
NP_442478.1_9 Forward -45 -27 13.7855 0.295
NP_439918.1_2 Reverse -358 -377 -4.32711 0.274
NP_442196.1_10 Reverse -256 -275 15.3391 0.149
NP_442110.1_7 Forward -344 -330 2.5562 0.222
NP_441558.1_5 Forward -276 -257 12.4875 0.0677
NP_441713.1_8 Reverse -375 -393 9.55725 0.268
NP_441716.1_1 Reverse -265 -279 5.21113 0.239
NP_440343.1_3 Forward -157 -139 6.1149 0.242
NP_442634.1_4 Forward -216 -202 3.53951 0.105
NP_443018.1_3 Reverse -266 -273 9.38056 0.128
NP_443018.1_3 Forward -33 -26 7.6106 0.156
NP_440376.1_1 Forward -79 -70 -1.27858 0.297
NP_442687.1_7 Forward -268 -258 12.8614 0.0636
NP_442687.1_7 Reverse -253 -263 4.79825 0.234
NP_442191.1_4 Reverse -139 -153 12.1566 0.225
NP_441846.1_10 Reverse -138 -157 -16.9135 0.256
NP_442530.1_2 Forward -44 -34 14.7297 0.203
NP_442161.1_7 Forward -39 -20 6.09597 0.196
NP_442782.1_2 Forward -267 -253 3.8345 0.261
NP_442782.1_2 Reverse -254 -268 2.35953 0.275
NP_442782.1_2 Reverse -253 -267 0.88457 0.282
NP_441414.1_9 Forward -274 -255 -5.99873 0.185
NP_440607.1_4 Forward -312 -293 8.45592 0.217
NP_441958.1_5 Forward -268 -258 -2.18325 0.267
NP_442486.1_6 Forward -280 -261 -5.9004 0.28
NP_440203.1_5 Forward -277 -267 8.73102 0.288
NP_443001.1_7 Reverse -259 -278 2.0644 0.279
NP_440984.1_7 Reverse -260 -274 6.29277 0.219
NP_441591.1_10 Reverse -361 -380 4.81767 0.297
NP_440827.1_1 Reverse -169 -188 14.9458 0.235
NP_440602.1_8 Reverse -142 -156 14.9459 0.137
NP_442002.1_9 Forward -268 -261 12.2322 0.185
NP_441654.1_7 Reverse -100 -119 10.6938 0.299
NP_440809.1_9 Forward -166 -148 -7.55234 0.225
NP_441294.1_4 Reverse -264 -283 8.16093 0.217
NP_442885.1_5 Reverse -105 -124 15.3382 0.236
NP_440147.1_4 Reverse -68 -81 1.19926 0.235
NP_441916.1_10 Reverse -281 -300 1.37609 0.264
NP_440206.1_9 Forward -256 -237 8.25926 0.277
NP_442396.1_5 Forward -122 -109 5.42749 0.285
NP_442004.1_6 Forward -378 -364 9.2427 0.14
NP_440703.1_9 Forward -273 -260 8.47516 0.226
NP_440018.1_3 Forward -279 -260 3.04771 0.28
NP_001035871.2_5 Forward -393 -375 19.4887 0.191
NP_001035871.2_7 Reverse -361 -371 13.648 0.219
NP_442982.1_5 Reverse -286 -305 3.24438 0.212
NP_441644.1_6 Reverse -265 -275 8.23937 0.104
NP_442215.1_1 Forward -278 -259 7.07928 0.204
NP_442554.1_8 Forward -273 -263 10.7964 0.043
NP_442142.1_4 Forward -277 -264 6.70522 0.158
NP_440881.1_4 Reverse -240 -259 1.17943 0.226
NP_441618.1_7 Reverse -196 -215 15.5439 0.295
NP_441826.1_2 Forward -151 -137 -4.62196 0.298
NP_442719.1_2 Forward -63 -45 -7.94636 0.239
NP_442808.1_1 Forward -380 -370 1.74956 0.281
NP_442630.1_3 Forward -92 -73 11.6025 0.161
NP_442050.1_1 Reverse -168 -187 8.06259 0.255
NP_440558.1_2 Reverse -261 -280 -6.39206 0.274
NP_441878.1_6 Forward -275 -265 0.668351 0.139
NP_442962.1_1 Forward -245 -226 8.84924 0.239
NP_441549.1_9 Forward -38 -20 -10.7973 0.288
NP_442590.1_10 Reverse -258 -277 3.44104 0.293
NP_442998.1_10 Reverse -72 -79 3.97235 0.297
NP_440899.1_1 Forward -239 -220 6.5532 0.275
NP_440899.1_8 Forward -38 -19 -9.14533 0.258
NP_441559.1_8 Reverse -143 -157 -6.68692 0.279
NP_441296.1_9 Reverse -76 -89 9.45847 0.277
NP_442866.1_1 Forward -349 -330 -7.67036 0.268
NP_440695.1_6 Forward -391 -377 9.44178 0.285
NP_442957.1_9 Reverse -11 -30 8.25926 0.189
NP_442993.1_1 Forward -267 -251 -10.5612 0.222
NP_442386.1_9 Reverse -264 -273 6.48915 0.219
NP_441271.1_8 Reverse -375 -385 17.188 0.206
NP_442791.1_5 Reverse -361 -380 -9.93197 0.279
NP_441160.1_1 Reverse -142 -161 -10.9153 0.279
NP_440586.1_9 Reverse -247 -266 7.07928 0.273
NP_440027.1_3 Forward -382 -364 5.32826 0.245
NP_440408.1_7 Reverse -19 -38 7.27595 0.29
NP_439943.1_1 Forward -260 -241 -12.2919 0.296
NP_442783.1_8 Forward -364 -345 14.1583 0.266
NP_440316.1_10 Reverse -356 -366 7.94484 0.245
NP_441616.1_7 Reverse -40 -58 19.1937 0.157
NP_441018.1_7 Forward -310 -291 10.6192 0.201
NP_442262.1_10 Reverse -266 -273 9.47889 0.187
NP_442262.1_10 Forward -33 -26 8.8889 0.219
NP_441689.1_5 Reverse -23 -33 4.99446 0.285
NP_440826.1_5 Reverse -19 -37 15.6735 0.231
NP_440297.1_9 Reverse -266 -276 0.766681 0.282
NP_442280.1_10 Forward -33 -15 6.33103 0.279
NP_441896.1_5 Forward -337 -330 15.3787 0.268
NP_440888.1_2 Reverse -109 -123 9.73373 0.116
NP_440888.1_2 Forward -181 -167 7.3738 0.198
NP_441543.1_3 Forward -375 -361 14.1586 0.163
NP_442845.1_2 Reverse -19 -33 9.73436 0.168
NP_440982.1_1 Forward -372 -353 7.37347 0.294
NP_441469.1_8 Reverse -171 -180 8.06287 0.227
NP_440071.1_4 Forward -263 -244 13.2741 0.234
NP_440998.1_3 Forward -220 -201 1.47442 0.293
NP_441462.1_2 Reverse -70 -80 -0.806614 0.254
NP_441462.1_2 Forward -267 -257 -1.29827 0.299
NP_442428.1_4 Reverse -141 -160 5.70265 0.211
NP_440603.1_9 Reverse -259 -278 0.687771 0.284
NP_440673.1_3 Forward -32 -25 10.5605 0.123
NP_440865.1_9 Reverse -132 -151 -9.34199 0.285
NP_441052.1_2 Forward -274 -264 4.79825 0.145
NP_442414.1_8 Reverse -262 -281 5.211 0.296
NP_442907.1_9 Forward -279 -260 -6.68705 0.289
NP_441004.1_4 Forward -269 -259 8.33817 0.277
NP_442366.1_3 Forward -281 -263 -5.38906 0.287
NP_441729.1_5 Forward -240 -221 17.5024 0.168
NP_442208.1_5 Forward -281 -262 0.786102 0.248
NP_441409.1_6 Reverse -199 -218 -14.7502 0.266
NP_441409.1_8 Reverse -331 -350 12.0296 0.209
NP_442843.1_1 Reverse -26 -45 -0.39387 0.186
NP_442038.1_1 Forward -245 -226 6.68596 0.179
NP_441078.1_4 Reverse -70 -79 -1.18024 0.237
NP_442729.1_5 Reverse -168 -178 14.238 0.22
NP_441094.1_6 Reverse -251 -268 9.87119 0.257
NP_441432.1_8 Reverse -24 -33 2.55633 0.298
NP_440713.1_4 Forward -272 -253 3.04771 0.251
NP_440565.1_7 Reverse -247 -266 -1.27885 0.282
NP_440565.1_7 Forward -244 -225 -2.16383 0.291
NP_440386.1_3 Forward -64 -45 -6.49039 0.27
NP_440284.1_8 Reverse -92 -111 14.3549 0.118
NP_442008.1_2 Forward -283 -264 4.916 0.232
NP_441807.1_5 Reverse -346 -365 8.55425 0.259
NP_441744.1_6 Reverse -147 -166 17.6649 0.21
NP_440486.1_6 Forward -281 -262 16.2241 0.207
NP_440459.1_2 Reverse -256 -273 9.57695 0.224
NP_440010.1_10 Reverse -175 -194 4.81767 0.244
NP_441168.1_7 Forward -243 -224 14.8474 0.292
NP_441948.1_6 Reverse -27 -44 19.0167 0.103
NP_441329.1_3 Reverse -325 -335 13.6534 0.261
NP_441895.1_10 Reverse -27 -46 -27.7299 0.29
NP_442796.1_10 Reverse -273 -292 7.96426 0.269
NP_440671.1_4 Reverse -19 -33 5.70279 0.275
NP_442021.1_9 Forward -160 -141 11.0125 0.116
NP_441813.1_3 Reverse -277 -296 13.2677 0.296
NP_442707.1_2 Forward -22 -12 18.3679 0.175
NP_441727.1_3 Forward -41 -22 2.65439 0.299
NP_440945.1_1 Reverse -218 -237 11.5042 0.232
NP_440546.1_4 Reverse -265 -275 9.17338 0.151
NP_442340.1_3 Forward -216 -197 -10.9153 0.295
NP_442402.1_4 Forward -269 -250 -2.75457 0.203
NP_442402.1_4 Forward -36 -17 -2.95123 0.209
NP_442402.1_10 Forward -260 -250 13.1559 0.204
NP_442402.1_10 Forward -259 -249 13.0576 0.204
NP_441848.1_7 Forward -33 -14 -4.42619 0.292
NP_439948.1_2 Reverse -47 -65 14.7077 0.259
NP_439942.1_2 Reverse -290 -309 14.1524 0.228
NP_440843.1_8 Forward -118 -99 13.7658 0.297
NP_442039.1_7 Reverse -247 -257 11.2881 0.257
NP_441811.1_1 Forward -188 -169 7.27595 0.28
NP_442679.1_1 Reverse -18 -37 6.58763 0.147
NP_442696.1_6 Reverse -291 -310 -12.9802 0.256
NP_440505.1_3 Forward -81 -71 9.61647 0.122
NP_440505.1_3 Reverse -146 -156 5.09324 0.246
NP_441701.1_3 Forward -122 -105 9.38028 0.245
NP_440308.1_6 Forward -282 -263 0.196116 0.3
NP_440914.1_1 Reverse -25 -35 6.76087 0.267
NP_442533.1_6 Reverse -265 -274 4.22796 0.186
NP_443016.1_1 Reverse -259 -278 5.89931 0.127
NP_441028.1_6 Forward -259 -249 8.04271 0.217
NP_441028.1_6 Forward -258 -248 6.0761 0.232
NP_439903.1_6 Reverse -255 -274 2.16195 0.231
NP_441286.1_1 Reverse -264 -276 -6.45087 0.265
NP_440886.1_7 Forward -148 -138 4.30615 0.243
NP_442614.1_2 Reverse -265 -279 9.5377 0.242
NP_442072.1_9 Reverse -69 -87 -21.712 0.212
NP_441403.1_4 Forward -242 -224 6.90232 0.282
NP_442963.1_3 Forward -205 -187 20.472 0.142
NP_442893.1_4 Forward -66 -47 4.91521 0.175
NP_442365.1_7 Reverse -99 -118 -1.08219 0.189
NP_440293.1_10 Reverse -354 -373 -0.0988766 0.243
NP_439988.1_3 Forward -278 -264 8.06273 0.266
NP_441246.1_6 Reverse -34 -52 8.7706 0.127
NP_440457.1_1 Forward -278 -266 0.923956 0.25
NP_440457.1_1 Reverse -145 -157 -0.649339 0.271
NP_440457.1_1 Reverse -138 -150 -0.944332 0.285
NP_442509.1_5 Forward -372 -355 12.8211 0.286
NP_440554.1_4 Forward -144 -134 2.43831 0.265
NP_440554.1_4 Forward -33 -23 2.43831 0.265
NP_442862.1_3 Reverse -151 -168 5.44704 0.276
NP_441173.1_9 Reverse -325 -333 14.0803 0.17
NP_441173.1_9 Forward -258 -250 11.3271 0.226
NP_441173.1_9 Reverse -326 -334 10.9338 0.242
NP_443010.1_10 Reverse -145 -162 6.92605 0.179
NP_440175.1_7 Reverse -353 -371 8.87516 0.285
NP_440216.1_1 Forward -79 -65 -12.4884 0.274
NP_440172.1_1 Reverse -265 -275 1.94665 0.29
NP_442379.1_10 Forward -86 -69 -3.69774 0.265
NP_443052.1_8 Forward -89 -70 -12.1936 0.249
NP_440072.1_5 Reverse -357 -375 -1.75081 0.264
NP_442116.1_6 Forward -51 -34 8.26445 0.254
NP_440261.1_5 Forward -262 -249 -12.4687 0.297
NP_440988.1_2 Forward -320 -302 6.214 0.299
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAACATTCAGAAATTCTTAACCAGGGACCCCTAACCCTAGTGCCCGAAAGGTTTGAAGCTATTTGGTTTGGTAAAAGTATCAAGCTGACCCATTTGGAGTTTGAGTTGCTTCACTGTCTGTTGCAGCGCCATGGGCAAACGGTTTCCCCCAGTGATATTTTGCGGGAAGTATGGGGCTACGAACCAGATGATGACATTGAAACCATCCGGGTGCACATTCGTCACCTCCGCACTAAGTTGGAACCGAATCCCCGTCGACCTCGCTTTATTAAAACGGTGTATGGGGCAGGCTATTGTTTGGAACTGTCAACGGAAGAAGGAGGCGGTAGTCCAACGTAGGTTTTAGCTTAATTTCCAGCCCATTATTCCCATTGCTTTGCCCTAGATTTGAGTATTTACC

CDS

ATGGCCGTCACTGATTTAAGTTTGACCAATTCTTCCCTGATGCCTACGTTGAACCCGATGATTCAACAGTTGGCCCTGGCGATCGCCGCTAGTTGGCAAAGTTTACCCCTCAAGCCCTATCAATTGCCGGAGGATTTGGGCTACGTAGAAGGCCGCCTGGAAGGGGAAAAGTTAGTGATTGAAAATCGGTGCTACCAAACGCCCCAGTTTCGCAAAATGCATTTGGAGTTGGCCAAGGTGGGCAAAGGGTTGGATATTCTCCACTGTGTAATGTTTCCTGAGCCTTTATACGGTCTACCTTTGTTTGGCTGTGACATTGTGGCCGGCCCCGGTGGAGTAAGTGCGGCTATTGCGGATCTATCCCCCACCCAAAGCGATCGCCAATTGCCCGCAGCGTACCAAAAATCATTGGCAGAGCTAGGCCAGCCAGAATTTGAGCAACAACGGGAATTGCCCCCCTGGGGAGAAATATTTTCTGAATATTGTTTATTCATCCGTCCCAGCAATGTCACTGAAGAAGAAAGATTTGTACAAAGGGTAGTGGACTTTTTGCAAATTCATTGTCACCAATCCATCGTTGCCGAACCCTTGTCTGAAGCTCAAACTTTGGAGCACCGTCAGGGGCAAATTCATTACTGCCAACAACAACAGAAAAATGATAAAACCCGTCGGGTACTGGAAAAAGCTTTTGGGGAAGCTTGGGCGGAACGGTATATGAGCCAAGTCTTATTTGATGTTATCCAATAA

Protein

MAVTDLSLTNSSLMPTLNPMIQQLALAIAASWQSLPLKPYQLPEDLGYVEGRLEGEKLVIENRCYQTPQFRKMHLELAKVGKGLDILHCVMFPEPLYGLPLFGCDIVAGPGGVSAAIADLSPTQSDRQLPAAYQKSLAELGQPEFEQQRELPPWGEIFSEYCLFIRPSNVTEEERFVQRVVDFLQIHCHQSIVAEPLSEAQTLEHRQGQIHYCQQQQKNDKTRRVLEKAFGEAWAERYMSQVLFDVIQ