Your browser is old and dusty. Try Google Chrome!

Details for slr0115

ORF slr0115
Accession NP_442582.1
Symbol rpaA, ycf27
Category response regulator for energy transfer from phycobilisomes to photosystems
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -291 -305 13.5693 0.168
NP_440795.1_7 Reverse -236 -243 10.6589 0.143
NP_442291.1_5 Forward -139 -123 -4.56302 0.28
NP_442151.1_6 Reverse -301 -315 8.25939 0.178
NP_441098.1_3 Forward -208 -189 2.39861 0.25
NP_441098.1_3 Forward -209 -190 1.82439 0.25
NP_441476.1_5 Forward -106 -87 -1.47551 0.205
NP_442062.1_3 Forward -216 -197 1.0811 0.23
NP_441900.1_2 Reverse -382 -400 9.6548 0.114
NP_441402.1_9 Forward -185 -166 16.7149 0.29
NP_440056.1_2 Forward -379 -360 15.9291 0.296
NP_441716.1_2 Forward -208 -189 0.484533 0.264
NP_440747.1_10 Reverse -232 -244 -11.9574 0.178
NP_441014.1_10 Reverse -348 -367 -1.47628 0.262
NP_440376.1_1 Forward -244 -235 5.70292 0.12
NP_442946.1_4 Forward -166 -148 18.8987 0.124
NP_440360.1_5 Reverse -254 -273 3.93269 0.297
NP_442937.1_5 Forward -322 -303 9.14423 0.202
NP_440651.1_7 Reverse -133 -152 12.5858 0.282
NP_440318.1_1 Reverse -349 -368 4.52268 0.24
NP_440203.1_5 Forward -314 -304 9.71433 0.245
NP_440138.1_6 Forward -315 -296 5.2102 0.23
NP_440138.1_6 Forward -384 -365 3.83357 0.24
NP_440809.1_8 Forward -232 -213 7.27595 0.295
NP_441294.1_7 Forward -314 -300 10.6905 0.177
NP_441646.1_1 Reverse -301 -320 11.9958 0.098
NP_442566.1_7 Reverse -283 -302 16.2241 0.213
NP_440147.1_4 Reverse -306 -319 3.65753 0.183
NP_441916.1_7 Forward -244 -234 4.10993 0.19
NP_441916.1_7 Forward -299 -289 1.455 0.285
NP_441041.1_4 Forward -275 -256 -7.17871 0.182
NP_440569.1_8 Forward -156 -137 8.65258 0.28
NP_001035871.2_7 Reverse -71 -81 12.1731 0.272
NP_441644.1_6 Forward -385 -375 7.94438 0.113
NP_441310.1_10 Forward -361 -351 17.5416 0.0807
NP_441751.2_8 Reverse -130 -144 -5.50694 0.214
NP_442167.1_3 Forward -80 -62 14.0797 0.297
NP_442142.1_4 Reverse -263 -276 2.96866 0.269
NP_440895.1_6 Forward -144 -131 9.65572 0.22
NP_441020.2_7 Forward -310 -291 6.58682 0.277
NP_441015.1_10 Forward -322 -303 -5.9004 0.235
NP_442253.1_5 Forward -320 -303 0.333834 0.203
NP_441717.1_4 Reverse -34 -53 18.5728 0.25
NP_442719.1_2 Forward -341 -323 -10.4046 0.273
NP_440763.1_2 Forward -163 -145 16.1175 0.268
NP_441612.1_2 Forward -358 -348 18.4242 0.172
NP_441911.1_10 Reverse -8 -27 8.36618 0.257
NP_440031.1_8 Forward -269 -250 17.699 0.186
NP_440558.1_2 Forward -320 -301 -2.65548 0.229
NP_440558.1_2 Reverse -304 -323 -4.81876 0.249
NP_442789.1_4 Forward -271 -252 -6.39206 0.285
NP_441557.1_4 Forward -361 -347 12.6843 0.291
NP_441445.1_1 Forward -326 -307 3.04771 0.22
NP_440356.1_4 Reverse -343 -362 12.6841 0.0585
NP_441819.1_5 Reverse -190 -209 14.5621 0.195
NP_442998.1_5 Forward -336 -326 8.73149 0.261
NP_442998.1_5 Reverse -7 -17 8.53483 0.261
NP_440899.1_8 Forward -28 -9 -11.2103 0.299
NP_441957.1_7 Forward -199 -180 18.584 0.137
NP_442283.1_4 Reverse -298 -317 15.2408 0.286
NP_440134.1_2 Forward -289 -270 2.0644 0.298
NP_440306.1_5 Reverse -7 -26 -2.36049 0.298
NP_441340.1_9 Reverse -145 -155 7.29115 0.289
NP_440586.1_1 Forward -270 -251 -4.13045 0.278
NP_442251.1_5 Reverse -3 -22 18.879 0.227
NP_443039.1_3 Reverse -270 -289 8.84924 0.233
NP_440372.1_3 Forward -206 -192 14.9084 0.17
NP_440819.1_5 Forward -359 -351 7.98423 0.228
NP_440819.1_5 Forward -102 -94 7.8859 0.266
NP_440819.1_5 Forward -358 -350 7.68924 0.266
NP_440316.1_10 Forward -79 -69 7.25653 0.251
NP_442917.1_1 Forward -128 -109 6.39016 0.275
NP_440297.1_9 Forward -77 -67 0.0783647 0.282
NP_440350.1_5 Forward -152 -133 -0.000545616 0.169
NP_440350.1_5 Reverse -350 -369 -1.08219 0.195
NP_441896.1_5 Forward -341 -334 15.3787 0.268
NP_441896.1_9 Forward -239 -226 18.3971 0.293
NP_441894.1_1 Forward -377 -358 -5.01543 0.258
NP_440888.1_2 Reverse -92 -106 5.50552 0.276
NP_442277.1_7 Forward -124 -108 -1.80754 0.286
NP_440575.1_8 Forward -351 -332 -6.68705 0.289
NP_442710.1_7 Reverse -203 -222 8.82759 0.0963
NP_443062.1_1 Reverse -284 -302 3.76806 0.285
NP_440519.1_8 Forward -256 -240 1.23851 0.29
NP_440504.1_7 Reverse -302 -321 -3.3438 0.244
NP_440673.1_3 Forward -315 -308 6.72562 0.277
NP_441052.1_2 Reverse -235 -245 4.20827 0.163
NP_441052.1_2 Reverse -135 -145 -0.708283 0.294
NP_442813.1_4 Reverse -353 -372 -3.44213 0.292
NP_442515.1_1 Reverse -307 -321 -3.147 0.287
NP_442709.1_4 Forward -222 -203 7.01554 0.18
NP_441046.1_2 Forward -265 -246 5.60432 0.225
NP_440338.1_4 Reverse -336 -355 5.99684 0.292
NP_442689.1_8 Reverse -193 -210 -6.15601 0.28
NP_442689.1_8 Forward -28 -11 -6.746 0.288
NP_441349.1_10 Forward -254 -235 -1.37718 0.103
NP_441349.1_10 Reverse -291 -310 -6.49039 0.23
NP_441409.1_6 Reverse -284 -303 -8.65367 0.172
NP_439960.1_10 Reverse -88 -106 -4.20908 0.292
NP_440588.1_2 Forward -147 -128 -6.1954 0.273
NP_439950.1_1 Forward -266 -257 13.1761 0.277
NP_441570.1_1 Reverse -58 -76 -15.7138 0.233
NP_441078.1_4 Reverse -235 -244 -0.885252 0.209
NP_442348.1_2 Reverse -103 -112 13.2744 0.198
NP_440707.1_9 Forward -271 -252 10.0292 0.198
NP_442443.1_1 Forward -271 -252 -6.78538 0.298
NP_441432.1_8 Reverse -57 -66 9.73449 0.0754
NP_441432.1_8 Reverse -307 -316 9.24284 0.0755
NP_440461.1_3 Reverse -300 -319 16.1257 0.212
NP_442353.1_4 Forward -316 -297 1.76863 0.242
NP_442727.1_1 Reverse -91 -105 10.7177 0.297
NP_442010.1_1 Reverse -347 -365 14.2763 0.205
NP_442400.1_10 Reverse -13 -26 9.51548 0.271
NP_441968.1_1 Reverse -144 -152 15.162 0.257
NP_440442.1_9 Forward -386 -367 15.4374 0.162
NP_441800.1_3 Forward -77 -59 10.2456 0.279
NP_440025.1_3 Reverse -381 -395 9.93309 0.29
NP_440010.1_3 Reverse -92 -111 -7.27704 0.268
NP_441943.1_8 Forward -109 -90 -13.5702 0.28
NP_441329.1_6 Forward -367 -348 3.867 0.212
NP_441329.1_6 Reverse -9 -28 2.81659 0.217
NP_441895.1_2 Forward -373 -354 -7.67036 0.0995
NP_441813.1_3 Forward -368 -349 14.8191 0.238
NP_442028.1_1 Reverse -189 -202 8.17859 0.289
NP_441009.1_4 Reverse -371 -390 9.63589 0.298
NP_440219.1_1 Forward -231 -212 12.4595 0.276
NP_441541.1_1 Forward -217 -199 2.29379 0.199
NP_441541.1_1 Forward -126 -108 -0.76195 0.237
NP_441541.1_1 Reverse -188 -206 -2.95826 0.264
NP_441541.1_1 Reverse -189 -207 -4.00868 0.271
NP_441541.1_1 Forward -214 -196 -4.48614 0.277
NP_440354.1_7 Reverse -370 -388 9.65558 0.224
NP_442402.1_4 Reverse -85 -104 -1.37794 0.189
NP_442402.1_4 Forward -388 -369 -3.93454 0.22
NP_442402.1_4 Forward -387 -368 -4.52452 0.226
NP_442402.1_10 Reverse -349 -359 12.0743 0.224
NP_441848.1_4 Forward -210 -194 13.1847 0.195
NP_442679.1_1 Forward -371 -352 4.22769 0.147
NP_442679.1_1 Reverse -5 -24 -3.73712 0.262
NP_442829.1_5 Reverse -222 -241 18.6964 0.159
NP_440351.1_10 Forward -293 -274 13.175 0.2
NP_440914.1_1 Reverse -308 -318 8.41992 0.191
NP_440914.1_7 Forward -219 -200 7.30471 0.283
NP_442533.1_6 Reverse -235 -244 3.34298 0.216
NP_440854.1_5 Reverse -23 -37 14.7174 0.274
NP_442203.1_1 Forward -124 -110 14.0489 0.279
NP_442203.1_3 Forward -203 -184 3.9289 0.291
NP_441697.1_5 Reverse -334 -353 -10.5523 0.28
NP_441028.1_6 Reverse -350 -360 14.6309 0.158
NP_442202.1_10 Reverse -68 -82 2.85119 0.282
NP_441527.1_4 Forward -364 -345 -2.24448 0.155
NP_441527.1_4 Forward -363 -344 -6.06416 0.214
NP_441527.1_4 Reverse -14 -33 -10.3613 0.27
NP_441527.1_4 Reverse -13 -32 -10.5523 0.272
NP_442588.1_1 Forward -272 -253 7.07928 0.259
NP_441286.1_1 Reverse -128 -140 -1.63265 0.145
NP_440092.1_4 Reverse -72 -91 17.7974 0.0799
NP_440886.1_7 Reverse -234 -244 7.15773 0.103
NP_440513.1_6 Forward -270 -251 9.93006 0.249
NP_442459.1_7 Reverse -80 -99 2.16274 0.242
NP_442794.1_1 Forward -41 -29 5.74217 0.209
NP_441836.1_1 Forward -255 -236 13.4473 0.223
NP_440358.1_8 Forward -271 -252 1.96607 0.246
NP_439988.1_7 Forward -383 -369 13.1753 0.292
NP_440422.1_10 Forward -31 -12 8.95209 0.212
NP_442867.1_8 Reverse -357 -376 5.80098 0.275
NP_440987.1_7 Reverse -26 -40 17.3058 0.198
NP_442680.1_5 Forward -370 -351 1.3422 0.243
NP_442680.1_5 Reverse -4 -23 -0.709294 0.292
NP_442297.1_4 Reverse -367 -386 11.7516 0.294
NP_441489.1_3 Forward -208 -194 9.17885 0.232
NP_442582.1_3 Forward -209 -195 14.2399 0.237
NP_441885.1_5 Reverse -235 -245 0.766681 0.123
NP_442703.1_9 Reverse -213 -231 3.55906 0.288
NP_442341.1_7 Reverse -234 -248 1.47456 0.288
NP_441173.1_9 Reverse -351 -359 9.75379 0.284
NP_440191.1_4 Reverse -352 -362 14.6025 0.266
NP_443000.1_7 Reverse -56 -66 2.24165 0.226
NP_440552.1_8 Forward -214 -197 16.1903 0.102
NP_442451.1_2 Reverse -316 -335 -6.29373 0.232
NP_440175.1_7 Forward -82 -64 13.9499 0.174
NP_440216.1_9 Forward -292 -283 7.17789 0.286
NP_440216.1_9 Reverse -143 -152 5.80125 0.289
NP_440416.1_9 Forward -318 -299 -19.3717 0.274
NP_440416.1_9 Reverse -369 -388 -19.6667 0.276
NP_442116.1_6 Reverse -195 -212 15.1399 0.141
NP_440885.1_6 Reverse -323 -342 7.98055 0.227
NP_440988.1_10 Forward -319 -305 13.8056 0.159
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTGGTGGTGCTATACACCGATGGTATTCCCGAAGCAGAAAACGGGGAAAAACAATTTTATGGTTTGGCAAGATTTCAAGAGGTGCTCATTGCCAACCACCAGTCAACAGCCTTGGAAATTAGTCAAGCAGTGGTGGAGGATTTAATGGCTTATATTGGTGACAGCCGGGTTTTTGATGACATTACTTTAGTCATTTTTAAAAAAATATAGTTAGCTTCAGCACAAGATTACCCATGTTTTAGATGGAGTTTTTCTTGGTCATGATGCTCGCAAGTCTATAATTACTATAAAAATGCCGCGGGAAACAGGGCGCTAATTTTCAGGCCCTGGGACTGTGAAAGCCTTTATAATAGGTTGCCCCTTTAAAATCGTTTTTTTCCTTTAGTTTTAGCCCCTGAGC

CDS

ATGCCTCGAATACTGATCATTGACGATGACCCGGCAATTTCCGATTTAGTCTCCATTAATTTAGAAATGGCAGGCTACGATGTCCAACAGGCAGTGGATGGCATCAAGGGGCAAGCGTTGGCGGTGCAACTACAACCGGATCTGATCATGTTGGACTTGATGTTGCCCAAAGTGGATGGATTTACGGTTTGTCAACGTTTGCGCCGGGACGAACGCACAGCAGATATTCCGGTTTTGATGCTAACGGCGTTGGGTCAGATCCAGGATAAAATTCAAGGCTTTGACTCTGGGGCGGACGATTACCTCACTAAGCCTTTCGACGTGGAGGAAATGTTAGCCCGGGTGAGGGCCCTACTGCGACGCACCGATCGCATCCCCCAGGCGGCAAAACATTCAGAAATTCTTAACCAGGGACCCCTAACCCTAGTGCCCGAAAGGTTTGAAGCTATTTGGTTTGGTAAAAGTATCAAGCTGACCCATTTGGAGTTTGAGTTGCTTCACTGTCTGTTGCAGCGCCATGGGCAAACGGTTTCCCCCAGTGATATTTTGCGGGAAGTATGGGGCTACGAACCAGATGATGACATTGAAACCATCCGGGTGCACATTCGTCACCTCCGCACTAAGTTGGAACCGAATCCCCGTCGACCTCGCTTTATTAAAACGGTGTATGGGGCAGGCTATTGTTTGGAACTGTCAACGGAAGAAGGAGGCGGTAGTCCAACGTAG

Protein

MPRILIIDDDPAISDLVSINLEMAGYDVQQAVDGIKGQALAVQLQPDLIMLDLMLPKVDGFTVCQRLRRDERTADIPVLMLTALGQIQDKIQGFDSGADDYLTKPFDVEEMLARVRALLRRTDRIPQAAKHSEILNQGPLTLVPERFEAIWFGKSIKLTHLEFELLHCLLQRHGQTVSPSDILREVWGYEPDDDIETIRVHIRHLRTKLEPNPRRPRFIKTVYGAGYCLELSTEEGGGSPT