Your browser is old and dusty. Try Google Chrome!

Details for slr0093

ORF slr0093
Accession NP_442496.1
Symbol dnaJ
Category Chaperones
Definition DnaJ protein, heat shock protein 40, molecular chaperone
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -313 -299 17.5025 0.0786
NP_442711.1_1 Forward -232 -218 10.6193 0.275
NP_441061.1_2 Reverse -305 -319 8.65272 0.0856
NP_441061.1_2 Forward -312 -298 2.94952 0.168
NP_441061.1_2 Reverse -264 -278 0.982901 0.196
NP_440795.1_7 Forward -312 -305 14.6904 0.0123
NP_440795.1_7 Reverse -305 -312 14.6904 0.0123
NP_440795.1_7 Forward -277 -270 10.2655 0.154
NP_441418.1_6 Reverse -304 -323 -12.3902 0.0643
NP_441418.1_6 Forward -313 -294 -18.9784 0.0841
NP_441418.1_6 Forward -244 -225 -30.4831 0.28
NP_442291.1_5 Reverse -303 -319 9.30165 0.0521
NP_442291.1_5 Forward -314 -298 -1.12144 0.192
NP_440897.1_6 Forward -313 -294 1.96529 0.17
NP_440897.1_9 Reverse -94 -112 13.9813 0.215
NP_441453.1_4 Reverse -304 -312 16.539 0.00633
NP_441453.1_4 Forward -313 -305 16.539 0.00633
NP_442151.1_6 Forward -278 -264 9.63603 0.142
NP_442151.1_6 Reverse -304 -318 8.45605 0.172
NP_441818.1_1 Reverse -305 -316 15.6928 0.0257
NP_440226.1_1 Reverse -304 -323 10.7175 0.0603
NP_441465.1_8 Reverse -166 -184 7.68896 0.235
NP_440120.1_4 Forward -276 -262 15.7325 0.273
NP_440150.1_6 Reverse -301 -320 6.68596 0.223
NP_440150.1_6 Forward -316 -297 0.58944 0.297
NP_442173.1_1 Forward -312 -304 15.4574 0.00633
NP_442173.1_1 Reverse -305 -313 15.4574 0.00633
NP_442752.1_4 Forward -313 -306 13.8055 0.0199
NP_442752.1_4 Reverse -304 -311 13.8055 0.0199
NP_443027.1_4 Forward -315 -305 13.1564 0.0521
NP_443027.1_4 Reverse -302 -312 11.8781 0.0872
NP_442975.1_10 Reverse -300 -314 5.21053 0.228
NP_442975.1_10 Forward -317 -303 3.04726 0.263
NP_441225.1_4 Reverse -265 -284 -12.2919 0.284
NP_440784.1_7 Forward -312 -305 15.9687 0.0123
NP_440784.1_7 Reverse -305 -312 15.9687 0.0123
NP_442909.1_7 Reverse -305 -319 9.73373 0.14
NP_440061.1_9 Reverse -302 -316 21.73 0.00189
NP_441054.1_2 Forward -277 -258 9.73422 0.284
NP_441145.1_1 Reverse -234 -253 7.7676 0.254
NP_441476.1_5 Reverse -258 -277 -3.44213 0.237
NP_440878.1_9 Reverse -294 -313 -2.26216 0.258
NP_442062.1_8 Forward -313 -303 19.4496 0.000558
NP_442062.1_8 Reverse -304 -314 17.3846 0.00193
NP_442062.1_8 Forward -385 -375 8.33817 0.0769
NP_441859.1_3 Reverse -303 -322 9.7334 0.125
NP_441802.1_1 Forward -336 -317 6.39097 0.269
NP_440304.1_4 Forward -315 -305 9.91146 0.051
NP_440304.1_4 Forward -262 -252 3.61828 0.295
NP_440304.1_4 Reverse -302 -312 1.84832 0.299
NP_442242.1_4 Forward -312 -305 14.3954 0.0124
NP_442242.1_4 Reverse -305 -312 14.3954 0.0124
NP_440044.1_8 Reverse -305 -324 18.4857 0.0159
NP_441619.1_8 Forward -103 -89 6.88214 0.295
NP_441208.1_9 Forward -316 -302 14.0609 0.103
NP_441208.1_9 Reverse -239 -253 4.62115 0.297
NP_440370.1_10 Forward -322 -303 7.47261 0.257
NP_442110.1_7 Reverse -263 -277 4.91614 0.188
NP_442110.1_7 Forward -313 -299 3.34284 0.21
NP_442110.1_7 Forward -295 -281 -0.197071 0.276
NP_442726.1_7 Reverse -262 -280 6.70565 0.192
NP_441925.1_4 Reverse -213 -232 -11.7026 0.253
NP_441925.1_4 Reverse -210 -229 -13.6693 0.258
NP_441083.1_5 Reverse -304 -314 20.3345 0.00053
NP_441083.1_5 Forward -313 -303 11.3864 0.0159
NP_441083.1_5 Reverse -369 -379 1.35667 0.209
NP_441738.1_2 Forward -311 -304 15.28 0.0102
NP_441738.1_2 Reverse -306 -313 15.28 0.0102
NP_441738.1_4 Reverse -259 -278 5.70265 0.206
NP_440209.1_1 Reverse -304 -312 18.1123 0.00295
NP_440209.1_1 Forward -313 -305 18.1123 0.00295
NP_442889.1_1 Forward -53 -34 -15.3402 0.289
NP_442889.1_8 Reverse -301 -315 5.70218 0.217
NP_440447.1_1 Reverse -299 -317 5.23069 0.213
NP_440178.1_7 Reverse -303 -322 -12.2919 0.118
NP_440178.1_7 Forward -244 -225 -23.01 0.287
NP_442570.1_3 Forward -50 -31 0.392778 0.207
NP_441025.1_5 Reverse -270 -284 18.2892 0.179
NP_442601.1_9 Reverse -218 -237 13.0775 0.117
NP_441716.1_1 Reverse -304 -318 18.0925 0.0205
NP_441716.1_1 Reverse -210 -224 6.98109 0.183
NP_443013.1_3 Forward -237 -218 5.01433 0.297
NP_442111.1_1 Forward -61 -42 13.175 0.29
NP_442111.1_4 Forward -314 -300 21.9274 0.0011
NP_441624.1_7 Forward -198 -184 6.6861 0.275
NP_441163.1_1 Reverse -296 -313 8.10125 0.233
NP_441163.1_1 Forward -279 -262 7.3146 0.245
NP_441215.1_1 Reverse -290 -309 13.1758 0.1
NP_440906.1_5 Forward -312 -305 15.8704 0.0124
NP_440906.1_5 Reverse -305 -312 15.8704 0.0124
NP_440906.1_5 Reverse -211 -218 5.64398 0.292
NP_440438.2_8 Reverse -340 -359 7.86593 0.141
NP_440747.1_10 Reverse -301 -313 17.0502 0.000794
NP_440747.1_10 Forward -316 -304 7.51213 0.00286
NP_440747.1_10 Reverse -207 -219 -12.1541 0.227
NP_441130.1_7 Reverse -292 -306 15.5352 0.287
NP_441130.1_10 Reverse -302 -316 17.9942 0.0144
NP_441130.1_10 Forward -315 -301 8.84938 0.131
NP_442973.1_5 Reverse -295 -314 16.3224 0.0995
NP_441486.1_1 Forward -316 -302 4.62115 0.0425
NP_441486.1_1 Reverse -266 -280 -3.04867 0.175
NP_441486.1_1 Reverse -301 -315 -3.93365 0.184
NP_441486.1_1 Forward -281 -267 -4.7203 0.205
NP_440944.1_2 Reverse -49 -68 9.63589 0.149
NP_442634.1_4 Forward -315 -301 -2.85201 0.156
NP_442634.1_4 Reverse -302 -316 -3.34366 0.161
NP_442634.1_4 Reverse -284 -298 -5.31028 0.246
NP_440403.1_4 Forward -162 -143 -1.27885 0.174
NP_440842.1_6 Forward -88 -69 10.4217 0.284
NP_441014.1_8 Reverse -207 -226 -0.688862 0.218
NP_442848.1_1 Forward -319 -305 7.17775 0.0791
NP_442848.1_9 Reverse -138 -157 11.3075 0.145
NP_443018.1_3 Forward -312 -305 14.8871 0.0123
NP_443018.1_3 Reverse -305 -312 14.8871 0.0123
NP_443018.1_3 Forward -277 -270 4.36568 0.254
NP_443018.1_3 Reverse -270 -277 4.07068 0.299
NP_441634.1_8 Reverse -302 -316 5.99778 0.114
NP_441634.1_8 Forward -231 -217 5.30946 0.114
NP_441634.1_8 Forward -315 -301 -2.95034 0.295
NP_440376.1_1 Forward -313 -304 19.4693 0.000692
NP_440376.1_1 Reverse -304 -313 19.4693 0.000692
NP_440376.1_1 Forward -153 -144 1.1797 0.255
NP_440376.1_1 Reverse -136 -145 0.884706 0.259
NP_440376.1_1 Forward -104 -95 0.196389 0.283
NP_440580.1_5 Forward -211 -197 14.5526 0.248
NP_442687.1_7 Reverse -303 -313 15.8113 0.0125
NP_442687.1_7 Forward -314 -304 8.92815 0.0994
NP_442687.1_7 Forward -154 -144 5.09324 0.221
NP_442191.1_4 Reverse -270 -284 10.6053 0.294
NP_442191.1_4 Reverse -125 -139 10.5083 0.298
NP_442485.1_3 Reverse -302 -321 -2.95047 0.271
NP_442958.1_3 Reverse -293 -312 -2.85214 0.299
NP_441013.1_2 Reverse -89 -107 0.510803 0.254
NP_441080.1_6 Reverse -323 -339 19.6902 0.124
NP_441422.1_7 Reverse -302 -319 6.13536 0.0992
NP_441422.1_7 Reverse -261 -278 5.84037 0.0992
NP_441422.1_7 Forward -280 -263 -8.0243 0.265
NP_440667.1_2 Forward -278 -259 -7.17871 0.273
NP_442658.1_1 Reverse -302 -312 17.0891 0.00615
NP_442658.1_1 Forward -315 -305 9.616 0.147
NP_442658.1_1 Reverse -37 -47 6.96107 0.214
NP_442658.1_1 Reverse -374 -384 6.0761 0.238
NP_442658.1_1 Forward -280 -270 5.78111 0.25
NP_440141.1_4 Forward -281 -262 -11.8003 0.298
NP_440141.1_8 Forward -287 -268 7.17762 0.246
NP_441855.2_4 Reverse -296 -315 12.9937 0.174
NP_442782.1_2 Forward -272 -258 17.8958 0.157
NP_442782.1_2 Forward -103 -89 13.2743 0.173
NP_442782.1_2 Forward -313 -299 7.47274 0.202
NP_442496.1_2 Forward -320 -301 21.3373 0.0457
NP_440656.1_8 Forward -324 -305 4.62101 0.0974
NP_443061.1_4 Reverse -166 -185 1.27776 0.288
NP_441487.1_9 Reverse -303 -322 25.7622 0.00646
NP_441256.1_1 Reverse -301 -320 -9.44032 0.284
NP_442937.1_5 Forward -318 -299 12.6841 0.103
NP_442937.1_5 Forward -375 -356 10.1275 0.17
NP_441958.1_5 Forward -314 -304 12.2714 0.00183
NP_441958.1_5 Reverse -303 -313 12.2714 0.00183
NP_441127.1_1 Forward -281 -267 13.0776 0.204
NP_442836.1_5 Forward -391 -372 2.26107 0.266
NP_442836.1_10 Reverse -189 -199 13.4514 0.224
NP_440984.1_7 Reverse -299 -313 9.93102 0.126
NP_440984.1_7 Forward -318 -304 9.14437 0.131
NP_440984.1_7 Forward -255 -241 6.09611 0.227
NP_442911.1_2 Forward -323 -304 0.58944 0.0657
NP_442911.1_2 Reverse -294 -313 -2.95047 0.105
NP_442911.1_2 Forward -288 -269 -5.40875 0.158
NP_440153.1_5 Forward -312 -298 12.586 0.0645
NP_440153.1_5 Reverse -305 -319 8.94771 0.127
NP_440153.1_8 Reverse -269 -282 -2.04567 0.234
NP_442064.1_1 Reverse -264 -283 -12.9802 0.283
NP_443055.1_6 Forward -321 -303 10.4414 0.125
NP_443055.1_6 Reverse -234 -252 -1.35821 0.277
NP_440993.1_2 Reverse -299 -315 3.89344 0.256
NP_440827.1_3 Reverse -252 -271 10.4225 0.298
NP_440388.1_2 Reverse -206 -225 7.7676 0.0737
NP_441348.1_3 Forward -318 -299 21.3373 0.0253
NP_441099.1_5 Reverse -135 -154 -7.37537 0.174
NP_441099.1_5 Reverse -294 -313 -7.4737 0.176
NP_441099.1_6 Forward -94 -75 13.3725 0.282
NP_442002.1_1 Reverse -186 -204 -7.55234 0.251
NP_442002.1_9 Reverse -367 -374 11.1505 0.185
NP_442002.1_9 Reverse -303 -310 10.7572 0.185
NP_441294.1_7 Reverse -216 -230 11.1704 0.153
NP_441294.1_7 Reverse -300 -314 9.4426 0.244
NP_441646.1_1 Reverse -297 -316 14.8474 0.0796
NP_441646.1_1 Reverse -256 -275 2.45773 0.218
NP_442438.1_10 Reverse -299 -313 11.111 0.0463
NP_442438.1_10 Forward -318 -304 2.85119 0.168
NP_442431.1_10 Forward -235 -217 6.11567 0.195
NP_441000.1_6 Reverse -303 -317 2.85119 0.126
NP_441000.1_6 Forward -314 -300 -2.45868 0.216
NP_442771.1_1 Forward -315 -297 -7.55234 0.171
NP_442771.1_1 Reverse -75 -93 -8.63398 0.2
NP_441674.1_2 Forward -162 -143 4.62101 0.299
NP_440147.1_4 Reverse -302 -315 19.3905 0.00277
NP_440147.1_4 Forward -315 -302 8.47575 0.0504
NP_440147.1_4 Forward -221 -208 3.5592 0.186
NP_441550.1_8 Forward -315 -305 16.7941 0.00906
NP_441550.1_8 Reverse -302 -312 8.82935 0.112
NP_441916.1_5 Reverse -289 -308 15.0441 0.273
NP_441916.1_7 Forward -313 -303 18.4663 0.00144
NP_441916.1_7 Reverse -304 -314 10.3048 0.0261
NP_440465.1_4 Forward -314 -295 12.7825 0.21
NP_440465.1_10 Forward -316 -297 -1.86883 0.299
NP_441041.1_4 Forward -278 -259 0.196116 0.0899
NP_441041.1_7 Reverse -301 -313 14.6087 0.0342
NP_441041.1_7 Reverse -121 -133 4.79381 0.295
NP_441725.1_4 Reverse -299 -313 4.42388 0.278
NP_441725.1_5 Reverse -305 -315 9.02648 0.0553
NP_441725.1_5 Forward -312 -302 2.04498 0.115
NP_441725.1_5 Reverse -270 -280 -0.806614 0.271
NP_439966.1_7 Reverse -302 -312 17.9741 0.00631
NP_439966.1_7 Forward -315 -305 14.8275 0.0177
NP_439966.1_7 Reverse -169 -179 5.38779 0.226
NP_439966.1_9 Forward -315 -306 0.884706 0.253
NP_439966.1_9 Reverse -302 -311 0.884706 0.253
NP_440736.1_3 Forward -387 -368 5.40766 0.223
NP_442941.1_3 Reverse -305 -315 10.9931 0.0116
NP_442941.1_3 Forward -312 -302 10.7964 0.0116
NP_440289.1_2 Reverse -301 -314 11.1307 0.0212
NP_440289.1_2 Forward -316 -303 -4.50394 0.288
NP_440260.1_8 Forward -223 -205 -1.45582 0.233
NP_440260.1_8 Forward -387 -369 -2.3408 0.243
NP_440260.1_8 Reverse -260 -278 -4.8974 0.273
NP_441678.1_9 Forward -273 -254 -4.32711 0.292
NP_442281.1_1 Reverse -299 -313 19.3701 0.00282
NP_442281.1_1 Forward -318 -304 7.3738 0.102
NP_442281.1_1 Forward -150 -136 5.50552 0.155
NP_442281.1_1 Reverse -371 -385 2.35894 0.269
NP_442575.1_8 Forward -312 -293 -1.67217 0.232
NP_442256.1_2 Reverse -302 -320 -6.1757 0.214
NP_442256.1_2 Reverse -218 -236 -7.45401 0.214
NP_442256.1_2 Forward -315 -297 -9.81395 0.292
NP_001035871.2_7 Reverse -186 -196 13.5497 0.219
NP_440437.1_1 Reverse -298 -317 24.6805 0.00694
NP_442012.1_1 Forward -319 -300 1.76941 0.212
NP_442012.1_1 Forward -213 -194 0.58944 0.235
NP_439983.1_7 Forward -103 -85 15.5554 0.157
NP_441556.1_10 Reverse -299 -313 12.0712 0.2
NP_440498.1_1 Forward -322 -304 -3.71743 0.272
NP_440375.1_6 Forward -87 -68 11.9958 0.239
NP_441644.1_6 Reverse -304 -314 17.3841 0.00127
NP_441644.1_6 Forward -278 -268 10.5993 0.0628
NP_441644.1_6 Forward -313 -303 10.1076 0.0628
NP_443049.1_6 Reverse -67 -77 11.3482 0.263
NP_440867.1_10 Reverse -303 -322 1.57275 0.294
NP_442215.1_2 Forward -315 -299 6.25339 0.0723
NP_442215.1_2 Reverse -295 -311 -2.30141 0.195
NP_442029.1_6 Reverse -264 -283 10.8159 0.17
NP_442029.1_6 Forward -318 -299 7.57094 0.223
NP_440253.1_2 Reverse -304 -322 9.65558 0.0463
NP_440929.1_8 Forward -313 -304 19.2726 0.000701
NP_440929.1_8 Reverse -304 -313 19.2726 0.000701
NP_442933.1_10 Forward -313 -304 17.601 0.00325
NP_442933.1_10 Reverse -304 -313 17.601 0.00325
NP_441751.2_8 Forward -312 -298 -0.590395 0.129
NP_441751.2_8 Reverse -305 -319 -3.04867 0.134
NP_442554.1_8 Reverse -305 -315 18.0729 0.00543
NP_442554.1_8 Forward -312 -302 14.1397 0.0144
NP_442554.1_8 Reverse -270 -280 3.22496 0.235
NP_441762.1_7 Reverse -303 -315 11.8387 0.0142
NP_441762.1_7 Forward -314 -302 2.98891 0.0676
NP_442142.1_4 Reverse -301 -314 15.1616 0.0289
NP_442142.1_4 Forward -316 -303 6.90188 0.153
NP_442142.1_4 Forward -80 -67 2.18201 0.299
NP_442292.1_1 Reverse -305 -314 18.486 0.00229
NP_442292.1_1 Forward -312 -303 9.63616 0.0183
NP_442292.1_5 Forward -317 -298 11.7992 0.138
NP_442476.1_6 Forward -312 -298 3.53951 0.156
NP_442476.1_6 Reverse -305 -319 3.24451 0.161
NP_440895.1_10 Forward -38 -21 3.57876 0.149
NP_442381.1_8 Reverse -301 -320 2.85105 0.0839
NP_441711.1_4 Forward -322 -303 5.60432 0.173
NP_441523.1_6 Reverse -206 -225 4.71934 0.251
NP_443009.1_5 Forward -314 -303 18.3477 0.00265
NP_442301.1_2 Reverse -303 -322 5.50519 0.264
NP_442408.2_1 Reverse -304 -323 -3.44213 0.241
NP_441715.1_4 Forward -312 -302 18.8596 0.00741
NP_441715.1_4 Reverse -305 -315 7.84651 0.107
NP_441448.1_1 Forward -280 -261 6.39097 0.249
NP_440183.1_9 Forward -75 -56 -13.2752 0.26
NP_441198.1_5 Reverse -306 -319 13.49 0.206
NP_440379.1_5 Reverse -22 -41 -8.26035 0.25
NP_440464.1_10 Forward -203 -193 12.4352 0.225
NP_441468.1_1 Forward -312 -305 15.8704 0.0124
NP_441468.1_1 Reverse -305 -312 15.8704 0.0124
NP_441468.1_1 Forward -277 -270 4.46401 0.224
NP_441020.2_6 Forward -315 -298 7.90532 0.215
NP_441015.1_10 Forward -318 -299 17.2074 0.0247
NP_441015.1_10 Forward -312 -293 -5.60541 0.228
NP_441015.1_10 Forward -277 -258 -6.78538 0.256
NP_441015.1_10 Forward -234 -215 -10.817 0.288
NP_441673.1_1 Forward -313 -304 20.8459 0.000698
NP_441673.1_1 Reverse -304 -313 20.8459 0.000698
NP_441673.1_1 Forward -278 -269 -8.06341 0.254
NP_441731.1_3 Reverse -296 -315 -5.60541 0.284
NP_441731.1_9 Forward -276 -259 17.9351 0.201
NP_442253.1_5 Forward -173 -156 -7.23765 0.298
NP_441876.1_9 Reverse -296 -306 11.8776 0.269
NP_441876.1_9 Reverse -166 -176 10.5993 0.287
NP_441826.1_2 Reverse -298 -312 14.4542 0.0196
NP_441826.1_2 Forward -319 -305 1.86788 0.14
NP_441826.1_5 Forward -191 -172 4.62101 0.253
NP_442868.1_6 Forward -315 -305 17.4829 0.012
NP_442868.1_6 Reverse -302 -312 10.3048 0.038
NP_442719.1_2 Forward -385 -367 -0.178247 0.162
NP_442719.1_2 Reverse -189 -207 -11.0929 0.287
NP_442719.1_2 Reverse -137 -155 -11.6829 0.294
NP_441056.1_1 Forward -313 -294 -6.68705 0.271
NP_441612.1_2 Reverse -304 -314 8.54929 0.21
NP_441612.1_2 Reverse -38 -48 7.29072 0.256
NP_442227.1_2 Reverse -288 -307 -2.45882 0.274
NP_442361.1_8 Reverse -215 -233 15.0638 0.282
NP_440789.1_8 Reverse -195 -214 20.944 0.0635
NP_440789.1_8 Reverse -37 -56 13.3725 0.28
NP_442808.1_1 Reverse -303 -313 18.4657 0.00201
NP_442808.1_1 Forward -314 -304 8.63269 0.0481
NP_442808.1_1 Reverse -170 -180 5.58445 0.146
NP_442808.1_1 Forward -78 -68 3.71617 0.227
NP_441101.1_10 Reverse -300 -319 -4.42544 0.278
NP_440145.1_3 Forward -323 -304 1.86774 0.122
NP_440145.1_5 Reverse -74 -93 9.93088 0.265
NP_442542.1_2 Reverse -302 -315 8.37742 0.156
NP_442542.1_9 Reverse -297 -311 4.62054 0.292
NP_442542.1_9 Reverse -61 -75 4.62054 0.292
NP_442113.1_10 Reverse -216 -235 1.47442 0.192
NP_442050.1_5 Forward -315 -305 15.6142 0.01
NP_442050.1_5 Reverse -302 -312 6.96107 0.27
NP_440558.1_2 Reverse -260 -279 -3.83545 0.239
NP_442789.1_4 Forward -277 -258 1.47442 0.185
NP_441518.1_3 Forward -323 -304 -4.32711 0.12
NP_441518.1_3 Forward -345 -326 -10.0303 0.235
NP_441878.1_6 Forward -314 -304 10.4031 0.0176
NP_441878.1_6 Reverse -303 -313 10.4031 0.0176
NP_441878.1_6 Forward -279 -269 -7.19813 0.21
NP_441878.1_6 Forward -251 -241 -7.29646 0.217
NP_441878.1_6 Reverse -234 -244 -7.59145 0.245
NP_441878.1_6 Forward -153 -143 -7.88644 0.278
NP_441036.1_8 Reverse -303 -313 17.7779 0.000554
NP_441036.1_8 Forward -314 -304 8.33817 0.174
NP_442650.1_2 Forward -278 -264 6.58777 0.13
NP_441557.1_4 Forward -338 -324 13.0776 0.291
NP_441557.1_5 Forward -313 -304 19.9609 0.000699
NP_441557.1_5 Reverse -304 -313 19.9609 0.000699
NP_441445.1_1 Forward -322 -303 8.06259 0.122
NP_441445.1_1 Forward -287 -268 -0.0988766 0.286
NP_442066.2_4 Forward -313 -294 7.86593 0.0828
NP_442777.1_1 Reverse -313 -332 9.7334 0.194
NP_442419.1_2 Reverse -299 -318 4.62101 0.184
NP_440101.1_5 Reverse -297 -316 5.30933 0.196
NP_441458.1_10 Reverse -295 -314 8.75091 0.181
NP_441458.1_10 Reverse -260 -279 1.47442 0.288
NP_442830.1_5 Forward -245 -231 4.03056 0.239
NP_442183.1_1 Reverse -304 -318 13.9626 0.0376
NP_442183.1_9 Forward -232 -222 9.7148 0.296
NP_440190.1_4 Reverse -376 -393 17.9351 0.0792
NP_441549.1_9 Forward -317 -299 -5.09406 0.198
NP_442347.1_2 Reverse -305 -314 12.4878 0.056
NP_442347.1_2 Forward -312 -303 11.1111 0.056
NP_442645.1_2 Forward -321 -302 -19.9617 0.288
NP_442965.1_2 Forward -277 -258 4.32602 0.168
NP_442965.1_2 Forward -108 -89 -4.13045 0.255
NP_441037.1_4 Forward -315 -305 9.55921 0.21
NP_441037.1_4 Reverse -302 -312 6.92787 0.237
NP_442594.1_7 Reverse -293 -312 3.83357 0.297
NP_442594.1_8 Forward -188 -169 6.09597 0.236
NP_442594.1_8 Forward -111 -92 3.34271 0.286
NP_442317.1_6 Reverse -299 -318 6.09597 0.238
NP_441633.1_3 Reverse -302 -315 15.4572 0.0103
NP_441633.1_3 Forward -315 -302 1.39592 0.109
NP_441633.1_3 Reverse -249 -262 -4.89726 0.216
NP_441633.1_3 Reverse -20 -33 -5.09393 0.223
NP_442764.1_6 Reverse -306 -324 1.49411 0.271
NP_440136.1_2 Forward -312 -305 15.9687 0.0123
NP_440136.1_2 Reverse -305 -312 15.9687 0.0123
NP_442590.1_10 Forward -226 -207 5.70265 0.258
NP_442590.1_10 Forward -313 -294 4.52268 0.274
NP_442998.1_5 Forward -171 -161 15.6147 0.149
NP_442998.1_5 Reverse -366 -376 8.23984 0.267
NP_442998.1_5 Forward -302 -292 7.05986 0.3
NP_442998.1_10 Forward -311 -304 15.5754 0.0102
NP_442998.1_10 Reverse -306 -313 15.5754 0.0102
NP_440299.1_1 Reverse -300 -313 18.1116 0.00453
NP_440299.1_1 Reverse -265 -278 16.5383 0.00987
NP_440299.1_1 Forward -317 -304 9.85179 0.0646
NP_441799.1_1 Forward -317 -303 16.6169 0.0138
NP_441799.1_1 Reverse -300 -314 5.30886 0.214
NP_441007.1_5 Forward -243 -224 9.53756 0.225
NP_441007.1_10 Forward -318 -305 8.9674 0.108
NP_442334.1_2 Forward -323 -306 -12.9408 0.297
NP_442201.1_10 Reverse -293 -312 -6.1954 0.184
NP_441449.1_10 Forward -319 -301 11.0322 0.295
NP_440256.1_1 Forward -316 -297 -6.39206 0.21
NP_440256.1_1 Forward -80 -61 -6.88371 0.223
NP_440256.1_1 Reverse -301 -320 -9.73531 0.287
NP_440087.1_1 Forward -322 -303 -0.885524 0.196
NP_441559.1_8 Reverse -299 -313 12.1926 0.0574
NP_441559.1_8 Reverse -258 -272 -5.60527 0.267
NP_441559.1_8 Reverse -319 -333 -6.58858 0.279
NP_442860.1_7 Forward -353 -335 11.9922 0.259
NP_440915.1_2 Reverse -187 -206 22.3206 0.0657
NP_440915.1_6 Reverse -300 -314 12.4876 0.0208
NP_442785.1_7 Forward -147 -133 9.14437 0.273
NP_441464.1_8 Reverse -304 -318 9.5377 0.189
NP_440702.1_2 Forward -318 -299 -4.6221 0.257
NP_441113.1_3 Forward -155 -141 15.5352 0.235
NP_440306.1_8 Forward -64 -45 -3.34455 0.281
NP_441939.1_3 Forward -312 -293 20.059 0.0103
NP_441939.1_3 Forward -218 -199 6.19431 0.248
NP_441199.1_6 Reverse -247 -266 -1.7705 0.298
NP_439985.1_7 Forward -319 -300 5.40766 0.224
NP_442993.1_1 Forward -250 -234 -2.98973 0.122
NP_442386.1_9 Reverse -303 -312 15.7322 0.0144
NP_442386.1_9 Forward -314 -305 13.8639 0.0289
NP_442386.1_9 Reverse -375 -384 8.16077 0.209
NP_440570.1_5 Forward -162 -143 -3.63879 0.291
NP_441340.1_5 Forward -312 -305 15.6737 0.0124
NP_441340.1_5 Reverse -305 -312 15.6737 0.0124
NP_441340.1_5 Reverse -270 -277 3.97235 0.274
NP_441340.1_9 Reverse -47 -57 7.86959 0.256
NP_440168.1_8 Reverse -257 -276 7.96426 0.179
NP_440327.1_6 Forward -324 -305 3.73603 0.28
NP_442240.1_1 Reverse -296 -315 7.17681 0.253
NP_442240.1_2 Forward -312 -293 -11.5053 0.137
NP_441160.1_1 Reverse -74 -93 -8.16202 0.254
NP_440586.1_8 Forward -312 -305 13.2151 0.026
NP_440586.1_8 Reverse -305 -312 13.2151 0.026
NP_440586.1_9 Forward -279 -260 7.66927 0.273
NP_442251.1_6 Forward -312 -305 15.2804 0.0124
NP_442251.1_6 Reverse -305 -312 15.2804 0.0124
NP_441262.1_3 Reverse -304 -311 14.7888 0.0223
NP_441262.1_3 Forward -313 -306 14.7888 0.0223
NP_443051.1_1 Reverse -303 -312 10.4228 0.00754
NP_443051.1_1 Forward -314 -305 10.4228 0.00754
NP_439937.1_8 Forward -286 -267 -4.52377 0.286
NP_439937.1_9 Forward -209 -192 -1.04349 0.122
NP_439937.1_9 Reverse -303 -320 -15.8914 0.287
NP_441595.1_5 Forward -320 -302 7.88563 0.222
NP_440926.1_5 Reverse -252 -271 7.27595 0.286
NP_440398.1_1 Reverse -223 -242 10.8159 0.271
NP_440408.1_7 Forward -313 -294 8.65258 0.272
NP_440408.1_10 Reverse -248 -267 10.9142 0.176
NP_440439.1_1 Forward -316 -303 10.8357 0.0339
NP_440439.1_1 Reverse -301 -314 10.2457 0.0372
NP_439943.1_1 Reverse -161 -180 -9.34199 0.28
NP_440372.1_2 Forward -312 -305 16.3621 0.0124
NP_440372.1_2 Reverse -305 -312 16.3621 0.0124
NP_441181.1_6 Forward -312 -294 3.95239 0.254
NP_440316.1_10 Reverse -67 -77 6.37155 0.263
NP_439977.1_5 Reverse -298 -317 -3.3438 0.299
NP_441572.1_7 Reverse -298 -317 8.75091 0.074
NP_441572.1_7 Reverse -204 -223 1.76941 0.145
NP_442384.1_10 Forward -313 -300 19.1938 0.00338
NP_442384.1_10 Reverse -210 -223 8.47575 0.0656
NP_442384.1_10 Reverse -304 -317 3.95252 0.172
NP_442114.1_4 Forward -313 -302 9.20345 0.17
NP_441877.1_5 Forward -61 -42 14.7491 0.124
NP_441018.1_7 Forward -317 -298 7.37428 0.272
NP_442790.1_4 Reverse -295 -314 -6.39206 0.144
NP_442790.1_4 Forward -163 -144 -14.9469 0.283
NP_442790.1_4 Reverse -144 -163 -15.9302 0.3
NP_442262.1_10 Forward -312 -305 14.1988 0.0123
NP_442262.1_10 Reverse -305 -312 14.1988 0.0123
NP_441689.1_5 Forward -315 -305 5.87944 0.197
NP_440163.1_10 Forward -247 -237 10.8948 0.187
NP_440163.1_10 Forward -281 -271 9.51814 0.232
NP_440344.1_10 Reverse -297 -314 -4.58271 0.098
NP_440344.1_10 Forward -320 -303 -12.5475 0.257
NP_440075.1_5 Reverse -302 -321 14.0599 0.251
NP_440531.1_6 Forward -393 -374 -2.26216 0.247
NP_440189.1_10 Forward -51 -32 22.9106 0.032
NP_441965.1_10 Forward -316 -300 10.1866 0.107
NP_441640.1_8 Reverse -172 -191 1.37609 0.178
NP_442693.1_7 Forward -279 -260 12.6841 0.202
NP_440297.1_9 Reverse -270 -280 0.176696 0.282
NP_440297.1_9 Forward -312 -302 -0.118297 0.282
NP_440297.1_9 Reverse -305 -315 -0.216628 0.282
NP_440350.1_5 Forward -55 -36 -5.31042 0.289
NP_442280.1_10 Reverse -259 -277 10.5192 0.223
NP_440894.1_6 Forward -236 -217 21.3373 0.128
NP_440999.1_9 Reverse -300 -314 19.9608 0.0114
NP_440999.1_9 Reverse -216 -230 -2.06536 0.257
NP_440888.1_2 Forward -313 -299 16.9119 0.00511
NP_440888.1_2 Reverse -304 -318 16.2235 0.00758
NP_440888.1_2 Reverse -263 -277 5.40719 0.28
NP_440491.1_1 Forward -316 -297 17.6373 0.0511
NP_440052.1_5 Reverse -293 -312 7.07928 0.104
NP_442277.1_4 Reverse -295 -314 10.815 0.0889
NP_442033.1_10 Reverse -302 -321 1.37609 0.0882
NP_442033.1_10 Reverse -142 -161 -14.5535 0.299
NP_441543.1_2 Forward -312 -303 18.486 0.00236
NP_441543.1_2 Reverse -305 -314 16.9127 0.00359
NP_441543.1_2 Reverse -270 -279 6.68623 0.142
NP_442845.1_2 Forward -319 -305 3.34284 0.294
NP_441834.1_3 Forward -383 -364 18.584 0.119
NP_441551.1_5 Forward -317 -301 8.41597 0.238
NP_441319.1_5 Reverse -264 -283 8.94757 0.273
NP_441918.1_7 Forward -371 -352 -0.39387 0.297
NP_441469.1_8 Reverse -303 -312 16.126 0.00797
NP_441469.1_8 Forward -279 -270 13.1761 0.082
NP_441469.1_8 Forward -314 -305 6.48957 0.227
NP_443064.1_6 Reverse -304 -314 12.5669 0.0796
NP_442337.1_8 Forward -53 -34 1.67108 0.233
NP_442578.1_7 Forward -312 -305 14.5921 0.026
NP_442578.1_7 Reverse -305 -312 14.5921 0.026
NP_440220.1_4 Reverse -256 -275 5.60352 0.205
NP_442286.1_1 Reverse -304 -323 17.0107 0.0996
NP_441462.1_2 Forward -313 -303 11.5831 0.00406
NP_441462.1_2 Reverse -304 -314 11.5831 0.00406
NP_441462.1_4 Reverse -79 -98 -2.36049 0.192
NP_441621.1_7 Forward -315 -301 6.48943 0.068
NP_441621.1_7 Reverse -302 -316 -3.34366 0.188
NP_443062.1_1 Forward -313 -295 7.47334 0.175
NP_443062.1_6 Reverse -227 -246 5.50599 0.204
NP_441601.1_4 Reverse -216 -235 -2.85214 0.293
NP_442204.1_1 Reverse -300 -311 11.5634 0.0565
NP_442204.1_1 Reverse -206 -217 1.7303 0.266
NP_442204.1_2 Reverse -294 -313 5.70265 0.295
NP_441560.1_8 Reverse -264 -283 11.5127 0.294
NP_441351.1_8 Forward -280 -261 5.01433 0.209
NP_440516.1_2 Reverse -298 -316 6.31233 0.122
NP_440516.1_8 Forward -313 -304 16.9127 0.00442
NP_440516.1_8 Reverse -304 -313 16.9127 0.00442
NP_442080.1_7 Reverse -230 -249 -1.96717 0.287
NP_442428.1_4 Forward -251 -232 2.55606 0.252
NP_442428.1_5 Forward -312 -305 15.8704 0.0124
NP_442428.1_5 Reverse -305 -312 15.8704 0.0124
NP_442428.1_5 Forward -277 -270 4.759 0.223
NP_441443.1_2 Reverse -153 -172 -5.11376 0.29
NP_441443.1_7 Forward -325 -306 -1.27885 0.258
NP_442120.1_10 Reverse -257 -276 -11.8986 0.265
NP_441867.1_2 Forward -269 -250 -10.6203 0.202
NP_441867.1_2 Forward -100 -81 -20.5517 0.292
NP_440603.1_9 Reverse -264 -283 7.27595 0.226
NP_440673.1_2 Reverse -259 -278 10.6822 0.198
NP_440673.1_3 Forward -311 -304 12.4288 0.0426
NP_440673.1_3 Reverse -306 -313 12.4288 0.0426
NP_440865.1_9 Forward -319 -300 1.0811 0.128
NP_441052.1_2 Reverse -304 -314 19.9412 0.00106
NP_441052.1_2 Forward -313 -303 10.5014 0.0285
NP_441052.1_2 Reverse -220 -230 4.89658 0.14
NP_442219.1_8 Forward -323 -304 11.2594 0.187
NP_442219.1_8 Forward -93 -74 10.0998 0.213
NP_442219.1_9 Reverse -305 -314 17.7976 0.00718
NP_442219.1_9 Forward -312 -303 8.35786 0.0681
NP_440436.1_4 Forward -312 -303 18.1905 0.00233
NP_440436.1_4 Reverse -305 -314 17.2072 0.00233
NP_440436.1_4 Reverse -270 -279 5.70251 0.186
NP_441884.1_9 Reverse -301 -320 -4.52377 0.0594
NP_440314.1_9 Reverse -305 -324 9.43923 0.0328
NP_442907.1_2 Reverse -305 -323 11.7205 0.181
NP_441719.1_4 Forward -312 -305 16.3621 0.0124
NP_441719.1_4 Reverse -305 -312 16.3621 0.0124
NP_441733.1_10 Forward -316 -303 10.639 0.106
NP_441004.1_1 Forward -278 -259 -7.67036 0.199
NP_441004.1_1 Forward -46 -27 -10.7186 0.225
NP_441004.1_1 Forward -266 -247 -14.5535 0.268
NP_441004.1_1 Forward -108 -89 -16.4218 0.284
NP_441004.1_1 Forward -109 -90 -17.2085 0.29
NP_441004.1_2 Forward -271 -252 -0.0988766 0.251
NP_442813.1_4 Reverse -128 -147 -6.09707 0.299
NP_442366.1_3 Forward -314 -296 9.36059 0.0571
NP_440129.1_10 Reverse -297 -311 4.32615 0.185
NP_441115.1_4 Forward -314 -296 8.6715 0.24
NP_441115.1_4 Forward -296 -278 7.78652 0.272
NP_440328.1_4 Reverse -298 -317 17.6007 0.0248
NP_443054.1_2 Reverse -302 -316 1.08123 0.251
NP_441851.1_10 Reverse -303 -313 16.008 0.00552
NP_441851.1_10 Forward -314 -304 15.8113 0.00552
NP_441851.1_10 Forward -279 -269 4.89658 0.24
NP_442208.1_5 Forward -315 -296 9.24257 0.147
NP_442622.1_1 Reverse -303 -322 -11.5053 0.257
NP_442622.1_8 Reverse -145 -163 -18.9587 0.293
NP_442011.1_1 Forward -314 -295 -1.67217 0.268
NP_442856.1_7 Reverse -295 -314 8.94757 0.101
NP_441668.1_4 Forward -343 -324 0.982764 0.227
NP_442515.1_1 Reverse -303 -317 10.3243 0.0533
NP_442515.1_1 Forward -314 -300 -4.52363 0.298
NP_440593.1_3 Forward -277 -258 -7.17871 0.288
NP_440593.1_3 Reverse -172 -191 -7.67036 0.298
NP_440165.1_5 Reverse -303 -322 0.392778 0.149
NP_441046.1_2 Forward -283 -264 2.3594 0.24
NP_442689.1_8 Reverse -336 -353 -3.69774 0.251
NP_441349.1_10 Forward -323 -304 2.55606 0.0747
NP_441349.1_10 Reverse -294 -313 0.58944 0.0878
NP_441349.1_10 Forward -229 -210 -5.21209 0.194
NP_440432.1_2 Reverse -298 -317 -4.03212 0.268
NP_440432.1_9 Reverse -305 -320 1.35653 0.147
NP_440432.1_9 Forward -76 -61 -4.64166 0.216
NP_442843.1_1 Forward -277 -258 7.37428 0.135
NP_442843.1_1 Forward -393 -374 -8.65367 0.258
NP_442843.1_1 Forward -328 -309 -11.8986 0.295
NP_439960.1_10 Reverse -297 -315 4.54237 0.161
NP_439960.1_10 Forward -236 -218 -3.32411 0.27
NP_440474.1_8 Reverse -305 -319 5.50552 0.25
NP_441477.1_10 Reverse -143 -161 1.59244 0.256
NP_441477.1_10 Forward -320 -302 -0.374176 0.291
NP_442168.1_5 Forward -277 -258 10.0292 0.151
NP_440588.1_2 Reverse -295 -314 16.9124 0.0108
NP_440588.1_2 Forward -86 -67 1.86774 0.127
NP_442006.1_2 Forward -322 -305 -6.746 0.168
NP_442006.1_2 Reverse -59 -76 -16.1858 0.243
NP_442006.1_2 Forward -40 -23 -17.8574 0.283
NP_441003.1_9 Reverse -295 -314 3.04771 0.3
NP_440483.1_1 Reverse -184 -203 -7.57203 0.266
NP_440483.1_9 Reverse -65 -84 5.80098 0.161
NP_441570.1_1 Reverse -304 -322 -1.45582 0.0568
NP_441570.1_1 Forward -278 -260 -7.45401 0.0895
NP_441078.1_4 Forward -313 -304 19.6659 0.0007
NP_441078.1_4 Reverse -304 -313 19.6659 0.0007
NP_441078.1_4 Forward -219 -210 -1.27858 0.246
NP_441078.1_4 Forward -278 -269 -1.77023 0.266
NP_442729.1_5 Forward -323 -313 8.1415 0.248
NP_440539.1_9 Reverse -186 -205 -7.27704 0.298
NP_441528.1_2 Reverse -260 -279 8.4551 0.277
NP_441663.1_8 Reverse -298 -317 8.06259 0.0936
NP_441663.1_8 Reverse -32 -51 -2.45882 0.268
NP_441663.1_8 Forward -160 -141 -3.44213 0.289
NP_440526.1_3 Reverse -305 -316 10.6779 0.0646
NP_440526.1_3 Reverse -381 -392 5.66304 0.237
NP_441432.1_8 Forward -314 -305 16.8143 0.00595
NP_441432.1_8 Reverse -303 -312 8.25953 0.0755
NP_441432.1_9 Reverse -328 -341 15.8701 0.125
NP_443024.1_3 Reverse -342 -352 11.6814 0.289
NP_442320.1_8 Forward -319 -305 4.42448 0.0504
NP_442320.1_8 Reverse -298 -312 -2.95034 0.1
NP_441732.1_2 Reverse -300 -316 12.9399 0.00384
NP_441732.1_2 Reverse -206 -222 -15.6744 0.155
NP_440503.1_1 Reverse -28 -47 19.6656 0.291
NP_440313.1_6 Forward -97 -78 20.2556 0.0809
NP_442157.1_6 Forward -321 -303 17.4237 0.12
NP_442157.1_9 Reverse -32 -51 17.404 0.209
NP_440760.1_1 Forward -278 -259 -15.4385 0.147
NP_440760.1_1 Forward -153 -134 -20.7484 0.225
NP_440760.1_1 Forward -313 -294 -22.8133 0.271
NP_442353.1_4 Reverse -298 -317 -0.197979 0.287
NP_442489.1_7 Forward -313 -304 20.1576 0.000695
NP_442489.1_7 Reverse -304 -313 20.1576 0.000695
NP_442489.1_7 Forward -278 -269 -1.27858 0.185
NP_440559.1_1 Reverse -305 -314 17.4043 0.00658
NP_440559.1_1 Forward -312 -303 8.75118 0.0586
NP_441659.2_8 Reverse -304 -314 18.1713 0.00133
NP_441659.2_8 Forward -313 -303 11.9764 0.0147
NP_442913.1_10 Forward -322 -303 8.55425 0.0469
NP_442913.1_10 Forward -259 -240 -2.16383 0.182
NP_441040.1_2 Reverse -296 -315 -6.29373 0.181
NP_441040.1_2 Forward -216 -197 -11.9969 0.255
NP_442849.1_6 Reverse -320 -334 14.6509 0.236
NP_442008.1_2 Forward -316 -297 12.0942 0.104
NP_441800.1_7 Reverse -215 -233 1.49411 0.204
NP_441800.1_7 Reverse -371 -389 -4.60241 0.3
NP_440779.1_5 Reverse -304 -321 -14.5141 0.246
NP_441185.1_9 Reverse -210 -228 16.1454 0.292
NP_442346.1_5 Forward -314 -304 16.6963 0.00248
NP_442346.1_5 Forward -220 -210 9.51814 0.118
NP_442346.1_5 Reverse -303 -313 9.02648 0.118
NP_440352.1_5 Forward -311 -292 9.83295 0.289
NP_440545.1_3 Forward -317 -300 21.5733 0.00658
NP_440545.1_3 Reverse -265 -282 1.41547 0.119
NP_441856.1_3 Forward -222 -203 -3.14714 0.278
NP_441856.1_7 Forward -322 -303 8.45592 0.292
NP_440025.1_1 Reverse -300 -319 7.96426 0.238
NP_440831.1_3 Forward -322 -303 9.1053 0.211
NP_440831.1_3 Reverse -168 -187 8.32868 0.229
NP_441629.1_3 Reverse -18 -37 -3.24622 0.277
NP_440486.1_6 Forward -314 -295 5.40766 0.297
NP_440250.1_4 Forward -70 -51 3.14526 0.276
NP_440459.1_2 Forward -315 -298 11.8386 0.166
NP_441653.1_2 Reverse -293 -312 7.00843 0.223
NP_440010.1_4 Forward -317 -298 -0.787962 0.262
NP_440010.1_10 Forward -325 -306 12.6841 0.19
NP_441943.1_8 Reverse -29 -48 -5.21209 0.256
NP_442311.1_5 Reverse -77 -96 1.57275 0.261
NP_442603.1_7 Forward -313 -299 10.6187 0.125
NP_442603.1_7 Reverse -304 -318 9.14375 0.155
NP_441233.1_2 Forward -237 -218 12.0942 0.262
NP_441888.1_7 Reverse -299 -313 13.5693 0.0743
NP_441948.1_4 Reverse -297 -315 -4.01242 0.214
NP_441948.1_4 Forward -162 -144 -5.58572 0.271
NP_441833.1_4 Forward -312 -305 15.9687 0.0124
NP_441833.1_4 Reverse -305 -312 15.9687 0.0124
NP_441329.1_6 Forward -344 -325 1.00224 0.245
NP_441112.1_6 Reverse -114 -133 -3.83545 0.296
NP_441112.1_8 Forward -351 -332 2.75272 0.232
NP_442699.1_8 Forward -309 -290 -4.32711 0.238
NP_442162.1_9 Forward -312 -305 16.2637 0.0124
NP_442162.1_9 Reverse -305 -312 16.2637 0.0124
NP_440671.1_2 Forward -310 -296 15.5359 0.174
NP_440671.1_4 Reverse -298 -312 12.0943 0.117
NP_442045.1_5 Reverse -295 -314 0.196116 0.266
NP_442073.1_6 Reverse -295 -314 -3.14714 0.291
NP_442199.1_5 Forward -286 -267 -5.21209 0.24
NP_442140.1_3 Forward -312 -302 14.238 0.0486
NP_442140.1_3 Reverse -305 -315 13.5497 0.0542
NP_442723.1_1 Reverse -160 -179 2.45694 0.289
NP_440875.1_9 Forward -311 -301 17.327 0.0126
NP_441813.1_5 Reverse -302 -312 19.4496 0.00647
NP_441813.1_5 Forward -315 -305 8.73149 0.0367
NP_441813.1_7 Reverse -220 -234 12.8803 0.212
NP_441813.1_7 Reverse -217 -231 12.6836 0.212
NP_440590.1_4 Forward -312 -299 13.4906 0.013
NP_440590.1_4 Reverse -305 -318 4.44418 0.0601
NP_440567.1_1 Reverse -305 -319 9.34103 0.0455
NP_440567.1_1 Forward -312 -298 7.07942 0.0779
NP_442497.1_10 Forward -312 -303 10.4228 0.0087
NP_442497.1_10 Reverse -305 -314 10.4228 0.0087
NP_440821.1_4 Forward -315 -305 17.9746 0.00497
NP_440821.1_4 Reverse -302 -312 10.2065 0.0163
NP_440821.1_4 Forward -280 -270 -0.118297 0.229
NP_441239.1_9 Reverse -302 -314 14.1986 0.0288
NP_441239.1_9 Forward -315 -303 9.67541 0.0987
NP_441951.1_4 Reverse -251 -270 3.73603 0.273
NP_441009.1_4 Forward -284 -265 11.0125 0.26
NP_440665.1_1 Forward -241 -222 -13.5702 0.257
NP_440665.1_2 Reverse -30 -49 -6.1954 0.265
NP_442399.1_4 Reverse -375 -389 21.1035 0.0432
NP_442044.1_1 Reverse -299 -318 -14.0619 0.283
NP_442193.1_8 Forward -281 -262 9.34008 0.295
NP_441017.1_6 Reverse -173 -187 17.0102 0.0651
NP_441541.1_1 Forward -355 -337 -4.39064 0.276
NP_440354.1_5 Forward -316 -297 8.35759 0.174
NP_442138.1_1 Reverse -305 -324 2.6536 0.24
NP_442138.1_1 Reverse -284 -303 1.37531 0.26
NP_442138.1_10 Reverse -304 -323 -7.96535 0.296
NP_442052.1_7 Forward -264 -250 14.8476 0.199
NP_442809.1_6 Forward -272 -253 1.76941 0.27
NP_440546.1_4 Forward -313 -303 11.8882 0.0679
NP_440546.1_4 Reverse -304 -314 10.046 0.109
NP_442041.1_5 Reverse -20 -39 13.1758 0.162
NP_440462.1_6 Reverse -302 -312 17.2863 0.00752
NP_440462.1_6 Forward -315 -305 10.3048 0.0396
NP_442465.1_9 Reverse -371 -385 9.43936 0.298
NP_440868.1_4 Forward -317 -305 16.7552 0.0136
NP_440868.1_4 Reverse -300 -312 10.5604 0.0364
NP_440868.1_4 Forward -282 -270 -0.846001 0.282
NP_440401.1_9 Reverse -202 -209 12.6251 0.287
NP_441249.1_8 Forward -103 -84 4.12936 0.259
NP_442479.1_9 Reverse -333 -352 -6.1954 0.266
NP_441582.1_5 Reverse -158 -177 2.55527 0.293
NP_441474.1_1 Reverse -218 -237 3.53858 0.233
NP_442402.1_4 Reverse -328 -347 -1.8696 0.194
NP_442402.1_4 Reverse -317 -336 -2.45958 0.199
NP_442402.1_4 Reverse -318 -337 -9.14605 0.285
NP_442402.1_4 Reverse -257 -276 -10.326 0.299
NP_442402.1_9 Reverse -133 -152 12.9791 0.198
NP_442402.1_10 Forward -204 -194 10.4026 0.29
NP_442039.1_4 Forward -312 -305 15.1821 0.0124
NP_442039.1_4 Reverse -305 -312 15.1821 0.0124
NP_442039.1_7 Forward -338 -328 7.84651 0.271
NP_442039.1_7 Forward -276 -266 7.45319 0.276
NP_442829.1_2 Forward -341 -325 12.5862 0.287
NP_441926.1_3 Reverse -153 -169 7.82668 0.17
NP_442696.1_6 Reverse -372 -391 -12.7836 0.253
NP_442837.1_3 Forward -312 -305 15.7721 0.0124
NP_442837.1_3 Reverse -305 -312 15.7721 0.0124
NP_440160.1_2 Forward -334 -315 -2.95047 0.249
NP_440160.1_9 Forward -47 -28 7.96426 0.27
NP_440160.1_9 Reverse -184 -203 7.86593 0.27
NP_442053.1_1 Forward -313 -304 18.3876 0.0007
NP_442053.1_1 Reverse -304 -313 18.3876 0.0007
NP_440505.1_3 Forward -315 -305 16.598 0.00683
NP_440505.1_3 Reverse -302 -312 15.9097 0.00857
NP_440505.1_7 Forward -320 -301 -2.45882 0.289
NP_440520.1_1 Forward -49 -30 -3.04881 0.208
NP_441203.1_1 Forward -312 -293 -19.7651 0.297
NP_440308.1_6 Reverse -36 -55 0.982764 0.296
NP_442532.1_7 Reverse -304 -318 4.03116 0.178
NP_441408.2_7 Forward -315 -296 -5.50708 0.295
NP_440914.1_1 Reverse -304 -314 17.5935 0.000537
NP_440914.1_1 Forward -313 -303 8.6151 0.186
NP_441011.1_8 Forward -312 -303 16.9127 0.00602
NP_441011.1_8 Reverse -305 -314 8.25953 0.144
NP_442533.1_1 Forward -108 -89 -9.24366 0.221
NP_442533.1_1 Forward -319 -300 -16.6185 0.273
NP_442533.1_6 Forward -313 -304 17.2076 0.00137
NP_442533.1_6 Reverse -304 -313 17.2076 0.00137
NP_442533.1_6 Forward -278 -269 4.22796 0.186
NP_442533.1_6 Reverse -144 -153 1.67135 0.293
NP_442229.1_1 Forward -315 -301 8.06211 0.185
NP_441482.1_7 Reverse -298 -312 -0.590395 0.0612
NP_441482.1_7 Forward -266 -252 -11.1118 0.237
NP_439944.1_9 Reverse -305 -315 19.1546 0.00329
NP_441028.1_6 Reverse -295 -305 6.37109 0.23
NP_441028.1_6 Forward -203 -193 5.78111 0.243
NP_441028.1_6 Reverse -165 -175 4.40448 0.278
NP_441028.1_6 Reverse -97 -107 3.51951 0.292
NP_442202.1_1 Forward -200 -184 15.2383 0.237
NP_440116.1_8 Reverse -305 -324 -0.0988766 0.104
NP_440115.1_6 Forward -316 -306 17.9746 0.0163
NP_440115.1_6 Reverse -301 -311 7.64985 0.146
NP_440115.1_6 Forward -156 -146 4.79825 0.282
NP_440007.1_9 Reverse -300 -314 1.96621 0.281
NP_441680.1_4 Reverse -33 -52 0.58944 0.246
NP_441059.1_2 Forward -272 -253 -4.32711 0.242
NP_441059.1_2 Forward -333 -314 -5.60541 0.257
NP_440608.1_6 Reverse -305 -324 4.32522 0.27
NP_441602.1_3 Forward -318 -299 -0.39387 0.224
NP_441602.1_3 Forward -53 -34 -3.24547 0.243
NP_442673.1_5 Reverse -338 -356 11.7205 0.272
NP_441972.1_5 Forward -277 -258 2.55606 0.121
NP_441106.1_1 Reverse -303 -312 18.191 0.0028
NP_441106.1_1 Forward -314 -305 9.63616 0.0311
NP_441106.1_1 Forward -279 -270 5.60459 0.141
NP_440429.1_2 Reverse -258 -277 9.3409 0.272
NP_440429.1_9 Forward -170 -151 -0.0988766 0.297
NP_442249.1_10 Reverse -19 -38 12.1925 0.257
NP_441286.1_1 Reverse -303 -315 12.1337 0.0104
NP_441286.1_1 Forward -314 -302 6.03717 0.0258
NP_441286.1_1 Reverse -268 -280 -6.15587 0.251
NP_440670.1_8 Forward -313 -304 18.3876 0.000699
NP_440670.1_8 Reverse -304 -313 18.3876 0.000699
NP_440886.1_7 Reverse -303 -313 17.7774 0.0011
NP_440886.1_7 Reverse -219 -229 15.9091 0.0203
NP_440886.1_7 Forward -314 -304 7.94438 0.0805
NP_440828.1_4 Reverse -303 -322 -6.78612 0.279
NP_442614.1_2 Reverse -241 -255 7.76774 0.265
NP_442382.1_9 Reverse -259 -278 9.83173 0.281
NP_442072.1_9 Forward -314 -296 -13.5505 0.115
NP_442072.1_9 Forward -220 -202 -22.1053 0.22
NP_442401.1_2 Reverse -303 -322 12.585 0.159
NP_441753.1_10 Forward -322 -303 7.37428 0.186
NP_440907.2_8 Reverse -305 -315 10.8943 0.0969
NP_440907.2_8 Forward -312 -302 7.94438 0.117
NP_441021.1_1 Reverse -252 -271 -6.78538 0.18
NP_441021.1_1 Forward -312 -293 -12.7836 0.295
NP_441021.1_8 Reverse -299 -317 1.39578 0.273
NP_441463.1_3 Forward -323 -304 0.0977854 0.132
NP_442842.1_4 Reverse -252 -271 1.96607 0.274
NP_441626.1_2 Forward -312 -305 15.7721 0.0124
NP_441626.1_2 Reverse -305 -312 15.7721 0.0124
NP_442211.1_9 Reverse -80 -99 2.75272 0.247
NP_442221.1_4 Forward -236 -217 6.19431 0.296
NP_442365.1_5 Reverse -305 -324 10.5209 0.183
NP_442365.1_7 Reverse -300 -319 8.84924 0.0809
NP_440107.1_5 Reverse -303 -322 -4.91709 0.197
NP_442794.1_1 Reverse -300 -312 10.4621 0.0721
NP_442615.1_1 Reverse -295 -313 5.91901 0.0371
NP_442615.1_1 Forward -322 -304 -2.3408 0.143
NP_441962.1_4 Forward -318 -299 -8.94866 0.21
NP_441962.1_9 Reverse -20 -39 9.43923 0.258
NP_440387.1_1 Reverse -304 -320 15.4965 0.00544
NP_440387.1_1 Forward -313 -297 -1.02311 0.142
NP_440855.1_1 Forward -290 -271 6.09597 0.147
NP_441431.1_2 Reverse -301 -315 16.3219 0.0381
NP_441488.1_7 Forward -319 -300 2.85105 0.242
NP_441836.1_2 Forward -319 -300 -2.16383 0.226
NP_441836.1_2 Forward -284 -265 -2.95047 0.232
NP_441993.1_1 Forward -319 -300 5.26024 0.205
NP_441993.1_1 Forward -243 -224 0.679741 0.294
NP_440358.1_8 Forward -64 -45 5.40766 0.189
NP_440114.1_10 Reverse -304 -318 7.57108 0.231
NP_441817.1_3 Forward -324 -305 11.2092 0.226
NP_440293.1_3 Forward -280 -261 -5.9004 0.285
NP_440766.1_4 Forward -317 -303 7.66941 0.0884
NP_440766.1_4 Forward -184 -170 4.52282 0.126
NP_441237.1_9 Reverse -305 -315 14.9263 0.0242
NP_441979.1_5 Reverse -298 -317 -12.3902 0.228
NP_442743.1_1 Reverse -90 -109 7.4718 0.264
NP_442743.1_4 Forward -312 -293 0.491109 0.174
NP_440457.1_1 Reverse -300 -312 7.61046 0.101
NP_440457.1_1 Forward -282 -270 6.62715 0.116
NP_440457.1_1 Forward -317 -305 0.23564 0.25
NP_440798.1_6 Forward -312 -299 3.95252 0.147
NP_440798.1_6 Reverse -305 -318 3.26421 0.151
NP_440801.1_8 Reverse -303 -322 11.6025 0.134
NP_440142.1_9 Reverse -258 -272 11.7987 0.298
NP_442297.1_4 Reverse -300 -319 15.4476 0.164
NP_441332.1_4 Reverse -39 -58 7.47261 0.236
NP_441436.1_6 Forward -316 -297 10.6192 0.253
NP_441436.1_8 Forward -314 -295 7.7676 0.293
NP_441436.1_9 Reverse -87 -97 18.4657 0.168
NP_440473.1_1 Reverse -207 -226 10.9682 0.285
NP_440473.1_9 Forward -324 -305 14.2574 0.02
NP_442509.1_9 Forward -313 -303 16.2041 0.00739
NP_442509.1_9 Reverse -198 -208 11.5826 0.124
NP_442509.1_9 Forward -154 -144 10.501 0.173
NP_442509.1_9 Reverse -304 -314 8.14104 0.192
NP_442509.1_9 Reverse -210 -220 7.45273 0.219
NP_442784.1_3 Forward -277 -258 17.2074 0.264
NP_441253.1_8 Reverse -230 -244 11.2476 0.269
NP_442514.1_5 Reverse -290 -309 1.37531 0.178
NP_440554.1_4 Forward -312 -302 16.4996 0.0189
NP_440554.1_4 Reverse -305 -315 6.37155 0.123
NP_440554.1_4 Reverse -270 -280 2.14332 0.276
NP_442862.1_3 Forward -58 -41 11.7402 0.202
NP_442862.1_3 Reverse -335 -352 9.47861 0.219
NP_441885.1_5 Reverse -304 -314 20.9245 0.000538
NP_441885.1_5 Forward -313 -303 11.4848 0.00668
NP_440478.1_9 Forward -149 -130 9.24257 0.258
NP_440478.1_10 Reverse -302 -316 8.45605 0.257
NP_442341.1_7 Forward -314 -300 10.9143 0.0591
NP_442341.1_7 Reverse -303 -317 10.226 0.0678
NP_442341.1_7 Forward -146 -132 4.22782 0.198
NP_442341.1_9 Reverse -302 -316 7.96378 0.182
NP_441756.1_5 Reverse -300 -319 1.17943 0.217
NP_441173.1_9 Forward -202 -194 12.0154 0.214
NP_441173.1_9 Reverse -328 -336 10.9338 0.242
NP_442395.2_4 Forward -314 -295 6.09517 0.151
NP_442395.2_4 Forward -334 -315 1.57197 0.237
NP_440191.1_4 Forward -399 -389 14.4085 0.266
NP_440750.1_8 Reverse -73 -91 14.9646 0.237
NP_440423.1_6 Forward -321 -302 -12.6852 0.198
NP_443000.1_7 Reverse -302 -312 11.5831 0.0344
NP_443000.1_7 Forward -315 -305 10.4031 0.0345
NP_443000.1_7 Forward -297 -287 1.25834 0.26
NP_440507.2_3 Forward -322 -303 21.4347 0.0116
NP_442513.1_5 Forward -321 -302 15.7316 0.264
NP_441842.1_10 Forward -320 -306 13.6676 0.0716
NP_441842.1_10 Reverse -129 -143 9.04604 0.2
NP_440275.1_3 Forward -315 -305 17.6796 0.0102
NP_440275.1_3 Reverse -302 -312 15.418 0.0178
NP_440091.1_1 Forward -317 -305 15.8703 0.0161
NP_441902.1_3 Reverse -193 -203 16.2857 0.159
NP_440679.1_5 Forward -247 -228 5.01433 0.298
NP_442451.1_2 Reverse -296 -315 -0.688862 0.16
NP_441207.1_7 Reverse -49 -63 12.8375 0.237
NP_439962.1_4 Reverse -296 -315 -2.0655 0.224
NP_439962.1_4 Forward -277 -258 -7.17871 0.288
NP_439962.1_4 Reverse -216 -235 -8.06369 0.292
NP_440175.1_4 Forward -321 -302 -13.4719 0.247
NP_440880.1_5 Forward -272 -254 12.8022 0.236
NP_440149.1_8 Forward -278 -259 -0.4922 0.15
NP_440149.1_8 Forward -313 -294 -8.16202 0.3
NP_441105.1_3 Reverse -293 -312 3.83436 0.086
NP_440216.1_1 Forward -313 -299 17.4042 0.00188
NP_440216.1_1 Reverse -304 -318 -1.5737 0.034
NP_440216.1_1 Reverse -210 -224 -11.2101 0.169
NP_440216.1_1 Forward -219 -205 -12.2918 0.256
NP_440216.1_9 Reverse -45 -54 9.93116 0.286
NP_440701.1_5 Forward -289 -270 7.17762 0.266
NP_440172.1_1 Reverse -304 -314 15.0247 0.00945
NP_440172.1_1 Forward -313 -303 8.73149 0.0586
NP_442290.1_9 Reverse -231 -250 13.2741 0.287
NP_440167.1_3 Forward -323 -304 20.4523 0.0451
NP_440167.1_3 Forward -282 -263 9.14423 0.26
NP_440167.1_6 Reverse -258 -272 17.4042 0.25
NP_442015.1_10 Reverse -300 -313 21.4554 0.00329
NP_442015.1_10 Forward -317 -304 2.87088 0.187
NP_441226.1_7 Forward -312 -305 14.4934 0.0123
NP_441226.1_7 Reverse -305 -312 14.4934 0.0123
NP_441226.1_7 Reverse -130 -137 6.82361 0.246
NP_441111.1_7 Forward -312 -304 18.7023 0.00294
NP_441111.1_7 Reverse -305 -313 18.7023 0.00294
NP_441111.1_7 Reverse -270 -278 -0.668896 0.274
NP_442379.1_10 Forward -320 -303 -2.91109 0.245
NP_441766.1_2 Forward -313 -304 17.5026 0.00297
NP_441766.1_2 Reverse -304 -313 17.5026 0.00297
NP_442417.1_5 Forward -313 -299 16.8142 0.0349
NP_440416.1_9 Reverse -297 -316 4.03102 0.0355
NP_440416.1_9 Reverse -129 -148 -9.34199 0.13
NP_440416.1_9 Reverse -203 -222 -15.1435 0.186
NP_440416.1_9 Forward -320 -301 -16.1268 0.208
NP_440416.1_9 Reverse -262 -281 -17.9951 0.25
NP_443052.1_8 Forward -323 -304 17.699 0.00511
NP_443052.1_9 Reverse -259 -278 -7.17871 0.294
NP_442552.1_1 Reverse -254 -273 13.2741 0.191
NP_440591.1_9 Forward -320 -302 11.9172 0.0935
NP_440591.1_9 Forward -261 -243 9.45892 0.151
NP_442154.1_1 Forward -321 -303 -7.15901 0.141
NP_440261.1_5 Forward -312 -299 6.80412 0.0316
NP_440261.1_5 Reverse -305 -318 -2.73398 0.0924
NP_440261.1_7 Forward -308 -289 -3.44213 0.19
NP_440988.1_2 Reverse -219 -237 6.60732 0.299
NP_440988.1_2 Reverse -145 -163 6.41066 0.299
NP_440988.1_10 Forward -315 -301 5.77014 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTTCAACAGTTGGGAGGGTTTGCTGATTTGCCCATTATGGAAGATTACCAATTTATGCAAAAACTGGGAAAACAACGGGGCAAGGTGGCGATCGCCGGGGGCAAAGTGATTACATCTGGACGGCGGTGGCAAAAGCTGGGGCTACTGCGGACTACGGCCATTAACCAGCTGGTGGTGGCGGGCTATCATCTGGGGGTTTCTCCCCAAACCTTGGTCCATTGGTATCGGGGGGCAAAACCGAATCGGGGGAACCGGCCAAACTCCGACGGGACTTCTTGTTAGAGTAAGTTAGTTAGGGGTAAGGCTGGGGCAGTTTGATCAACTCCATAGCCGGTTTGGATAAACTTTTCCTGGCTTTGCTCCAGGGCGGCAGTTTCAGGTCACAGGAGGGACACTTGT

CDS

ATGGCATCAACAGATTTCAAAGACTATTACCAAATTTTGGGAGTGACCAAAACCGCTTCAGAAGCTGAAATCAAAAAGCAGTTTCGTAAATTAGCACTGAAATATCATCCTGACAAAAATCCTGGGGATAAGGCGGCGGAGGAAAAATTTAAGGAAATTAGCGAAGCCTATGAGGTGCTTTCTGACCCCGAAAAACGCCAGAAATATGACCAATTTGGCCGCTATTGGCAACAGGCTGGCACGGCAGGACAACCCAGTGGCAGCTACGGCCCTGGAGTCGGCGTGGATTTTGGTGGCTTTGACTTTAGCCAGTACGGCAATTTTGACGAATTTATTAATGAACTGTTGGGACGCTTCAATACCCCCGGTGGCGGCGGTCAGAGAACTTCCTACAGCTATTCCACCGGCGGCCCTGGCTTTAATGACTTTGGTGGTTTTGGCAATGCCCAGGCCCCCGCAGGCGATCGGGAAGCAACCCTACAGTTAACTTTGGCGGAAGCTTTTCGGGGAGTGGAAAAACGTCTCAACTTAGGGGAAGAAATGGTCACTGTGCGGATTCCCGCCGGAGCGAAAAATGGCAGTCGAGTACGGGTGAGGGGCAAAGGTATGGCCAGTCCTTACGGTCAAAGGGGGGATTTGTATCTCAACTTGCAACTGACCCCCCATCCATTTTTCCAATTTGAAGGGGATAACCTGGTCTGTGAATTGGCGATCGCCCCGGACGAAGCGGTGTTGGGGGCCGATATTAGTGTACCGACCCCCGATGGCATGGTGCGAATGAAAGTCCCGGCAGGAGTCAAATCCGGCCAATCCCTGCGGTTAAAAGGGAAAGGTTGGCCGAACCCTAAACAGGGCCGTGGTGACCAGTTAGTACGCCTAATCATCACTGCTCCGAAAAATCCCAGCGCCATTGAACGGGAATGCTATGAAAAAATTCAGGCGCAACGGACAGAAAATCCCCGCCAAGCGGTGGAAAAATACGCCAATTTGTTGGCATAG

Protein

MASTDFKDYYQILGVTKTASEAEIKKQFRKLALKYHPDKNPGDKAAEEKFKEISEAYEVLSDPEKRQKYDQFGRYWQQAGTAGQPSGSYGPGVGVDFGGFDFSQYGNFDEFINELLGRFNTPGGGGQRTSYSYSTGGPGFNDFGGFGNAQAPAGDREATLQLTLAEAFRGVEKRLNLGEEMVTVRIPAGAKNGSRVRVRGKGMASPYGQRGDLYLNLQLTPHPFFQFEGDNLVCELAIAPDEAVLGADISVPTPDGMVRMKVPAGVKSGQSLRLKGKGWPNPKQGRGDQLVRLIITAPKNPSAIERECYEKIQAQRTENPRQAVEKYANLLA