Your browser is old and dusty. Try Google Chrome!

Details for slr0088

ORF slr0088
Accession NP_442491.1
Symbol crtO
Category Carotenoid
Definition beta-carotene ketolase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -55 -41 21.6324 0.00612
NP_441061.1_2 Reverse -278 -292 10.226 0.0636
NP_440557.1_1 Reverse -48 -67 -0.885524 0.27
NP_440795.1_7 Forward -285 -278 14.6904 0.0123
NP_440795.1_7 Reverse -278 -285 14.6904 0.0123
NP_440795.1_7 Forward -55 -48 14.6904 0.0123
NP_440795.1_7 Reverse -48 -55 14.6904 0.0123
NP_441418.1_6 Forward -298 -279 -19.3717 0.0876
NP_441418.1_6 Forward -56 -37 -20.2567 0.108
NP_441418.1_6 Reverse -277 -296 -21.7317 0.159
NP_441418.1_6 Reverse -238 -257 -30.6798 0.291
NP_440815.1_5 Forward -56 -37 8.55425 0.237
NP_441453.1_1 Reverse -270 -288 7.29487 0.216
NP_441453.1_1 Forward -63 -45 5.22993 0.251
NP_441453.1_4 Reverse -47 -55 16.539 0.00633
NP_441453.1_4 Forward -286 -278 16.539 0.00633
NP_441453.1_4 Forward -56 -48 16.539 0.00633
NP_441453.1_4 Reverse -277 -285 7.8859 0.0536
NP_441453.1_7 Reverse -70 -77 14.1988 0.175
NP_441453.1_7 Forward -303 -296 12.9205 0.23
NP_442151.1_6 Reverse -277 -291 21.8291 0.0045
NP_442151.1_6 Forward -286 -272 13.4709 0.0512
NP_442151.1_6 Forward -56 -42 11.8976 0.0886
NP_442151.1_6 Reverse -47 -61 6.29277 0.24
NP_441818.1_1 Reverse -278 -289 15.6928 0.0257
NP_440226.1_1 Reverse -47 -66 7.27595 0.109
NP_440120.1_4 Reverse -298 -312 13.9626 0.29
NP_442623.1_3 Forward -55 -36 -18.2901 0.263
NP_442623.1_3 Forward -285 -266 -19.2734 0.284
NP_440348.1_6 Forward -278 -259 3.24438 0.278
NP_440150.1_6 Reverse -44 -63 3.93269 0.245
NP_441721.1_9 Reverse -279 -298 16.0274 0.254
NP_442173.1_1 Forward -55 -47 15.4574 0.00633
NP_442173.1_1 Reverse -278 -286 15.4574 0.00633
NP_442173.1_1 Reverse -48 -56 15.4574 0.00633
NP_442173.1_1 Forward -285 -277 14.1791 0.0165
NP_442752.1_4 Forward -286 -279 13.8055 0.0199
NP_442752.1_4 Forward -56 -49 13.8055 0.0199
NP_442752.1_4 Reverse -47 -54 13.8055 0.0199
NP_442752.1_4 Reverse -114 -121 10.8555 0.0846
NP_442752.1_4 Reverse -90 -97 5.34899 0.221
NP_443027.1_4 Reverse -275 -285 16.303 0.0437
NP_443027.1_4 Forward -58 -48 13.2547 0.0521
NP_443027.1_4 Forward -288 -278 13.1564 0.0521
NP_443027.1_4 Reverse -45 -55 13.1564 0.0521
NP_439997.1_4 Forward -201 -182 9.3409 0.204
NP_441812.1_3 Forward -287 -273 12.7826 0.195
NP_441812.1_3 Reverse -113 -127 9.93102 0.228
NP_441812.1_3 Reverse -46 -60 9.83269 0.228
NP_442975.1_10 Forward -290 -276 8.75042 0.0875
NP_442975.1_10 Reverse -43 -57 3.93223 0.249
NP_442975.1_10 Reverse -273 -287 2.35894 0.276
NP_440784.1_7 Forward -285 -278 15.9687 0.0123
NP_440784.1_7 Reverse -278 -285 15.9687 0.0123
NP_440784.1_7 Forward -55 -48 15.9687 0.0123
NP_440784.1_7 Reverse -48 -55 15.9687 0.0123
NP_442909.1_7 Forward -55 -41 8.84875 0.161
NP_441250.1_3 Forward -271 -252 5.50599 0.24
NP_440061.1_9 Forward -58 -44 19.1735 0.00631
NP_440061.1_9 Reverse -275 -289 10.2254 0.126
NP_440110.1_4 Forward -297 -278 14.2574 0.0777
NP_440110.1_8 Forward -288 -269 -2.55715 0.274
NP_441054.1_4 Forward -269 -251 -3.12744 0.26
NP_442062.1_8 Forward -56 -46 17.3846 0.00193
NP_442062.1_8 Reverse -47 -57 10.3048 0.0493
NP_442062.1_8 Forward -286 -276 9.61647 0.0587
NP_442062.1_8 Reverse -277 -287 7.84651 0.0871
NP_442062.1_8 Reverse -114 -124 7.05986 0.11
NP_440761.1_4 Forward -61 -42 -14.0619 0.257
NP_441859.1_3 Forward -57 -38 10.815 0.116
NP_441802.1_1 Reverse -299 -318 4.03102 0.298
NP_440304.1_4 Forward -58 -48 10.8948 0.051
NP_440304.1_4 Forward -288 -278 9.91146 0.051
NP_440304.1_4 Reverse -45 -55 9.91146 0.051
NP_440304.1_4 Reverse -275 -285 9.12481 0.0626
NP_442242.1_4 Forward -285 -278 14.3954 0.0124
NP_442242.1_4 Reverse -278 -285 14.3954 0.0124
NP_442242.1_4 Forward -55 -48 14.3954 0.0124
NP_442242.1_4 Reverse -48 -55 14.3954 0.0124
NP_440044.1_8 Reverse -278 -297 16.1257 0.0239
NP_441581.1_8 Forward -253 -234 15.3391 0.293
NP_441200.1_4 Reverse -297 -316 16.0274 0.15
NP_441208.1_9 Reverse -44 -58 16.5192 0.0647
NP_441208.1_9 Forward -289 -275 7.9644 0.219
NP_441594.1_6 Reverse -38 -57 4.32602 0.221
NP_441594.1_6 Forward -340 -321 -0.39387 0.299
NP_442276.1_2 Forward -298 -279 4.03102 0.299
NP_442110.1_7 Reverse -277 -291 9.5377 0.0724
NP_442110.1_7 Forward -56 -42 9.2427 0.0755
NP_442110.1_7 Forward -286 -272 2.16287 0.222
NP_442110.1_7 Forward -343 -329 1.37622 0.23
NP_441083.1_5 Forward -56 -46 20.3345 0.00053
NP_441083.1_5 Reverse -47 -57 11.2881 0.0159
NP_441083.1_5 Reverse -277 -287 10.9931 0.017
NP_441083.1_5 Forward -286 -276 1.55333 0.204
NP_442827.1_8 Forward -294 -275 14.6499 0.0402
NP_442827.1_8 Reverse -269 -288 -0.29631 0.224
NP_441738.1_2 Reverse -279 -286 15.28 0.0102
NP_441738.1_2 Forward -54 -47 15.28 0.0102
NP_441738.1_2 Reverse -49 -56 15.28 0.0102
NP_441738.1_2 Forward -284 -277 11.5435 0.084
NP_441558.1_5 Reverse -275 -294 13.5691 0.057
NP_441558.1_5 Forward -288 -269 10.1275 0.105
NP_441558.1_5 Reverse -45 -64 6.68596 0.206
NP_441955.1_8 Reverse -108 -125 6.92201 0.281
NP_440209.1_1 Reverse -47 -55 18.1123 0.00295
NP_440209.1_1 Forward -286 -278 18.1123 0.00295
NP_440209.1_1 Forward -56 -48 18.1123 0.00295
NP_440209.1_1 Reverse -277 -285 8.47588 0.0457
NP_442136.1_4 Forward -344 -325 10.1267 0.288
NP_442889.1_1 Forward -62 -43 -12.6852 0.238
NP_442889.1_8 Reverse -274 -288 7.47213 0.149
NP_440447.1_5 Reverse -69 -79 14.1397 0.277
NP_441713.1_1 Reverse -41 -60 -6.88371 0.123
NP_440178.1_7 Forward -287 -268 -21.7317 0.237
NP_440178.1_7 Forward -57 -38 -21.9284 0.246
NP_442706.1_10 Reverse -279 -297 14.0805 0.235
NP_441716.1_1 Forward -56 -42 17.2075 0.0287
NP_441716.1_1 Reverse -244 -258 9.2427 0.122
NP_441716.1_1 Reverse -277 -291 3.63784 0.259
NP_441327.1_5 Forward -74 -65 16.6177 0.111
NP_442111.1_4 Reverse -46 -60 13.2743 0.0394
NP_442111.1_4 Forward -57 -43 11.2093 0.0515
NP_442111.1_4 Forward -287 -273 9.83269 0.0575
NP_442111.1_4 Reverse -276 -290 8.65272 0.0709
NP_440906.1_5 Forward -285 -278 15.8704 0.0124
NP_440906.1_5 Reverse -278 -285 15.8704 0.0124
NP_440906.1_5 Forward -55 -48 15.8704 0.0124
NP_440906.1_5 Reverse -48 -55 15.8704 0.0124
NP_442596.1_1 Forward -285 -271 20.6484 0.0872
NP_442801.1_1 Reverse -378 -397 15.7885 0.293
NP_440747.1_10 Reverse -44 -56 17.2469 0.000522
NP_440747.1_10 Forward -59 -47 17.1486 0.000663
NP_440747.1_10 Forward -289 -277 -2.22263 0.026
NP_440747.1_10 Reverse -274 -286 -11.8591 0.161
NP_440747.1_10 Reverse -111 -123 -12.1541 0.227
NP_441130.1_10 Forward -288 -274 8.16106 0.14
NP_441130.1_10 Reverse -45 -59 6.98109 0.173
NP_441486.1_1 Forward -126 -112 -2.65535 0.175
NP_439964.1_6 Reverse -196 -215 19.8623 0.168
NP_442330.1_9 Reverse -211 -230 8.45592 0.262
NP_442634.1_4 Forward -58 -44 15.6342 0.0115
NP_442634.1_4 Reverse -45 -59 6.58777 0.0489
NP_442634.1_4 Forward -288 -274 4.32615 0.0819
NP_442634.1_4 Reverse -275 -289 -5.60527 0.264
NP_441265.1_3 Forward -292 -278 2.94952 0.181
NP_440403.1_10 Forward -256 -237 11.1109 0.179
NP_441014.1_10 Reverse -321 -340 1.37531 0.229
NP_442848.1_1 Forward -292 -278 7.57108 0.0791
NP_442848.1_1 Reverse -41 -55 7.37441 0.0791
NP_442848.1_5 Reverse -283 -301 4.54237 0.276
NP_441012.1_4 Forward -121 -108 9.65572 0.272
NP_441012.1_4 Forward -48 -35 8.37742 0.272
NP_443018.1_3 Forward -285 -278 14.8871 0.0123
NP_443018.1_3 Reverse -278 -285 14.8871 0.0123
NP_443018.1_3 Forward -55 -48 14.8871 0.0123
NP_443018.1_3 Reverse -48 -55 14.8871 0.0123
NP_443018.1_3 Reverse -115 -122 11.5438 0.0752
NP_443018.1_3 Reverse -329 -336 7.6106 0.156
NP_441316.1_7 Forward -288 -273 6.37141 0.107
NP_441316.1_7 Reverse -45 -60 5.58476 0.121
NP_441634.1_8 Reverse -112 -126 3.04785 0.157
NP_441634.1_8 Forward -235 -221 1.67122 0.185
NP_441634.1_8 Forward -301 -287 -1.96703 0.295
NP_441634.1_8 Forward -288 -274 -2.75368 0.295
NP_441634.1_8 Forward -58 -44 -2.85201 0.295
NP_440376.1_1 Forward -56 -47 19.4693 0.000692
NP_440376.1_1 Reverse -47 -56 19.4693 0.000692
NP_440376.1_1 Forward -286 -277 9.73449 0.0365
NP_440376.1_1 Reverse -277 -286 9.63616 0.0385
NP_440376.1_1 Reverse -346 -355 2.16301 0.233
NP_441857.1_5 Reverse -237 -255 1.88744 0.287
NP_442687.1_7 Forward -57 -47 9.02648 0.0994
NP_442687.1_7 Reverse -46 -56 8.92815 0.0994
NP_441846.1_10 Reverse -291 -310 -14.3569 0.222
NP_442958.1_3 Forward -297 -278 2.65439 0.267
NP_441422.1_3 Reverse -42 -61 14.0324 0.289
NP_441422.1_7 Forward -58 -41 7.11867 0.0992
NP_441422.1_7 Forward -251 -234 -8.61428 0.276
NP_441950.1_7 Reverse -341 -360 -8.55534 0.287
NP_442296.1_9 Forward -349 -330 -1.47551 0.204
NP_442658.1_1 Forward -58 -48 14.2375 0.0237
NP_442658.1_1 Reverse -275 -285 14.0409 0.0273
NP_442658.1_1 Reverse -45 -55 9.616 0.147
NP_442658.1_1 Forward -288 -278 9.616 0.147
NP_442658.1_1 Reverse -112 -122 6.46942 0.229
NP_442782.1_2 Reverse -303 -317 0.392915 0.29
NP_441414.1_9 Forward -286 -267 8.75091 0.0265
NP_441414.1_9 Forward -56 -37 3.93269 0.0568
NP_440184.1_5 Reverse -37 -56 3.83436 0.253
NP_440720.1_1 Forward -297 -278 18.7807 0.04
NP_441478.1_7 Reverse -238 -252 20.7474 0.18
NP_439959.1_3 Forward -298 -279 10.3242 0.242
NP_442937.1_5 Reverse -42 -61 8.45592 0.22
NP_441958.1_5 Forward -57 -47 21.2195 0.000805
NP_441958.1_5 Reverse -46 -56 12.2714 0.00183
NP_441958.1_5 Reverse -276 -286 11.3864 0.0074
NP_441958.1_5 Forward -287 -277 3.12662 0.0364
NP_441127.1_1 Forward -337 -323 13.2743 0.199
NP_442836.1_5 Reverse -41 -60 6.88262 0.171
NP_440203.1_5 Forward -53 -43 13.5492 0.114
NP_440203.1_5 Reverse -280 -290 12.6642 0.141
NP_439905.1_1 Forward -285 -272 13.0973 0.178
NP_439905.1_1 Reverse -278 -291 10.5407 0.216
NP_439905.1_1 Reverse -48 -61 9.16406 0.221
NP_440984.1_7 Reverse -272 -286 12.586 0.122
NP_440984.1_7 Forward -61 -47 9.63603 0.127
NP_441097.1_2 Reverse -297 -314 19.3117 0.0607
NP_439990.1_5 Forward -61 -48 16.8339 0.0301
NP_439990.1_5 Reverse -42 -55 13.0973 0.103
NP_442376.1_2 Reverse -42 -61 -3.04881 0.202
NP_442911.1_2 Reverse -37 -56 7.66927 0.024
NP_442911.1_2 Reverse -267 -286 0.392778 0.0675
NP_442911.1_2 Forward -296 -277 -2.16383 0.0946
NP_440153.1_5 Reverse -278 -292 12.4876 0.0645
NP_440153.1_5 Forward -55 -41 8.06273 0.149
NP_440153.1_8 Reverse -277 -290 4.34585 0.202
NP_442064.1_4 Reverse -37 -56 15.7316 0.128
NP_443055.1_6 Forward -286 -268 2.08335 0.22
NP_440993.1_2 Reverse -272 -288 13.8249 0.0656
NP_440993.1_2 Forward -291 -275 3.59845 0.256
NP_440993.1_2 Reverse -42 -58 2.71347 0.262
NP_440496.1_1 Forward -278 -259 2.3594 0.269
NP_440138.1_6 Forward -55 -36 4.32522 0.239
NP_441348.1_3 Reverse -272 -291 9.53756 0.215
NP_441099.1_5 Reverse -37 -56 6.98095 0.0429
NP_442002.1_9 Reverse -313 -320 11.3472 0.185
NP_441294.1_7 Forward -290 -276 8.48272 0.298
NP_441646.1_1 Reverse -40 -59 5.70265 0.176
NP_442438.1_10 Reverse -42 -56 10.1277 0.0579
NP_442438.1_10 Forward -291 -277 7.86607 0.0859
NP_442438.1_10 Reverse -329 -343 2.85119 0.168
NP_440484.1_3 Forward -288 -274 10.226 0.242
NP_440147.1_4 Forward -58 -45 19.6855 0.00258
NP_440147.1_4 Reverse -45 -58 9.16406 0.0428
NP_440147.1_4 Reverse -177 -190 4.05085 0.173
NP_440147.1_4 Reverse -275 -288 3.65753 0.183
NP_440147.1_4 Reverse -312 -325 1.88757 0.216
NP_440147.1_4 Forward -288 -275 1.59258 0.224
NP_441550.1_8 Reverse -45 -55 16.7941 0.00906
NP_441550.1_8 Forward -288 -278 16.7941 0.00906
NP_441550.1_8 Forward -58 -48 15.8108 0.0132
NP_441550.1_8 Reverse -275 -285 14.2375 0.0168
NP_441916.1_7 Reverse -47 -57 18.9579 0.00144
NP_441916.1_7 Forward -56 -46 10.3048 0.0261
NP_441916.1_7 Forward -286 -276 9.61647 0.0333
NP_441916.1_7 Reverse -277 -287 2.04498 0.265
NP_441916.1_10 Forward -330 -311 7.37428 0.194
NP_440206.1_4 Reverse -37 -56 1.08032 0.289
NP_441041.1_4 Forward -292 -273 -1.47551 0.1
NP_441041.1_4 Forward -56 -37 -8.752 0.207
NP_441041.1_4 Reverse -41 -60 -10.522 0.233
NP_441041.1_4 Forward -298 -279 -12.3902 0.265
NP_441041.1_7 Forward -59 -47 13.3454 0.0485
NP_441041.1_7 Reverse -44 -56 9.1668 0.12
NP_441041.1_7 Reverse -274 -286 7.02889 0.18
NP_440569.1_10 Forward -324 -305 5.58586 0.237
NP_442004.1_6 Forward -56 -42 5.99778 0.181
NP_442004.1_6 Reverse -277 -291 2.35953 0.266
NP_441725.1_4 Forward -61 -47 3.93223 0.278
NP_441725.1_4 Reverse -42 -56 3.63724 0.278
NP_441725.1_5 Forward -55 -45 9.02648 0.0553
NP_441725.1_5 Reverse -278 -288 9.02648 0.0553
NP_441725.1_5 Forward -285 -275 7.64985 0.0904
NP_441725.1_5 Reverse -48 -58 1.94665 0.115
NP_439966.1_7 Reverse -45 -55 14.8275 0.0177
NP_439966.1_7 Forward -288 -278 14.8275 0.0177
NP_439966.1_7 Forward -58 -48 14.3359 0.0203
NP_439966.1_7 Reverse -275 -285 11.2876 0.0688
NP_439966.1_7 Forward -125 -115 10.0093 0.0968
NP_439966.1_9 Reverse -275 -284 9.24284 0.253
NP_439966.1_9 Forward -288 -279 0.884706 0.253
NP_439966.1_9 Reverse -45 -54 0.884706 0.253
NP_440202.1_8 Forward -345 -326 10.6817 0.292
NP_442941.1_3 Reverse -48 -58 19.2529 0.00262
NP_442941.1_3 Forward -55 -45 10.9931 0.0116
NP_442941.1_3 Reverse -278 -288 10.9931 0.0116
NP_442941.1_3 Forward -285 -275 1.55333 0.15
NP_440289.1_2 Forward -59 -46 3.16588 0.0811
NP_440289.1_2 Reverse -44 -57 -4.7006 0.294
NP_440983.1_5 Forward -56 -37 -3.3438 0.237
NP_440983.1_9 Reverse -38 -57 -0.0988766 0.295
NP_442281.1_1 Reverse -42 -56 15.6336 0.0113
NP_442281.1_1 Forward -61 -47 7.86545 0.0907
NP_442281.1_1 Forward -291 -277 4.42388 0.195
NP_442281.1_1 Reverse -109 -123 2.35894 0.269
NP_441334.1_7 Reverse -275 -294 15.7324 0.0126
NP_441334.1_7 Forward -58 -39 -19.0768 0.275
NP_441334.1_7 Forward -288 -269 -20.3551 0.275
NP_440018.1_3 Reverse -278 -297 8.35759 0.209
NP_440177.1_1 Forward -291 -273 4.9357 0.272
NP_442256.1_2 Reverse -275 -293 -5.58572 0.214
NP_442256.1_2 Forward -288 -270 -8.14232 0.217
NP_001035871.2_7 Forward -384 -374 12.0747 0.272
NP_440437.1_1 Forward -62 -43 -5.11376 0.274
NP_440437.1_1 Forward -105 -86 -5.9004 0.296
NP_440647.1_9 Forward -288 -270 3.46073 0.275
NP_441644.1_6 Reverse -47 -57 19.0557 0.000803
NP_441644.1_6 Forward -56 -46 17.3841 0.00127
NP_441644.1_6 Forward -286 -276 16.5975 0.00319
NP_441644.1_6 Reverse -277 -287 8.04271 0.11
NP_441644.1_6 Forward -292 -282 6.37109 0.161
NP_443049.1_6 Reverse -113 -123 11.4458 0.257
NP_443049.1_6 Forward -287 -277 11.2506 0.269
NP_442215.1_2 Reverse -275 -291 -6.52964 0.273
NP_442215.1_2 Reverse -45 -61 -6.82463 0.28
NP_440929.1_8 Forward -56 -47 19.2726 0.000701
NP_440929.1_8 Reverse -47 -56 19.2726 0.000701
NP_440929.1_8 Forward -286 -277 17.4043 0.00289
NP_440929.1_8 Reverse -277 -286 17.4043 0.00289
NP_442933.1_10 Forward -56 -47 17.601 0.00325
NP_442933.1_10 Reverse -47 -56 17.601 0.00325
NP_442933.1_10 Forward -286 -277 9.04618 0.063
NP_442933.1_10 Reverse -277 -286 8.94785 0.0643
NP_442933.1_10 Reverse -244 -253 8.75118 0.0688
NP_440382.1_2 Forward -159 -140 11.3067 0.175
NP_441751.2_8 Forward -55 -41 16.3225 0.00876
NP_441751.2_8 Reverse -48 -62 12.0943 0.0212
NP_442554.1_8 Forward -55 -45 18.0729 0.00543
NP_442554.1_8 Reverse -278 -288 18.0729 0.00543
NP_442554.1_8 Reverse -48 -58 17.2863 0.00543
NP_442554.1_8 Forward -285 -275 15.8113 0.00783
NP_442554.1_8 Forward -122 -112 3.22496 0.235
NP_441586.1_6 Reverse -275 -294 6.09597 0.277
NP_441762.1_7 Forward -57 -45 2.79224 0.0676
NP_441762.1_7 Reverse -276 -288 -4.68091 0.181
NP_441762.1_7 Forward -287 -275 -4.77924 0.182
NP_441762.1_7 Reverse -46 -58 -6.84419 0.284
NP_442142.1_4 Reverse -44 -57 14.08 0.0317
NP_442142.1_4 Forward -59 -46 12.9 0.0406
NP_442142.1_4 Forward -256 -243 3.65697 0.248
NP_442142.1_4 Reverse -111 -124 3.26365 0.262
NP_442142.1_4 Forward -126 -113 2.67367 0.281
NP_442292.1_1 Forward -55 -46 18.486 0.00229
NP_442292.1_1 Reverse -278 -287 18.486 0.00229
NP_442292.1_1 Reverse -48 -57 17.5026 0.00435
NP_442292.1_1 Forward -285 -276 16.9127 0.00594
NP_442476.1_6 Reverse -278 -292 5.89945 0.131
NP_442476.1_6 Forward -285 -271 5.1128 0.139
NP_442476.1_6 Reverse -48 -62 1.17956 0.228
NP_442476.1_6 Forward -55 -41 0.982901 0.233
NP_443009.1_5 Reverse -46 -57 14.5128 0.02
NP_443009.1_5 Forward -287 -276 13.4312 0.0327
NP_443009.1_5 Forward -57 -46 10.1862 0.0792
NP_442408.2_1 Reverse -277 -296 -4.52377 0.263
NP_441715.1_4 Reverse -48 -58 16.7946 0.0106
NP_441715.1_4 Reverse -278 -288 7.84651 0.107
NP_441715.1_4 Forward -55 -45 7.84651 0.107
NP_441198.1_5 Reverse -279 -292 14.7683 0.206
NP_441198.1_8 Reverse -275 -285 13.955 0.101
NP_441468.1_1 Forward -285 -278 15.8704 0.0124
NP_441468.1_1 Reverse -278 -285 15.8704 0.0124
NP_441468.1_1 Forward -55 -48 15.8704 0.0124
NP_441468.1_1 Reverse -48 -55 15.8704 0.0124
NP_441468.1_1 Reverse -115 -122 4.07068 0.263
NP_441020.2_6 Forward -288 -271 12.1336 0.101
NP_441020.2_6 Reverse -45 -62 6.33202 0.267
NP_441015.1_10 Reverse -272 -291 -8.752 0.277
NP_441015.1_10 Forward -61 -42 -9.53865 0.282
NP_441015.1_10 Forward -291 -272 -10.4236 0.284
NP_441015.1_10 Forward -298 -279 -11.7019 0.3
NP_441673.1_1 Forward -56 -47 20.8459 0.000698
NP_441673.1_1 Reverse -47 -56 20.8459 0.000698
NP_441673.1_1 Forward -286 -277 11.1111 0.0121
NP_441673.1_1 Reverse -277 -286 11.0128 0.018
NP_441731.1_1 Reverse -51 -69 18.2409 0.203
NP_441731.1_3 Reverse -39 -58 -6.68705 0.296
NP_441956.1_9 Forward -57 -38 7.57094 0.274
NP_441826.1_2 Reverse -41 -55 22.2224 0.00317
NP_441826.1_2 Forward -292 -278 14.2576 0.0203
NP_441826.1_2 Reverse -322 -336 -1.37704 0.245
NP_441330.1_1 Forward -61 -42 -14.3569 0.219
NP_442490.1_9 Forward -298 -279 -7.57203 0.278
NP_442490.1_10 Forward -254 -236 7.88563 0.286
NP_441764.1_8 Forward -74 -64 12.4592 0.284
NP_442868.1_6 Reverse -45 -55 17.4829 0.012
NP_442868.1_6 Forward -288 -278 17.4829 0.012
NP_442868.1_6 Forward -58 -48 10.4031 0.038
NP_442868.1_6 Reverse -275 -285 -0.314959 0.284
NP_441612.1_2 Forward -56 -46 8.54929 0.21
NP_442227.1_2 Reverse -282 -301 -1.47551 0.262
NP_442808.1_1 Forward -57 -47 8.73102 0.0481
NP_442808.1_1 Reverse -46 -56 8.63269 0.0481
NP_442808.1_1 Forward -124 -114 5.97777 0.134
NP_442808.1_1 Reverse -288 -298 2.92952 0.252
NP_442808.1_1 Forward -356 -346 1.06124 0.296
NP_441101.1_10 Forward -60 -41 1.17943 0.173
NP_441101.1_10 Reverse -86 -105 -7.67036 0.29
NP_442775.1_6 Reverse -329 -348 13.8641 0.268
NP_440145.1_3 Forward -66 -47 1.47442 0.128
NP_440145.1_3 Reverse -37 -56 -0.787193 0.143
NP_442542.1_9 Forward -293 -279 10.5204 0.113
NP_442050.1_5 Reverse -275 -285 16.5975 0.00812
NP_442050.1_5 Forward -58 -48 15.9091 0.0091
NP_442050.1_5 Reverse -45 -55 15.6142 0.01
NP_442050.1_5 Forward -288 -278 15.6142 0.01
NP_440342.1_6 Forward -278 -259 21.3373 0.166
NP_442789.1_4 Forward -288 -269 7.66927 0.111
NP_442789.1_5 Reverse -73 -92 9.14423 0.21
NP_441878.1_6 Forward -57 -47 10.5014 0.0176
NP_441878.1_6 Reverse -46 -56 10.4031 0.0176
NP_441878.1_6 Forward -287 -277 0.668351 0.139
NP_441878.1_6 Reverse -276 -286 0.668351 0.139
NP_441036.1_8 Forward -57 -47 15.713 0.00724
NP_441036.1_8 Reverse -276 -286 14.7297 0.0187
NP_441036.1_8 Reverse -46 -56 8.33817 0.174
NP_442650.1_2 Forward -56 -42 6.78443 0.13
NP_441557.1_5 Forward -56 -47 19.9609 0.000699
NP_441557.1_5 Reverse -47 -56 19.9609 0.000699
NP_441557.1_5 Reverse -277 -286 17.4043 0.0023
NP_441557.1_5 Forward -286 -277 10.8161 0.00464
NP_441557.1_8 Forward -311 -301 10.3043 0.289
NP_441445.1_1 Reverse -81 -100 -0.688862 0.3
NP_441590.1_4 Forward -354 -335 3.44025 0.29
NP_442066.2_4 Forward -56 -37 2.45773 0.134
NP_442066.2_9 Forward -60 -47 12.6056 0.154
NP_442066.2_9 Reverse -273 -286 12.0157 0.154
NP_441433.1_8 Forward -84 -65 -2.26216 0.268
NP_441308.1_8 Reverse -275 -285 10.9931 0.22
NP_441458.1_10 Forward -65 -46 7.17762 0.196
NP_442830.1_1 Forward -231 -212 18.1907 0.198
NP_442183.1_1 Forward -56 -42 15.7325 0.0187
NP_442183.1_1 Forward -286 -272 12.9793 0.05
NP_441407.1_5 Reverse -267 -286 8.84924 0.153
NP_441549.1_9 Forward -290 -272 -8.24065 0.223
NP_441549.1_9 Reverse -86 -104 -10.1089 0.269
NP_442170.1_5 Forward -286 -267 10.2259 0.0569
NP_442347.1_2 Reverse -278 -287 12.4878 0.056
NP_442347.1_2 Forward -55 -46 12.4878 0.056
NP_442347.1_2 Reverse -105 -114 4.71961 0.266
NP_442347.1_2 Reverse -48 -57 3.34298 0.284
NP_442888.1_6 Forward -373 -354 3.73603 0.244
NP_441037.1_4 Reverse -275 -285 15.5041 0.028
NP_441037.1_4 Forward -288 -278 9.55921 0.21
NP_441037.1_4 Reverse -45 -55 9.55921 0.21
NP_441037.1_4 Forward -58 -48 7.22024 0.237
NP_441633.1_3 Forward -58 -45 6.01747 0.0481
NP_441633.1_3 Reverse -275 -288 -1.65234 0.16
NP_441633.1_3 Forward -288 -275 -6.07724 0.236
NP_441633.1_3 Reverse -45 -58 -6.07724 0.236
NP_440136.1_2 Forward -285 -278 15.9687 0.0123
NP_440136.1_2 Reverse -278 -285 15.9687 0.0123
NP_440136.1_2 Forward -55 -48 15.9687 0.0123
NP_440136.1_2 Reverse -48 -55 15.9687 0.0123
NP_442590.1_10 Forward -63 -44 3.93269 0.283
NP_442998.1_5 Forward -73 -63 13.0581 0.158
NP_442998.1_5 Forward -74 -64 9.61647 0.238
NP_442998.1_10 Reverse -279 -286 15.5754 0.0102
NP_442998.1_10 Forward -54 -47 15.5754 0.0102
NP_442998.1_10 Reverse -49 -56 15.5754 0.0102
NP_442998.1_10 Forward -121 -114 6.13563 0.181
NP_442998.1_10 Forward -284 -277 5.84064 0.235
NP_440899.1_2 Forward -67 -48 12.0933 0.118
NP_440299.1_1 Reverse -43 -56 21.8481 0.000628
NP_440299.1_1 Forward -290 -277 10.9334 0.0529
NP_441799.1_1 Forward -60 -46 16.6169 0.0138
NP_441799.1_1 Reverse -43 -57 6.58715 0.167
NP_441799.1_1 Forward -290 -276 6.39049 0.174
NP_441799.1_1 Reverse -273 -287 4.71887 0.238
NP_441007.1_10 Reverse -272 -285 19.4888 0.0239
NP_441007.1_10 Forward -291 -278 9.16406 0.104
NP_441007.1_10 Reverse -42 -55 8.86907 0.108
NP_441007.1_10 Forward -61 -48 3.5592 0.182
NP_442334.1_2 Forward -296 -279 -14.0225 0.297
NP_442334.1_10 Forward -302 -283 -16.7168 0.257
NP_442201.1_10 Forward -297 -278 -4.52377 0.152
NP_440256.1_1 Reverse -44 -63 -4.91709 0.169
NP_440256.1_1 Forward -59 -40 -7.37537 0.234
NP_440456.1_7 Reverse -322 -336 15.7325 0.268
NP_441559.1_8 Forward -61 -47 10.9143 0.0574
NP_441559.1_8 Reverse -109 -123 0.687908 0.163
NP_441559.1_8 Forward -304 -290 -5.40861 0.261
NP_441559.1_8 Forward -118 -104 -6.49025 0.279
NP_441559.1_8 Reverse -42 -56 -6.68692 0.279
NP_440915.1_6 Reverse -43 -57 22.4191 0.00257
NP_440915.1_6 Forward -290 -276 5.30946 0.091
NP_440915.1_6 Forward -60 -46 0.982901 0.148
NP_442158.1_4 Reverse -67 -77 13.7464 0.212
NP_440717.1_1 Reverse -278 -297 5.30933 0.276
NP_442452.1_8 Forward -292 -278 14.0603 0.273
NP_442866.1_1 Reverse -272 -291 -5.80207 0.245
NP_440306.1_8 Reverse -57 -76 -2.06626 0.241
NP_441939.1_3 Reverse -48 -67 10.5209 0.125
NP_441939.1_3 Reverse -278 -297 5.99764 0.255
NP_441494.1_6 Forward -291 -278 8.27909 0.23
NP_442993.1_1 Reverse -114 -130 -9.5779 0.188
NP_442993.1_1 Reverse -47 -63 -11.5445 0.251
NP_440677.1_6 Forward -65 -46 9.53756 0.27
NP_442386.1_9 Reverse -46 -55 13.8639 0.0289
NP_442386.1_9 Forward -287 -278 13.8639 0.0289
NP_442386.1_9 Forward -57 -48 6.39082 0.219
NP_442386.1_9 Reverse -276 -285 5.11253 0.266
NP_441750.1_4 Reverse -283 -302 0.982764 0.291
NP_441340.1_5 Forward -285 -278 15.6737 0.0124
NP_441340.1_5 Reverse -278 -285 15.6737 0.0124
NP_441340.1_5 Forward -55 -48 15.6737 0.0124
NP_441340.1_5 Reverse -48 -55 15.6737 0.0124
NP_441340.1_9 Forward -74 -64 8.25522 0.256
NP_441340.1_9 Reverse -159 -169 7.38756 0.27
NP_442791.1_5 Reverse -96 -115 -10.9153 0.282
NP_442240.1_1 Forward -294 -275 5.30853 0.264
NP_442240.1_1 Reverse -39 -58 3.9319 0.277
NP_442240.1_2 Reverse -48 -67 -11.0136 0.137
NP_442240.1_2 Forward -122 -103 -14.8485 0.191
NP_440161.1_3 Reverse -45 -64 14.2574 0.121
NP_440586.1_1 Forward -234 -215 -5.01543 0.28
NP_440586.1_8 Forward -285 -278 13.2151 0.026
NP_440586.1_8 Forward -55 -48 13.2151 0.026
NP_440586.1_8 Reverse -278 -285 13.2151 0.026
NP_440586.1_8 Reverse -48 -55 13.2151 0.026
NP_440586.1_8 Reverse -115 -122 10.9535 0.119
NP_440586.1_9 Reverse -296 -315 4.52268 0.288
NP_442251.1_6 Forward -285 -278 15.2804 0.0124
NP_442251.1_6 Reverse -278 -285 15.2804 0.0124
NP_442251.1_6 Forward -55 -48 15.2804 0.0124
NP_442251.1_6 Reverse -48 -55 15.2804 0.0124
NP_440684.1_9 Reverse -41 -55 9.04604 0.221
NP_441262.1_3 Reverse -277 -284 14.8871 0.0223
NP_441262.1_3 Reverse -47 -54 14.7888 0.0223
NP_441262.1_3 Forward -286 -279 14.7888 0.0223
NP_441262.1_3 Forward -56 -49 14.7888 0.0223
NP_441262.1_3 Reverse -114 -121 5.25066 0.215
NP_440027.1_3 Reverse -277 -295 9.06482 0.187
NP_440027.1_3 Forward -66 -48 4.24662 0.262
NP_443051.1_1 Forward -57 -48 19.5676 0.00335
NP_443051.1_1 Reverse -276 -285 17.5026 0.0066
NP_443051.1_1 Reverse -46 -55 10.4228 0.00754
NP_443051.1_1 Forward -287 -278 10.4228 0.00754
NP_439996.1_6 Forward -296 -277 11.9948 0.181
NP_439937.1_9 Forward -57 -40 -16.0881 0.287
NP_441595.1_5 Forward -293 -275 6.50899 0.222
NP_440439.1_1 Forward -59 -46 10.934 0.0339
NP_440439.1_1 Reverse -44 -57 8.27909 0.0547
NP_440439.1_1 Forward -289 -276 2.37923 0.135
NP_440439.1_1 Forward -116 -103 -0.472371 0.221
NP_440439.1_1 Reverse -237 -250 -1.75067 0.281
NP_442239.1_8 Forward -302 -283 8.35759 0.249
NP_439943.1_4 Reverse -307 -326 12.9791 0.175
NP_440372.1_2 Forward -285 -278 16.3621 0.0124
NP_440372.1_2 Reverse -278 -285 16.3621 0.0124
NP_440372.1_2 Forward -55 -48 16.3621 0.0124
NP_440372.1_2 Reverse -48 -55 16.3621 0.0124
NP_441181.1_2 Reverse -258 -277 2.26107 0.272
NP_440819.1_5 Forward -74 -66 7.68924 0.266
NP_441803.1_2 Reverse -272 -291 0.982764 0.242
NP_439977.1_5 Forward -62 -43 14.4541 0.0531
NP_439977.1_5 Reverse -271 -290 13.9625 0.0531
NP_441572.1_7 Reverse -41 -60 -0.197208 0.179
NP_440267.1_2 Reverse -215 -229 5.40719 0.268
NP_442384.1_4 Reverse -332 -351 18.0915 0.148
NP_442384.1_10 Reverse -47 -60 17.0305 0.0065
NP_442384.1_10 Forward -56 -43 11.3273 0.0367
NP_442384.1_10 Reverse -104 -117 4.34585 0.16
NP_442384.1_10 Reverse -277 -290 3.95252 0.172
NP_442339.1_1 Reverse -161 -180 19.1731 0.11
NP_442114.1_4 Reverse -277 -288 8.7118 0.19
NP_441877.1_7 Forward -351 -332 7.4718 0.218
NP_441018.1_7 Reverse -37 -56 7.57094 0.269
NP_441018.1_7 Forward -117 -98 6.39097 0.289
NP_442790.1_4 Reverse -38 -57 7.17762 0.0729
NP_442790.1_4 Forward -295 -276 -7.4737 0.153
NP_442262.1_10 Forward -285 -278 14.1988 0.0123
NP_442262.1_10 Reverse -278 -285 14.1988 0.0123
NP_442262.1_10 Forward -55 -48 14.1988 0.0123
NP_442262.1_10 Reverse -48 -55 14.1988 0.0123
NP_442262.1_10 Reverse -115 -122 11.7405 0.0841
NP_442262.1_10 Reverse -329 -336 8.8889 0.219
NP_441689.1_5 Forward -58 -48 8.3377 0.132
NP_441689.1_5 Forward -288 -278 5.87944 0.197
NP_441689.1_5 Reverse -45 -55 5.87944 0.197
NP_442244.1_7 Reverse -334 -353 11.1109 0.291
NP_440163.1_10 Reverse -111 -121 8.73149 0.262
NP_442165.1_3 Forward -75 -61 18.0596 0.15
NP_440344.1_10 Reverse -282 -299 -2.3211 0.0643
NP_440344.1_10 Reverse -40 -57 -8.61428 0.13
NP_440344.1_10 Forward -338 -321 -12.4492 0.254
NP_440531.1_6 Forward -64 -45 2.75272 0.151
NP_440531.1_6 Reverse -196 -215 -5.40875 0.297
NP_442910.1_1 Reverse -40 -59 -6.88371 0.254
NP_441965.1_3 Reverse -37 -56 4.42435 0.173
NP_441965.1_10 Reverse -44 -60 11.9566 0.107
NP_440297.1_9 Forward -285 -275 -0.0199663 0.282
NP_440297.1_9 Forward -55 -45 -0.216628 0.282
NP_440297.1_9 Reverse -278 -288 -0.216628 0.282
NP_440297.1_9 Reverse -48 -58 -0.216628 0.282
NP_440297.1_9 Reverse -115 -125 -0.41329 0.283
NP_441592.1_4 Forward -56 -37 -2.55715 0.265
NP_440700.1_8 Reverse -302 -316 16.4209 0.223
NP_440650.1_6 Forward -62 -43 9.83255 0.239
NP_440894.1_10 Forward -61 -42 5.30933 0.235
NP_441778.1_8 Forward -304 -290 19.3701 0.178
NP_440999.1_1 Forward -357 -338 2.6536 0.249
NP_440999.1_9 Reverse -43 -57 10.3243 0.0541
NP_440999.1_9 Forward -60 -46 7.17775 0.0896
NP_440999.1_9 Reverse -273 -287 0.786239 0.177
NP_440999.1_9 Forward -290 -276 -0.393733 0.205
NP_440888.1_2 Forward -56 -42 16.9119 0.00511
NP_440888.1_2 Reverse -277 -291 12.3887 0.046
NP_440888.1_2 Reverse -47 -61 10.6187 0.0893
NP_440888.1_2 Forward -286 -272 7.07881 0.208
NP_440600.1_4 Reverse -39 -57 -0.275845 0.148
NP_440600.1_4 Reverse -269 -287 -1.75081 0.174
NP_440491.1_1 Forward -289 -270 19.489 0.0298
NP_442033.1_10 Forward -58 -39 -8.06369 0.189
NP_442033.1_10 Reverse -45 -64 -8.06369 0.189
NP_442033.1_10 Reverse -275 -294 -10.9153 0.245
NP_442807.1_10 Forward -229 -215 16.4209 0.199
NP_441543.1_2 Forward -55 -46 16.9127 0.00359
NP_441543.1_2 Reverse -278 -287 16.9127 0.00359
NP_441543.1_2 Reverse -48 -57 15.9293 0.00518
NP_441543.1_2 Forward -285 -276 6.39124 0.153
NP_441543.1_2 Forward -122 -113 6.39124 0.153
NP_442845.1_2 Reverse -41 -55 13.5693 0.0949
NP_442845.1_2 Forward -292 -278 6.3911 0.21
NP_442845.1_2 Reverse -277 -291 5.21113 0.24
NP_440739.1_7 Forward -286 -267 11.3075 0.25
NP_441551.1_5 Reverse -43 -59 9.89093 0.201
NP_441469.1_1 Reverse -272 -291 13.2741 0.172
NP_441469.1_8 Reverse -276 -285 6.98123 0.227
NP_441469.1_8 Forward -57 -48 6.5879 0.227
NP_441469.1_8 Forward -287 -278 6.48957 0.227
NP_441469.1_8 Reverse -46 -55 6.48957 0.227
NP_441469.1_8 Forward -124 -115 5.40793 0.272
NP_441469.1_8 Reverse -113 -122 5.21127 0.283
NP_443064.1_6 Forward -56 -46 12.5669 0.0796
NP_443064.1_6 Reverse -47 -57 10.8217 0.13
NP_442578.1_7 Forward -285 -278 14.5921 0.026
NP_442578.1_7 Forward -55 -48 14.5921 0.026
NP_442578.1_7 Reverse -278 -285 14.5921 0.026
NP_442578.1_7 Reverse -48 -55 14.5921 0.026
NP_442578.1_7 Reverse -115 -122 5.15232 0.291
NP_440220.1_4 Reverse -256 -275 -0.197979 0.261
NP_441462.1_2 Reverse -47 -57 20.2362 0.000805
NP_441462.1_2 Forward -56 -46 11.5831 0.00406
NP_441462.1_2 Forward -286 -276 11.3864 0.00425
NP_441462.1_2 Reverse -277 -287 1.74999 0.0811
NP_441621.1_7 Reverse -45 -59 4.62115 0.0934
NP_441621.1_7 Reverse -275 -289 -2.16369 0.188
NP_441621.1_7 Forward -58 -44 -2.85201 0.188
NP_441621.1_7 Forward -288 -274 -3.147 0.188
NP_441621.1_7 Forward -125 -111 -4.52363 0.232
NP_443062.1_1 Forward -56 -38 16.3465 0.031
NP_443062.1_1 Forward -123 -105 11.3736 0.1
NP_443062.1_1 Forward -286 -268 4.06059 0.276
NP_442204.1_1 Reverse -110 -121 12.5467 0.0565
NP_442204.1_1 Forward -60 -49 11.2684 0.0565
NP_442204.1_1 Forward -22 -11 3.89358 0.266
NP_442204.1_1 Reverse -43 -54 2.41861 0.266
NP_442204.1_1 Forward -290 -279 0.648657 0.281
NP_442204.1_5 Forward -296 -277 17.699 0.0339
NP_441560.1_10 Reverse -171 -190 7.96426 0.266
NP_440516.1_6 Reverse -328 -342 11.4053 0.204
NP_440516.1_6 Forward -346 -332 10.422 0.226
NP_440516.1_8 Forward -56 -47 16.9127 0.00442
NP_440516.1_8 Reverse -47 -56 16.9127 0.00442
NP_440516.1_8 Forward -286 -277 9.53783 0.0136
NP_440516.1_8 Reverse -277 -286 7.07956 0.0867
NP_442428.1_5 Forward -285 -278 15.8704 0.0124
NP_442428.1_5 Reverse -278 -285 15.8704 0.0124
NP_442428.1_5 Forward -55 -48 15.8704 0.0124
NP_442428.1_5 Reverse -48 -55 15.8704 0.0124
NP_442428.1_5 Reverse -115 -122 4.46401 0.267
NP_441790.1_3 Forward -285 -266 9.14423 0.0922
NP_440673.1_2 Reverse -267 -286 12.3406 0.149
NP_440673.1_3 Forward -54 -47 12.4288 0.0426
NP_440673.1_3 Reverse -279 -286 12.4288 0.0426
NP_440673.1_3 Reverse -49 -56 12.4288 0.0426
NP_440673.1_3 Forward -121 -114 11.6422 0.0724
NP_440673.1_3 Reverse -330 -337 9.67555 0.179
NP_440673.1_3 Forward -284 -277 5.34899 0.298
NP_440673.1_7 Forward -297 -278 7.27595 0.146
NP_441052.1_2 Forward -56 -46 19.9412 0.00106
NP_441052.1_2 Reverse -277 -287 11.3864 0.0285
NP_441052.1_2 Reverse -47 -57 10.4031 0.0285
NP_441052.1_2 Forward -286 -276 0.668351 0.256
NP_441052.1_2 Forward -99 -89 -0.708283 0.294
NP_442219.1_8 Forward -263 -244 9.23007 0.234
NP_442219.1_9 Forward -55 -46 17.7976 0.00718
NP_442219.1_9 Reverse -278 -287 17.7976 0.00718
NP_442219.1_9 Reverse -48 -57 8.25953 0.0681
NP_440436.1_4 Forward -55 -46 17.2072 0.00233
NP_440436.1_4 Reverse -278 -287 17.2072 0.00233
NP_440436.1_4 Reverse -48 -57 9.24241 0.0871
NP_440436.1_4 Forward -98 -89 7.76745 0.124
NP_440436.1_4 Forward -122 -113 5.60418 0.188
NP_441884.1_8 Forward -57 -38 -5.70374 0.194
NP_441884.1_9 Reverse -274 -293 -3.14714 0.0594
NP_441884.1_9 Forward -289 -270 -22.0267 0.275
NP_441884.1_9 Forward -59 -40 -23.895 0.284
NP_440314.1_9 Reverse -278 -297 -6.78538 0.231
NP_440648.1_1 Forward -286 -267 12.4875 0.112
NP_440648.1_6 Forward -95 -76 7.37347 0.279
NP_441719.1_4 Forward -285 -278 16.3621 0.0124
NP_441719.1_4 Reverse -278 -285 16.3621 0.0124
NP_441719.1_4 Forward -55 -48 16.3621 0.0124
NP_441719.1_4 Reverse -48 -55 16.3621 0.0124
NP_441719.1_4 Reverse -115 -122 3.77569 0.285
NP_441733.1_10 Reverse -44 -57 7.78743 0.15
NP_441733.1_10 Reverse -274 -287 6.1158 0.203
NP_441004.1_3 Forward -233 -214 7.07928 0.204
NP_442366.1_3 Forward -124 -106 1.29745 0.153
NP_442366.1_3 Forward -57 -39 -1.25915 0.208
NP_442176.1_1 Forward -380 -361 7.96426 0.225
NP_442873.1_3 Reverse -267 -286 3.24359 0.29
NP_440296.1_10 Reverse -44 -63 -11.9969 0.269
NP_441115.1_4 Reverse -276 -294 14.9646 0.0464
NP_441115.1_4 Forward -57 -39 10.4414 0.179
NP_442206.1_10 Forward -286 -271 5.68309 0.178
NP_442206.1_10 Forward -56 -41 4.30646 0.178
NP_442206.1_10 Reverse -47 -62 4.30646 0.178
NP_440328.1_4 Reverse -41 -60 7.96426 0.116
NP_440328.1_4 Forward -292 -273 6.39097 0.13
NP_443054.1_2 Forward -58 -44 0.88457 0.252
NP_440508.1_2 Reverse -64 -83 15.2223 0.234
NP_441851.1_10 Reverse -46 -56 15.8113 0.00552
NP_441851.1_10 Forward -287 -277 15.6147 0.00791
NP_441851.1_10 Reverse -113 -123 10.4031 0.0935
NP_441851.1_10 Forward -57 -47 8.53483 0.114
NP_441851.1_10 Reverse -276 -286 6.96153 0.151
NP_442622.1_8 Forward -56 -38 -18.6637 0.243
NP_440611.1_6 Forward -354 -335 5.60432 0.29
NP_442856.1_7 Reverse -241 -260 -4.42544 0.26
NP_442856.1_7 Forward -295 -276 -5.60541 0.283
NP_442515.1_1 Forward -287 -273 14.2576 0.0278
NP_442515.1_1 Reverse -46 -60 4.32615 0.107
NP_442515.1_1 Forward -57 -43 -4.22864 0.298
NP_440593.1_3 Forward -291 -272 -4.03212 0.244
NP_440593.1_3 Reverse -272 -291 -5.21209 0.259
NP_441982.1_6 Forward -201 -192 11.3395 0.288
NP_440463.1_8 Forward -314 -295 6.33814 0.27
NP_440165.1_5 Forward -57 -38 9.63589 0.0617
NP_440165.1_5 Reverse -276 -295 -7.4737 0.265
NP_442709.1_3 Reverse -40 -59 8.25926 0.121
NP_441349.1_10 Reverse -37 -56 3.53937 0.0661
NP_441349.1_10 Forward -66 -47 -4.42544 0.171
NP_441349.1_10 Forward -296 -277 -7.57203 0.254
NP_441409.1_6 Forward -62 -43 1.86774 0.0586
NP_441409.1_6 Reverse -41 -60 -8.55534 0.17
NP_440432.1_9 Forward -285 -270 6.17475 0.0477
NP_440432.1_9 Reverse -48 -63 -4.24833 0.202
NP_439960.1_10 Forward -306 -288 -3.81576 0.282
NP_440474.1_8 Forward -285 -271 17.6985 0.0432
NP_440474.1_8 Forward -345 -331 7.47213 0.204
NP_441477.1_10 Reverse -40 -58 5.82068 0.19
NP_440588.1_2 Forward -65 -46 -1.27885 0.155
NP_440588.1_2 Reverse -38 -57 -2.36049 0.164
NP_440588.1_2 Reverse -319 -338 -6.49039 0.283
NP_442006.1_2 Reverse -294 -311 -17.0707 0.269
NP_442006.1_2 Forward -79 -62 -19.0374 0.297
NP_442006.1_3 Reverse -41 -59 -7.15901 0.298
NP_441003.1_9 Reverse -38 -57 7.66927 0.227
NP_442243.1_1 Forward -25 -7 2.37835 0.204
NP_441570.1_1 Forward -56 -38 1.49411 0.0304
NP_441570.1_1 Reverse -277 -295 -11.5839 0.198
NP_441570.1_1 Reverse -47 -65 -14.8288 0.227
NP_440078.1_2 Reverse -340 -359 18.1907 0.105
NP_440078.1_10 Forward -56 -37 13.2741 0.155
NP_441078.1_4 Forward -56 -47 19.6659 0.0007
NP_441078.1_4 Reverse -47 -56 19.6659 0.0007
NP_441078.1_4 Forward -286 -277 9.93116 0.0203
NP_441078.1_4 Reverse -277 -286 9.83282 0.0226
NP_441078.1_4 Reverse -114 -123 -2.06522 0.295
NP_442729.1_8 Reverse -43 -56 8.67241 0.125
NP_442729.1_8 Forward -290 -277 5.72248 0.233
NP_441663.1_8 Reverse -41 -60 0.786102 0.214
NP_441663.1_8 Forward -62 -43 -1.57384 0.243
NP_442348.1_2 Forward -113 -104 7.57121 0.28
NP_442348.1_2 Forward -226 -217 6.8829 0.298
NP_440707.1_9 Forward -232 -213 6.98095 0.235
NP_442443.1_1 Forward -232 -213 -4.81876 0.278
NP_442443.1_1 Forward -331 -312 -6.09707 0.293
NP_440526.1_3 Forward -55 -44 17.7577 0.0398
NP_440526.1_3 Reverse -278 -289 10.6779 0.0646
NP_440526.1_3 Forward -285 -274 0.844851 0.267
NP_441432.1_8 Reverse -46 -55 16.8143 0.00595
NP_441432.1_8 Forward -287 -278 16.8143 0.00595
NP_441432.1_8 Forward -57 -48 16.8143 0.00595
NP_441432.1_8 Reverse -276 -285 6.98123 0.112
NP_442320.1_8 Forward -292 -278 5.01447 0.0442
NP_442320.1_8 Reverse -41 -55 4.71948 0.0472
NP_442344.1_7 Forward -285 -266 -7.17871 0.18
NP_441732.1_2 Forward -60 -44 2.91013 0.0145
NP_441732.1_2 Reverse -273 -289 -5.93965 0.0495
NP_441732.1_2 Forward -290 -274 -15.9694 0.164
NP_441732.1_2 Reverse -43 -59 -15.9694 0.164
NP_442540.1_3 Forward -89 -70 17.2306 0.278
NP_440629.1_6 Forward -62 -43 12.115 0.297
NP_442003.1_4 Reverse -105 -124 14.8474 0.205
NP_442003.1_9 Forward -285 -266 7.66927 0.235
NP_440760.1_1 Reverse -47 -66 -5.50708 0.0503
NP_440760.1_1 Forward -56 -37 -14.2585 0.128
NP_440760.1_1 Forward -123 -104 -16.1268 0.166
NP_440760.1_1 Forward -286 -267 -21.0434 0.228
NP_442797.1_7 Forward -293 -275 -0.177514 0.282
NP_442178.1_10 Reverse -291 -310 17.109 0.281
NP_440913.1_1 Reverse -45 -63 7.68896 0.196
NP_440713.1_4 Reverse -37 -56 12.8808 0.103
NP_442489.1_2 Forward -348 -329 2.65439 0.261
NP_442489.1_7 Forward -56 -47 20.1576 0.000695
NP_442489.1_7 Reverse -47 -56 20.1576 0.000695
NP_442489.1_7 Forward -286 -277 10.4228 0.0151
NP_442489.1_7 Reverse -277 -286 10.3245 0.0193
NP_442489.1_7 Reverse -114 -123 -1.57357 0.213
NP_442079.1_6 Reverse -339 -358 13.4708 0.276
NP_442079.1_7 Forward -55 -36 0.491109 0.283
NP_440559.1_1 Forward -55 -46 17.4043 0.00658
NP_440559.1_1 Reverse -278 -287 17.4043 0.00658
NP_440559.1_1 Reverse -48 -57 8.65285 0.0586
NP_440559.1_1 Forward -285 -276 7.76787 0.0918
NP_441659.2_8 Reverse -47 -57 20.9245 0.000805
NP_441659.2_8 Forward -56 -46 18.1713 0.00133
NP_441659.2_8 Forward -286 -276 17.5813 0.0024
NP_441659.2_8 Reverse -277 -287 8.63316 0.0405
NP_440860.1_8 Reverse -326 -345 13.2741 0.296
NP_441022.1_1 Forward -211 -202 10.587 0.294
NP_442913.1_10 Forward -295 -276 14.4541 0.0222
NP_442913.1_10 Reverse -268 -287 9.93088 0.0425
NP_439956.1_7 Reverse -41 -60 1.17943 0.292
NP_442008.1_2 Forward -59 -40 12.4875 0.1
NP_440708.1_6 Forward -308 -289 -10.4236 0.278
NP_442776.1_1 Forward -361 -342 7.17762 0.209
NP_442776.1_2 Forward -69 -50 9.63589 0.258
NP_440779.1_5 Reverse -277 -294 -14.2191 0.243
NP_442346.1_5 Reverse -46 -56 16.6963 0.00248
NP_442346.1_5 Forward -57 -47 16.303 0.00248
NP_442346.1_5 Forward -287 -277 15.418 0.00627
NP_442346.1_5 Reverse -276 -286 6.8632 0.188
NP_442346.1_5 Reverse -178 -188 6.56821 0.198
NP_442346.1_5 Forward -51 -41 5.68323 0.234
NP_440352.1_5 Forward -83 -64 11.6824 0.254
NP_440545.1_3 Reverse -43 -60 22.4583 0.00525
NP_440545.1_3 Forward -290 -273 15.8701 0.0128
NP_440545.1_3 Forward -60 -43 1.61214 0.116
NP_440545.1_3 Reverse -273 -290 0.137172 0.144
NP_441856.1_3 Forward -289 -270 -2.16383 0.255
NP_441629.1_3 Reverse -214 -233 0.785326 0.234
NP_440486.1_6 Forward -57 -38 10.9142 0.216
NP_440459.1_2 Forward -58 -41 8.10198 0.27
NP_440010.1_4 Reverse -37 -56 16.0265 0.157
NP_440010.1_4 Forward -60 -41 0.195343 0.25
NP_442603.1_7 Forward -56 -42 17.0102 0.0273
NP_442603.1_7 Reverse -277 -291 12.782 0.0948
NP_442603.1_7 Reverse -47 -61 6.68548 0.232
NP_441888.1_7 Reverse -42 -56 3.53951 0.225
NP_440946.1_6 Forward -348 -329 4.22769 0.294
NP_440449.1_6 Forward -294 -276 9.71478 0.17
NP_441948.1_4 Forward -63 -45 -0.865831 0.139
NP_440170.1_5 Reverse -37 -56 5.99764 0.19
NP_441502.1_3 Forward -58 -39 4.81767 0.299
NP_441502.1_5 Reverse -70 -89 19.174 0.0555
NP_441833.1_4 Forward -285 -278 15.9687 0.0124
NP_441833.1_4 Reverse -278 -285 15.9687 0.0124
NP_441833.1_4 Forward -55 -48 15.9687 0.0124
NP_441833.1_4 Reverse -48 -55 15.9687 0.0124
NP_442162.1_9 Forward -285 -278 16.2637 0.0124
NP_442162.1_9 Reverse -278 -285 16.2637 0.0124
NP_442162.1_9 Forward -55 -48 16.2637 0.0124
NP_442162.1_9 Reverse -48 -55 16.2637 0.0124
NP_440671.1_4 Reverse -41 -55 12.0943 0.117
NP_440671.1_4 Reverse -108 -122 5.40779 0.283
NP_442045.1_5 Forward -317 -298 6.39097 0.202
NP_442140.1_3 Forward -55 -45 13.5497 0.0542
NP_442140.1_3 Reverse -278 -288 13.5497 0.0542
NP_442140.1_3 Forward -285 -275 8.92815 0.117
NP_442140.1_3 Reverse -48 -58 4.69992 0.238
NP_440875.1_9 Reverse -49 -59 16.5483 0.0145
NP_440875.1_9 Forward -121 -111 13.6282 0.0646
NP_440875.1_9 Forward -54 -44 9.3454 0.233
NP_440875.1_9 Forward -284 -274 7.10665 0.283
NP_441813.1_5 Forward -58 -48 18.1713 0.00743
NP_441813.1_5 Reverse -45 -55 8.73149 0.0367
NP_441813.1_5 Forward -288 -278 8.73149 0.0367
NP_441813.1_5 Reverse -275 -285 7.94484 0.0517
NP_441813.1_5 Reverse -112 -122 -0.0199663 0.227
NP_440594.1_8 Reverse -48 -61 11.5234 0.152
NP_442028.1_1 Reverse -144 -157 9.89744 0.251
NP_440590.1_4 Reverse -278 -291 21.3571 0.00401
NP_440590.1_4 Forward -55 -42 5.72248 0.0585
NP_440590.1_4 Reverse -48 -61 -3.32397 0.255
NP_440590.1_4 Forward -122 -109 -4.01229 0.257
NP_440567.1_1 Reverse -278 -292 17.6008 0.0153
NP_440567.1_1 Forward -55 -41 13.4709 0.0213
NP_440567.1_1 Forward -285 -271 7.47274 0.0707
NP_440567.1_7 Reverse -203 -215 18.8196 0.203
NP_442497.1_10 Reverse -48 -57 17.601 0.00813
NP_442497.1_10 Forward -285 -276 15.7327 0.0087
NP_442497.1_10 Forward -55 -46 10.4228 0.0087
NP_442497.1_10 Reverse -278 -287 10.4228 0.0087
NP_440821.1_4 Reverse -45 -55 17.9746 0.00497
NP_440821.1_4 Forward -288 -278 17.9746 0.00497
NP_440821.1_4 Reverse -275 -285 10.2065 0.0163
NP_440821.1_4 Forward -58 -48 2.24165 0.131
NP_441239.1_9 Reverse -275 -287 14.887 0.0247
NP_441239.1_9 Forward -58 -46 13.0187 0.0389
NP_441239.1_9 Forward -125 -113 7.11881 0.169
NP_441239.1_9 Reverse -45 -57 7.11881 0.169
NP_441239.1_9 Forward -288 -276 2.98891 0.3
NP_441951.1_4 Forward -292 -273 3.93269 0.273
NP_441727.1_3 Reverse -40 -59 3.93269 0.275
NP_441892.1_1 Reverse -38 -55 9.18362 0.0744
NP_441892.1_1 Forward -295 -278 -4.18939 0.256
NP_440604.1_6 Forward -56 -37 5.40766 0.117
NP_440604.1_6 Forward -286 -267 -5.9004 0.287
NP_442044.1_1 Forward -286 -267 -7.76869 0.23
NP_442044.1_1 Reverse -42 -61 -13.4719 0.277
NP_442270.1_9 Forward -297 -278 -12.2919 0.292
NP_441508.1_4 Reverse -213 -227 16.1498 0.227
NP_440833.1_6 Forward -325 -311 14.8469 0.146
NP_440833.1_6 Reverse -260 -274 9.73373 0.261
NP_440212.1_5 Forward -297 -278 16.7157 0.218
NP_440546.1_4 Reverse -47 -57 13.5365 0.0459
NP_440546.1_4 Forward -56 -46 10.046 0.109
NP_440546.1_4 Forward -286 -276 6.65249 0.288
NP_440462.1_6 Forward -58 -48 18.7612 0.00454
NP_440462.1_6 Reverse -275 -285 10.7964 0.0396
NP_440462.1_6 Forward -288 -278 10.3048 0.0396
NP_440462.1_6 Reverse -45 -55 10.3048 0.0396
NP_440462.1_6 Reverse -112 -122 4.3066 0.205
NP_442465.1_2 Forward -323 -304 2.75194 0.243
NP_442611.1_1 Reverse -277 -296 -2.26216 0.287
NP_440868.1_4 Forward -60 -48 17.0502 0.0124
NP_440868.1_4 Forward -290 -278 9.97041 0.0405
NP_440868.1_4 Reverse -43 -55 7.4138 0.0691
NP_440868.1_4 Reverse -273 -285 1.31728 0.186
NP_440868.1_4 Forward -341 -329 -0.452677 0.269
NP_442402.1_4 Forward -318 -299 -1.18128 0.189
NP_441848.1_7 Forward -315 -296 3.53858 0.217
NP_441084.1_6 Reverse -275 -289 9.24716 0.29
NP_440696.1_3 Forward -296 -278 4.44404 0.198
NP_440696.1_6 Forward -298 -279 7.86593 0.246
NP_441843.2_9 Forward -284 -266 12.8263 0.205
NP_442039.1_3 Reverse -206 -225 18.6823 0.107
NP_442039.1_4 Forward -285 -278 15.1821 0.0124
NP_442039.1_4 Reverse -278 -285 15.1821 0.0124
NP_442039.1_4 Forward -55 -48 15.1821 0.0124
NP_442039.1_4 Reverse -48 -55 15.1821 0.0124
NP_442039.1_4 Forward -248 -241 6.43063 0.285
NP_441811.1_8 Forward -292 -278 6.98109 0.259
NP_440825.1_6 Reverse -304 -323 11.3075 0.282
NP_442696.1_2 Forward -287 -269 15.5554 0.111
NP_442837.1_3 Forward -285 -278 15.7721 0.0124
NP_442837.1_3 Reverse -278 -285 15.7721 0.0124
NP_442837.1_3 Forward -55 -48 15.7721 0.0124
NP_442837.1_3 Reverse -48 -55 15.7721 0.0124
NP_439994.1_3 Reverse -276 -295 17.1207 0.0697
NP_442053.1_1 Forward -56 -47 18.3876 0.0007
NP_442053.1_1 Reverse -47 -56 18.3876 0.0007
NP_442053.1_1 Forward -286 -277 9.34117 0.0666
NP_442053.1_1 Reverse -277 -286 8.84951 0.072
NP_440505.1_3 Forward -58 -48 17.188 0.00332
NP_440505.1_3 Reverse -45 -55 16.598 0.00683
NP_440505.1_3 Forward -288 -278 16.598 0.00683
NP_440505.1_3 Reverse -275 -285 5.5849 0.222
NP_440505.1_3 Reverse -88 -98 4.50326 0.284
NP_441252.1_6 Reverse -311 -318 14.3954 0.168
NP_441203.1_1 Reverse -278 -297 7.27595 0.0238
NP_442532.1_7 Forward -286 -272 14.1593 0.0644
NP_440914.1_1 Forward -56 -46 17.5935 0.000537
NP_440914.1_1 Reverse -47 -57 16.3248 0.00196
NP_440914.1_1 Forward -286 -276 14.0802 0.0188
NP_440914.1_1 Reverse -277 -287 8.51751 0.186
NP_441011.1_8 Reverse -48 -57 16.6177 0.00602
NP_441011.1_8 Forward -285 -276 8.94785 0.141
NP_441011.1_8 Reverse -278 -287 8.25953 0.144
NP_441011.1_8 Forward -55 -46 8.25953 0.144
NP_442533.1_1 Reverse -298 -317 -16.7168 0.275
NP_442533.1_6 Forward -56 -47 17.2076 0.00137
NP_442533.1_6 Reverse -47 -56 17.2076 0.00137
NP_442533.1_6 Forward -286 -277 7.86621 0.0862
NP_442533.1_6 Reverse -277 -286 7.37455 0.0898
NP_442533.1_6 Forward -253 -244 3.24465 0.219
NP_442533.1_6 Reverse -322 -331 1.57302 0.294
NP_442232.1_3 Reverse -39 -58 -4.72043 0.163
NP_442322.1_9 Forward -315 -297 13.883 0.251
NP_443016.1_1 Reverse -41 -60 -5.80207 0.251
NP_441482.1_7 Forward -62 -48 6.58777 0.0271
NP_441482.1_7 Reverse -41 -55 -0.787057 0.0612
NP_441482.1_7 Reverse -108 -122 -10.6202 0.211
NP_439944.1_9 Forward -55 -45 19.1546 0.00329
NP_439944.1_9 Reverse -278 -288 19.1546 0.00329
NP_439944.1_9 Forward -285 -275 15.5163 0.0177
NP_439944.1_9 Reverse -48 -58 9.12481 0.1
NP_439944.1_9 Reverse -245 -255 5.28991 0.262
NP_442269.1_10 Reverse -58 -77 5.01433 0.24
NP_441028.1_6 Reverse -66 -76 10.1076 0.21
NP_441028.1_6 Forward -309 -299 5.68278 0.243
NP_440116.1_8 Reverse -278 -297 -0.983855 0.115
NP_440115.1_6 Reverse -44 -54 18.9579 0.0139
NP_440115.1_6 Forward -289 -279 17.9746 0.0163
NP_440115.1_6 Forward -59 -49 14.0414 0.0615
NP_440007.1_9 Forward -60 -46 6.98109 0.213
NP_440007.1_9 Forward -290 -276 2.2612 0.281
NP_440007.1_9 Reverse -43 -57 1.47456 0.285
NP_441680.1_4 Reverse -285 -304 -1.18052 0.259
NP_441059.1_2 Reverse -302 -321 -7.4737 0.291
NP_440608.1_6 Reverse -278 -297 4.12856 0.277
NP_441602.1_3 Forward -291 -272 4.32602 0.156
NP_441602.1_3 Reverse -272 -291 -0.0988766 0.219
NP_441602.1_3 Forward -118 -99 -4.52377 0.268
NP_441972.1_5 Reverse -278 -297 13.2741 0.0368
NP_441972.1_5 Forward -345 -326 -7.4737 0.249
NP_441106.1_1 Forward -57 -48 18.486 0.0028
NP_441106.1_1 Forward -287 -278 9.63616 0.0311
NP_441106.1_1 Reverse -46 -55 9.63616 0.0311
NP_441106.1_1 Reverse -276 -285 9.34117 0.0333
NP_441106.1_1 Reverse -113 -122 5.3096 0.162
NP_439903.1_6 Forward -59 -40 9.34008 0.124
NP_442306.1_10 Forward -61 -42 -9.83364 0.11
NP_440797.1_2 Reverse -36 -55 14.0308 0.217
NP_441286.1_1 Forward -57 -45 12.232 0.00999
NP_441286.1_1 Reverse -276 -288 10.9537 0.0145
NP_441286.1_1 Reverse -46 -58 5.93884 0.0258
NP_441286.1_1 Forward -287 -275 5.54551 0.0259
NP_441286.1_1 Reverse -89 -101 0.923956 0.102
NP_442674.1_3 Reverse -39 -58 3.24359 0.294
NP_440670.1_8 Forward -56 -47 18.3876 0.000699
NP_440670.1_8 Reverse -47 -56 18.3876 0.000699
NP_440670.1_8 Forward -286 -277 16.3227 0.00291
NP_440670.1_8 Reverse -277 -286 15.1427 0.00768
NP_440886.1_6 Forward -117 -98 16.7157 0.132
NP_440886.1_7 Forward -57 -47 8.04271 0.0805
NP_440886.1_7 Reverse -46 -56 7.94438 0.0805
NP_440886.1_7 Reverse -223 -233 3.22451 0.291
NP_440828.1_1 Reverse -279 -298 -0.0996487 0.269
NP_440828.1_4 Reverse -276 -295 4.91521 0.135
NP_442614.1_2 Reverse -47 -61 10.226 0.234
NP_439995.1_5 Reverse -267 -286 6.09597 0.276
NP_441399.1_10 Reverse -322 -341 12.6841 0.258
NP_442072.1_9 Forward -287 -269 -20.827 0.204
NP_442072.1_9 Forward -57 -39 -21.712 0.212
NP_442295.1_4 Forward -219 -200 17.9043 0.292
NP_441808.1_7 Reverse -269 -288 15.8307 0.125
NP_440907.2_8 Forward -285 -275 17.2858 0.00883
NP_440907.2_8 Forward -55 -45 10.8943 0.0969
NP_440907.2_8 Reverse -278 -288 10.8943 0.0969
NP_440907.2_8 Reverse -48 -58 9.616 0.103
NP_442264.1_2 Reverse -37 -54 5.64371 0.274
NP_441021.1_1 Reverse -278 -297 6.09597 0.0704
NP_440326.1_9 Reverse -149 -168 11.7 0.274
NP_441463.1_3 Reverse -37 -56 6.29264 0.0648
NP_441463.1_6 Forward -58 -44 10.088 0.242
NP_441626.1_2 Forward -285 -278 15.7721 0.0124
NP_441626.1_2 Reverse -278 -285 15.7721 0.0124
NP_441626.1_2 Forward -55 -48 15.7721 0.0124
NP_441626.1_2 Reverse -48 -55 15.7721 0.0124
NP_442365.1_7 Forward -290 -271 -0.000545616 0.177
NP_442365.1_7 Forward -60 -41 -0.885524 0.187
NP_442794.1_1 Reverse -43 -55 13.0187 0.0721
NP_442794.1_1 Forward -290 -278 3.48056 0.286
NP_442615.1_1 Forward -65 -47 4.34571 0.0472
NP_442615.1_1 Forward -295 -277 -2.83245 0.151
NP_442615.1_1 Reverse -268 -286 -4.99573 0.201
NP_441962.1_4 Forward -291 -272 5.40766 0.094
NP_441962.1_4 Forward -55 -36 -4.03212 0.156
NP_441962.1_4 Reverse -42 -61 -8.55534 0.203
NP_441962.1_4 Forward -61 -42 -14.0619 0.282
NP_440387.1_1 Forward -56 -40 15.2015 0.00558
NP_440387.1_1 Forward -286 -270 5.56507 0.0315
NP_440387.1_1 Reverse -277 -293 5.36841 0.0325
NP_440387.1_1 Reverse -47 -63 -4.46469 0.187
NP_441431.1_2 Forward -59 -45 12.487 0.116
NP_441431.1_2 Reverse -291 -305 6.68548 0.263
NP_441488.1_7 Reverse -340 -359 4.12936 0.197
NP_441488.1_7 Reverse -271 -290 0.491109 0.296
NP_441488.1_8 Forward -291 -277 11.5037 0.146
NP_441836.1_2 Forward -62 -43 9.14423 0.101
NP_441836.1_2 Reverse -271 -290 -2.0655 0.224
NP_441993.1_1 Reverse -41 -60 7.69667 0.16
NP_441174.1_2 Forward -289 -275 13.5693 0.196
NP_441174.1_4 Reverse -299 -309 15.713 0.238
NP_440114.1_10 Forward -286 -272 12.7826 0.0731
NP_440114.1_10 Reverse -47 -61 7.86607 0.223
NP_441817.1_7 Forward -230 -211 19.469 0.0897
NP_442323.1_7 Forward -291 -272 10.0284 0.156
NP_441510.2_7 Forward -343 -329 14.0603 0.28
NP_440766.1_4 Reverse -43 -57 7.76774 0.0871
NP_440766.1_4 Forward -290 -276 0.786239 0.268
NP_439988.1_7 Forward -284 -270 11.7987 0.292
NP_439988.1_7 Forward -344 -330 11.4053 0.299
NP_441237.1_9 Forward -55 -45 14.9263 0.0242
NP_441237.1_9 Reverse -278 -288 14.9263 0.0242
NP_442743.1_4 Reverse -278 -297 -4.81876 0.255
NP_441311.1_2 Reverse -271 -285 10.6187 0.294
NP_441246.1_1 Forward -278 -259 2.3594 0.202
NP_439910.1_2 Forward -131 -114 -14.2191 0.183
NP_442867.1_8 Forward -311 -292 9.63589 0.22
NP_440457.1_1 Forward -290 -278 7.21714 0.105
NP_440457.1_1 Reverse -43 -55 6.62715 0.116
NP_440457.1_1 Reverse -110 -122 4.75886 0.154
NP_440457.1_1 Forward -60 -48 0.628964 0.25
NP_440798.1_6 Reverse -278 -291 4.64084 0.144
NP_440798.1_6 Forward -285 -272 1.78924 0.197
NP_440801.1_8 Reverse -243 -262 -1.18052 0.275
NP_441984.1_3 Reverse -273 -291 9.0656 0.217
NP_441984.1_3 Forward -89 -71 5.03403 0.295
NP_442509.1_9 Forward -56 -46 8.14104 0.192
NP_442509.1_9 Reverse -47 -57 8.04271 0.192
YP_003858595.1_4 Forward -134 -115 4.32522 0.246
NP_442514.1_5 Forward -86 -67 4.71854 0.15
NP_442514.1_5 Reverse -287 -306 -5.70449 0.261
NP_440554.1_4 Reverse -48 -58 17.9746 0.0131
NP_440554.1_4 Forward -285 -275 16.6963 0.0189
NP_440554.1_4 Reverse -278 -288 6.37155 0.123
NP_440554.1_4 Forward -55 -45 6.37155 0.123
NP_440554.1_4 Forward -122 -112 3.91327 0.211
NP_441885.1_5 Forward -56 -46 20.9245 0.000538
NP_441885.1_5 Reverse -47 -57 11.3864 0.00668
NP_441885.1_5 Reverse -277 -287 11.0914 0.00874
NP_441885.1_5 Forward -286 -276 2.24165 0.0822
NP_442341.1_7 Forward -57 -43 9.93102 0.0692
NP_442341.1_7 Forward -124 -110 2.45787 0.256
NP_442341.1_7 Reverse -276 -290 1.67122 0.282
NP_442341.1_9 Forward -58 -44 13.2736 0.0858
NP_441756.1_5 Forward -303 -284 5.30933 0.187
NP_441756.1_5 Reverse -285 -304 5.30933 0.187
NP_441756.1_5 Forward -304 -285 3.34271 0.2
NP_441756.1_5 Reverse -43 -62 1.96607 0.213
NP_441173.1_9 Forward -163 -155 12.9004 0.206
NP_442395.2_4 Forward -57 -38 13.175 0.0711
NP_442534.1_7 Forward -294 -275 8.94757 0.227
NP_440409.1_1 Reverse -269 -288 3.34271 0.18
NP_443000.1_7 Forward -58 -48 20.3345 0.00223
NP_443000.1_7 Forward -288 -278 10.4031 0.0345
NP_443000.1_7 Reverse -45 -55 10.4031 0.0345
NP_443000.1_7 Forward -367 -357 4.50326 0.188
NP_443000.1_7 Reverse -275 -285 1.74999 0.229
NP_440507.2_3 Reverse -38 -57 10.4217 0.208
NP_440727.1_2 Forward -261 -242 3.04771 0.288
NP_441842.1_1 Reverse -279 -292 15.9483 0.0521
NP_441842.1_10 Forward -293 -279 17.7975 0.0203
NP_440275.1_3 Reverse -275 -285 18.7612 0.0082
NP_440275.1_3 Forward -288 -278 17.6796 0.0102
NP_440275.1_3 Reverse -45 -55 17.6796 0.0102
NP_440275.1_3 Forward -58 -48 16.1063 0.0155
NP_440091.1_1 Forward -290 -278 8.29878 0.0653
NP_440091.1_1 Reverse -43 -55 1.41561 0.197
NP_440679.1_10 Forward -344 -325 -14.5535 0.24
NP_443010.1_10 Reverse -87 -104 6.53951 0.182
NP_442451.1_2 Forward -64 -45 -7.17871 0.232
NP_442451.1_2 Forward -294 -275 -10.817 0.28
NP_439962.1_4 Forward -294 -275 -0.983855 0.206
NP_441105.1_3 Reverse -36 -55 13.9625 0.0261
NP_440216.1_1 Reverse -47 -61 7.37441 0.00942
NP_440216.1_1 Forward -286 -272 -2.75368 0.0574
NP_440216.1_1 Reverse -277 -291 -9.44018 0.145
NP_440216.1_1 Forward -56 -42 -10.4235 0.145
NP_440216.1_9 Forward -77 -68 11.6028 0.254
NP_440216.1_9 Forward -76 -67 7.27622 0.286
NP_440172.1_1 Reverse -47 -57 17.5813 0.00421
NP_440172.1_1 Forward -56 -46 15.0247 0.00945
NP_440172.1_1 Forward -286 -276 10.9931 0.0445
NP_440172.1_1 Reverse -277 -287 5.19158 0.149
NP_442371.1_1 Forward -41 -31 14.3359 0.191
NP_442371.1_1 Forward -75 -65 14.0409 0.191
NP_440167.1_3 Forward -296 -277 12.2908 0.199
NP_442015.1_10 Reverse -43 -56 12.2123 0.0372
NP_442015.1_10 Forward -60 -47 3.65753 0.178
NP_442015.1_10 Forward -290 -277 2.87088 0.187
NP_442015.1_10 Forward -303 -290 -0.177378 0.255
NP_442015.1_10 Reverse -110 -123 -0.37404 0.264
NP_441226.1_7 Forward -285 -278 14.4934 0.0123
NP_441226.1_7 Reverse -278 -285 14.4934 0.0123
NP_441226.1_7 Forward -55 -48 14.4934 0.0123
NP_441226.1_7 Reverse -48 -55 14.4934 0.0123
NP_440198.1_2 Forward -214 -195 14.6176 0.276
NP_441111.1_7 Forward -55 -47 18.7023 0.00294
NP_441111.1_7 Reverse -278 -286 18.7023 0.00294
NP_441111.1_7 Reverse -48 -56 18.7023 0.00294
NP_441111.1_7 Forward -285 -277 8.96754 0.0463
NP_442379.1_10 Reverse -40 -57 7.80699 0.102
NP_442379.1_10 Forward -293 -276 -3.40274 0.259
NP_441766.1_2 Forward -56 -47 17.5026 0.00297
NP_441766.1_2 Reverse -47 -56 17.5026 0.00297
NP_441766.1_2 Reverse -277 -286 16.2243 0.0047
NP_441766.1_2 Forward -286 -277 9.14451 0.0337
NP_440416.1_9 Reverse -40 -59 -5.21209 0.0791
NP_440416.1_9 Reverse -282 -301 -13.8652 0.171
NP_440416.1_9 Reverse -327 -346 -19.3717 0.274
NP_440416.1_9 Forward -305 -286 -21.535 0.295
NP_443052.1_8 Forward -296 -277 -1.18052 0.0784
NP_443052.1_8 Reverse -267 -286 -2.26216 0.0885
NP_443052.1_9 Forward -254 -235 -5.70374 0.273
NP_440591.1_9 Reverse -40 -58 21.652 0.0158
NP_442154.1_1 Reverse -335 -353 -15.8121 0.225
NP_440261.1_5 Reverse -48 -61 14.2773 0.022
NP_440261.1_5 Reverse -278 -291 6.80412 0.0316
NP_440261.1_5 Forward -55 -42 -1.06236 0.0655
NP_440261.1_5 Forward -285 -272 -1.35735 0.0733
NP_440988.1_10 Forward -52 -38 6.06058 0.234
NP_440988.1_10 Reverse -45 -59 5.67333 0.24
NP_440988.1_10 Reverse -281 -295 3.34982 0.296
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTAATCAGTTAATTACCAGGGTTTTAGAAAATCAAGCATTCACGGTCCAACCCCTCAATGACCGCAATGGGGCCCGACAAATTGCCCAACTTTCTCCCCCTGGGGTGCCCGGTGGCGATCGCATCAAGGTCAAATTTTGGGTAGATGACCAGCGCTACCTGCGTCTGACGGTGGAGGATTTGTTGCAGCAAAAGCTGTTACTGGAAAATCAAGTGGTAGCCCAGTTGCGTTAGTTTTTCTACCAAAAAGAATATTTACCGGGAAGTATTAATTAACTTCCATCGCCGGGGATTAGTGGAGCACGATCCTCATCAATACCTTGCCCAGGGAAAAATTCATTCCAGGCGATCGCCACGGTCAGGATAAAATGTTCTACCCGAAGTCGAGGCCAATTTTTTT

CDS

ATGATCACCACCGATGTTGTCATTATTGGGGCGGGGCACAATGGCTTAGTCTGTGCAGCCTATTTGCTCCAACGGGGCTTGGGGGTGACGTTACTAGAAAAGCGGGAAGTACCAGGGGGGGCGGCCACCACAGAAGCTCTCATGCCGGAGCTATCCCCCCAGTTTCGCTTTAACCGCTGTGCCATTGACCACGAATTTATCTTTCTGGGGCCGGTGTTGCAGGAGCTAAATTTAGCCCAGTATGGTTTGGAATATTTATTTTGTGACCCCAGTGTTTTTTGTCCGGGGCTGGATGGCCAAGCTTTTATGAGCTACCGTTCCCTAGAAAAAACCTGTGCCCACATTGCCACCTATAGCCCCCGAGATGCGGAAAAATATCGGCAATTTGTCAATTATTGGACGGATTTGCTCAACGCTGTCCAGCCTGCTTTTAATGCTCCGCCCCAGGCTTTACTAGATTTAGCCCTGAACTATGGTTGGGAAAACTTAAAATCCGTGCTGGCGATCGCCGGGTCGAAAACCAAGGCGTTGGATTTTATCCGCACTATGATCGGCTCCCCGGAAGATGTGCTCAATGAATGGTTCGACAGCGAACGGGTTAAAGCTCCTTTAGCTAGACTATGTTCGGAAATTGGCGCTCCCCCATCCCAAAAGGGTAGTAGCTCCGGCATGATGATGGTGGCCATGCGGCATTTGGAGGGAATTGCCAGACCAAAAGGAGGCACTGGAGCCCTCACAGAAGCCTTGGTGAAGTTAGTGCAAGCCCAAGGGGGAAAAATCCTCACTGACCAAACCGTCAAACGGGTATTGGTGGAAAACAACCAGGCGATCGGGGTGGAGGTAGCTAACGGAGAACAGTACCGGGCCAAAAAAGGCGTGATTTCTAACATCGATGCCCGCCGTTTATTTTTGCAATTGGTGGAACCGGGGGCCCTAGCCAAGGTGAATCAAAACCTAGGGGAACGACTGGAACGGCGCACTGTGAACAATAACGAAGCCATTTTAAAAATCGATTGTGCCCTCTCCGGTTTACCCCACTTCACTGCCATGGCCGGGCCGGAGGATCTAACGGGAACTATTTTGATTGCCGACTCGGTACGCCATGTCGAGGAAGCCCACGCCCTCATTGCCTTGGGGCAAATTCCCGATGCTAATCCGTCTTTATATTTGGATATTCCCACTGTATTGGACCCCACCATGGCCCCCCCTGGGCAGCACACCCTCTGGATCGAATTTTTTGCCCCCTACCGCATCGCCGGGTTGGAAGGGACAGGGTTAATGGGCACAGGTTGGACCGATGAGTTAAAGGAAAAAGTGGCGGATCGGGTGATTGATAAATTAACGGACTATGCCCCTAACCTAAAATCTCTGATCATTGGTCGCCGAGTGGAAAGTCCCGCCGAACTGGCCCAACGGCTGGGAAGTTACAACGGCAATGTCTATCATCTGGATATGAGTTTGGACCAAATGATGTTCCTCCGGCCTCTACCGGAAATTGCCAACTACCAAACCCCCATCAAAAATCTTTACTTAACAGGGGCGGGTACCCATCCCGGTGGCTCCATATCAGGTATGCCCGGTAGAAATTGCGCTCGGGTCTTTTTAAAACAACAACGTCGTTTTTGGTAA

Protein

MITTDVVIIGAGHNGLVCAAYLLQRGLGVTLLEKREVPGGAATTEALMPELSPQFRFNRCAIDHEFIFLGPVLQELNLAQYGLEYLFCDPSVFCPGLDGQAFMSYRSLEKTCAHIATYSPRDAEKYRQFVNYWTDLLNAVQPAFNAPPQALLDLALNYGWENLKSVLAIAGSKTKALDFIRTMIGSPEDVLNEWFDSERVKAPLARLCSEIGAPPSQKGSSSGMMMVAMRHLEGIARPKGGTGALTEALVKLVQAQGGKILTDQTVKRVLVENNQAIGVEVANGEQYRAKKGVISNIDARRLFLQLVEPGALAKVNQNLGERLERRTVNNNEAILKIDCALSGLPHFTAMAGPEDLTGTILIADSVRHVEEAHALIALGQIPDANPSLYLDIPTVLDPTMAPPGQHTLWIEFFAPYRIAGLEGTGLMGTGWTDELKEKVADRVIDKLTDYAPNLKSLIIGRRVESPAELAQRLGSYNGNVYHLDMSLDQMMFLRPLPEIANYQTPIKNLYLTGAGTHPGGSISGMPGRNCARVFLKQQRRFW