Your browser is old and dusty. Try Google Chrome!

Details for slr0082

ORF slr0082
Accession NP_442485.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_1 Reverse -349 -368 9.88299 0.218
NP_442291.1_5 Forward -123 -107 1.92682 0.136
NP_442272.1_2 Reverse -341 -360 9.69201 0.286
NP_441453.1_4 Reverse -380 -388 5.23096 0.157
NP_441098.1_3 Reverse -349 -368 -4.30066 0.28
NP_440996.1_5 Reverse -347 -356 15.4627 0.195
NP_442287.1_5 Reverse -106 -116 15.5163 0.218
NP_442752.1_4 Reverse -113 -120 5.84064 0.166
NP_439997.1_4 Forward -312 -293 7.17762 0.266
NP_440061.1_9 Reverse -385 -399 8.55376 0.17
NP_440304.1_4 Forward -269 -259 3.02829 0.299
NP_441781.1_7 Forward -123 -104 2.85105 0.199
NP_441581.1_9 Reverse -270 -289 5.49036 0.296
NP_439918.1_2 Forward -395 -376 -4.13045 0.268
NP_439918.1_3 Forward -392 -373 7.96426 0.252
NP_441935.1_1 Reverse -114 -133 7.96426 0.24
NP_440893.1_6 Forward -120 -101 14.1583 0.242
NP_442742.1_9 Reverse -158 -177 -11.2103 0.269
NP_441083.1_5 Forward -116 -106 3.12662 0.182
NP_441738.1_2 Forward -120 -113 8.20023 0.181
NP_440209.1_1 Forward -389 -381 5.0343 0.194
NP_442889.1_1 Forward -89 -70 -15.4385 0.292
NP_441770.1_5 Forward -310 -291 -1.08219 0.261
NP_440178.1_7 Forward -396 -377 -22.0267 0.249
NP_439953.1_2 Forward -259 -241 5.91901 0.294
NP_441792.1_5 Reverse -375 -391 8.31834 0.276
NP_441716.1_2 Forward -365 -346 2.87713 0.234
NP_441716.1_2 Reverse -350 -369 1.44157 0.254
NP_441163.1_1 Reverse -236 -253 7.80625 0.236
NP_440906.1_5 Reverse -381 -388 8.20058 0.19
NP_442760.1_7 Reverse -72 -91 22.9106 0.00853
NP_440842.1_4 Forward -158 -139 0.267101 0.279
NP_442848.1_1 Reverse -380 -394 -3.63866 0.268
NP_443018.1_3 Reverse -315 -322 5.34899 0.212
NP_441588.1_4 Reverse -382 -392 6.76487 0.185
NP_442485.1_5 Forward -160 -141 27.358 0.00261
NP_441553.1_4 Forward -373 -355 15.3762 0.283
NP_442782.1_2 Forward -389 -375 7.37441 0.202
NP_443061.1_4 Forward -127 -108 1.47442 0.279
NP_442937.1_5 Forward -91 -72 6.19431 0.286
NP_442321.1_4 Forward -262 -243 -7.96535 0.284
NP_441097.1_2 Reverse -46 -63 7.80699 0.238
NP_442690.1_1 Forward -368 -349 -9.44032 0.197
NP_440153.1_8 Reverse -386 -399 -3.52063 0.295
NP_442064.1_4 Reverse -370 -389 5.80018 0.264
NP_440602.1_2 Forward -88 -69 0.982764 0.273
NP_441654.1_5 Forward -303 -284 14.7055 0.252
NP_441712.1_1 Reverse -284 -303 9.61754 0.289
NP_441294.1_7 Forward -126 -112 10.5945 0.181
NP_440411.1_10 Forward -397 -378 8.70022 0.293
NP_441550.1_7 Reverse -357 -376 16.0881 0.241
NP_440345.1_5 Forward -360 -346 15.5754 0.263
NP_440703.1_9 Reverse -387 -400 8.86849 0.226
NP_440983.1_5 Reverse -380 -399 -4.81876 0.261
NP_439983.1_7 Forward -307 -289 14.2771 0.198
NP_442215.1_2 Reverse -241 -257 -3.48138 0.216
NP_442933.1_10 Forward -389 -380 4.12963 0.28
NP_442970.1_3 Reverse -135 -153 15.0309 0.168
NP_442970.1_3 Forward -365 -347 13.9015 0.192
NP_441298.1_3 Forward -369 -359 16.4459 0.232
NP_441020.2_6 Forward -399 -382 7.217 0.237
NP_441876.1_9 Forward -69 -59 11.5826 0.275
NP_441393.1_2 Reverse -110 -129 22.2956 0.0767
NP_441637.1_9 Forward -303 -285 -1.25915 0.292
NP_442719.1_2 Forward -132 -114 0.411736 0.162
NP_441911.1_7 Forward -305 -286 -19.0774 0.275
NP_440869.1_6 Forward -363 -344 2.94938 0.245
NP_441906.1_2 Reverse -61 -80 0.195343 0.3
NP_442542.1_2 Forward -397 -384 8.47575 0.154
NP_441114.1_3 Reverse -75 -84 6.39124 0.277
NP_440558.1_2 Forward -256 -237 -2.36049 0.226
NP_441878.1_6 Forward -396 -386 -6.8048 0.196
NP_441534.1_5 Reverse -78 -97 3.14605 0.293
NP_441557.1_5 Forward -389 -380 -0.983583 0.272
NP_441557.1_8 Forward -115 -105 12.6642 0.236
NP_441433.1_8 Reverse -309 -328 -2.55715 0.27
NP_440101.1_10 Forward -395 -376 5.99764 0.203
NP_441458.1_8 Forward -374 -355 24.6857 0.00791
NP_441458.1_8 Reverse -354 -373 3.73377 0.273
NP_442830.1_5 Forward -124 -110 4.42388 0.239
NP_442397.1_9 Reverse -380 -399 5.211 0.247
NP_442397.1_9 Reverse -258 -277 3.24438 0.264
NP_441819.1_5 Reverse -285 -304 10.4559 0.261
NP_441819.1_5 Forward -368 -349 10.3605 0.261
NP_441819.1_5 Forward -385 -366 8.73709 0.293
NP_440276.1_8 Forward -393 -374 7.27595 0.274
NP_441467.1_10 Forward -82 -68 4.91614 0.3
NP_442347.1_2 Forward -121 -112 4.0313 0.284
NP_442594.1_8 Reverse -105 -124 11.2092 0.167
NP_442998.1_5 Forward -168 -158 10.8948 0.201
NP_442998.1_10 Reverse -382 -389 12.5271 0.0457
NP_440299.1_1 Forward -393 -380 9.65513 0.0681
NP_440299.1_1 Forward -130 -117 5.62358 0.169
NP_440299.1_1 Reverse -376 -389 4.05029 0.221
NP_440299.1_1 Reverse -382 -395 3.06699 0.261
NP_441362.1_1 Reverse -339 -358 15.2408 0.182
NP_442283.1_7 Reverse -318 -337 15.2408 0.255
NP_441559.1_8 Forward -127 -113 -5.60527 0.267
NP_442158.1_4 Forward -261 -251 14.238 0.193
NP_442069.1_8 Forward -326 -307 21.3373 0.0259
NP_441464.1_8 Reverse -120 -134 6.29277 0.241
NP_440570.1_5 Reverse -376 -395 -3.63879 0.291
NP_441750.1_1 Reverse -109 -128 -6.88371 0.244
NP_441750.1_4 Forward -64 -45 1.27776 0.286
NP_439976.1_4 Reverse -206 -225 5.80018 0.278
NP_442506.1_10 Forward -120 -101 18.7798 0.236
NP_440161.1_3 Forward -85 -66 7.57094 0.295
NP_442714.1_7 Forward -305 -286 -2.0655 0.292
NP_440192.1_4 Forward -308 -289 8.62144 0.292
NP_440684.1_9 Forward -92 -78 16.9125 0.0681
NP_440684.1_9 Forward -395 -381 7.17775 0.275
NP_440027.1_8 Forward -125 -106 11.7983 0.217
NP_440408.1_6 Forward -400 -382 17.9154 0.14
NP_440439.1_1 Reverse -110 -123 0.117615 0.202
NP_442887.1_5 Reverse -291 -310 -10.6203 0.264
NP_442384.1_10 Reverse -380 -393 4.73917 0.148
NP_442384.1_10 Forward -122 -109 2.87088 0.21
NP_442384.1_10 Reverse -387 -400 2.18257 0.235
NP_442035.1_7 Forward -266 -247 16.0795 0.276
NP_441018.1_7 Forward -393 -374 11.3075 0.188
NP_442262.1_10 Reverse -315 -322 7.6106 0.274
NP_441898.1_1 Reverse -107 -126 13.3725 0.299
NP_442067.1_3 Forward -310 -291 16.7157 0.224
NP_440888.1_2 Forward -122 -108 12.9786 0.0354
NP_440600.1_4 Reverse -372 -390 -7.35568 0.291
NP_441543.1_2 Reverse -381 -390 4.12963 0.279
NP_442845.1_2 Reverse -107 -121 8.55439 0.193
NP_442637.1_3 Forward -397 -378 11.3075 0.145
NP_441462.1_2 Forward -389 -379 -0.0199663 0.177
NP_442780.1_3 Forward -97 -78 9.11906 0.248
NP_440516.1_6 Forward -332 -318 16.4202 0.186
NP_440673.1_3 Forward -81 -74 6.72562 0.277
NP_442219.1_9 Forward -121 -112 2.06468 0.289
NP_440436.1_4 Reverse -381 -390 4.42421 0.265
NP_440314.1_9 Reverse -381 -400 -4.13045 0.201
NP_442907.1_9 Reverse -375 -394 -0.197208 0.222
NP_441004.1_1 Reverse -317 -336 -0.787193 0.124
NP_441004.1_1 Forward -395 -376 -13.5702 0.259
NP_441004.1_5 Forward -318 -304 8.16106 0.276
NP_442366.1_5 Forward -392 -382 11.5826 0.177
NP_439949.1_7 Forward -309 -295 10.9143 0.291
NP_442206.1_10 Forward -389 -374 2.33984 0.202
NP_441195.1_1 Reverse -312 -331 -0.0988766 0.183
NP_441982.1_6 Reverse -292 -301 11.5304 0.288
NP_441349.1_10 Reverse -103 -122 -6.68705 0.235
NP_440874.1_2 Forward -364 -345 13.1515 0.161
NP_441409.1_6 Forward -89 -70 -11.0136 0.215
NP_442843.1_1 Forward -313 -294 -7.76869 0.252
NP_442843.1_1 Forward -322 -303 -8.45701 0.255
NP_439960.1_4 Forward -390 -371 11.995 0.295
NP_441124.1_5 Forward -97 -87 11.4803 0.254
NP_440431.1_4 Reverse -345 -364 -7.974 0.275
NP_441975.1_5 Reverse -341 -360 20.7442 0.0715
NP_442006.1_2 Reverse -314 -331 -18.5457 0.292
NP_441570.1_1 Forward -389 -371 -16.6971 0.252
NP_441078.1_4 Forward -389 -380 -1.57357 0.266
NP_442348.1_2 Forward -306 -297 14.7494 0.146
NP_442348.1_2 Forward -253 -244 13.5694 0.179
NP_442348.1_2 Forward -307 -298 7.57121 0.28
NP_441432.1_8 Forward -390 -381 5.89959 0.13
NP_441432.1_9 Forward -271 -258 13.6401 0.165
NP_441432.1_9 Forward -300 -287 8.30749 0.29
NP_441732.1_2 Reverse -376 -392 -8.20127 0.124
NP_440629.1_1 Reverse -343 -361 1.59244 0.256
NP_440760.1_1 Reverse -380 -399 -13.8652 0.115
NP_440713.1_3 Reverse -69 -88 4.03102 0.278
NP_440559.1_1 Reverse -381 -390 4.42462 0.277
NP_442346.1_5 Forward -390 -380 11.0914 0.0764
NP_442346.1_5 Reverse -73 -83 8.04317 0.149
NP_442934.1_1 Forward -49 -30 12.7825 0.266
NP_442551.1_4 Forward -255 -240 -0.905081 0.245
NP_440847.1_6 Reverse -74 -93 17.5024 0.229
NP_441050.1_5 Forward -225 -207 -3.02911 0.286
NP_441329.1_6 Reverse -284 -303 -1.19407 0.291
NP_441895.1_10 Forward -321 -302 -27.6315 0.282
NP_442943.1_1 Reverse -148 -163 3.96695 0.245
NP_442021.1_3 Forward -395 -376 32.3503 0.000121
NP_442028.1_1 Forward -358 -345 15.8179 0.251
NP_441774.1_1 Reverse -56 -75 9.3409 0.25
NP_440590.1_4 Reverse -381 -394 5.03416 0.0585
NP_440227.1_2 Reverse -365 -381 13.8249 0.271
NP_442568.1_8 Reverse -287 -301 7.66941 0.296
NP_440604.1_6 Forward -389 -370 4.12936 0.131
NP_441541.1_1 Forward -370 -352 3.91715 0.175
NP_440833.1_6 Reverse -295 -309 7.27547 0.282
NP_442216.1_4 Reverse -299 -307 8.1805 0.255
NP_440212.1_9 Reverse -355 -374 2.96396 0.235
NP_440949.1_7 Forward -198 -179 9.7334 0.258
NP_440546.1_4 Forward -389 -379 9.94905 0.112
NP_440868.1_4 Forward -47 -35 -0.551008 0.274
NP_442499.1_1 Reverse -381 -400 3.34271 0.257
NP_441084.1_6 Reverse -378 -392 9.63499 0.273
NP_439942.1_2 Reverse -80 -99 15.8027 0.228
NP_442679.1_2 Reverse -319 -338 7.86593 0.258
NP_440505.1_3 Reverse -111 -121 4.50326 0.284
NP_441959.1_8 Forward -369 -356 7.93804 0.299
NP_441700.1_1 Reverse -375 -394 19.7631 0.148
NP_441408.2_7 Reverse -378 -397 5.89931 0.172
NP_441011.1_8 Forward -388 -379 5.40793 0.263
NP_440661.1_6 Reverse -112 -131 5.11266 0.231
NP_442535.1_2 Reverse -78 -97 6.88262 0.253
NP_441482.1_7 Reverse -374 -388 -3.54032 0.129
NP_439944.1_9 Forward -388 -378 11.2881 0.0887
NP_439944.1_9 Forward -394 -384 9.7148 0.1
NP_441697.1_5 Reverse -347 -366 -1.38506 0.206
NP_441697.1_5 Forward -374 -355 -5.30023 0.226
NP_441697.1_5 Reverse -345 -364 -10.1703 0.278
NP_440816.1_2 Reverse -283 -302 14.0832 0.157
NP_441028.1_6 Forward -301 -291 7.15773 0.23
NP_442202.1_6 Reverse -287 -306 -1.47551 0.274
NP_440116.1_5 Forward -392 -375 6.13536 0.17
NP_441527.1_4 Reverse -345 -364 -1.48055 0.148
NP_441527.1_4 Reverse -347 -366 -6.35064 0.217
NP_441527.1_4 Reverse -344 -363 -9.50187 0.259
NP_440007.1_9 Reverse -103 -117 1.37622 0.285
NP_441106.1_1 Reverse -379 -388 4.71961 0.21
NP_439903.1_6 Reverse -377 -396 11.405 0.095
NP_441385.1_1 Forward -314 -299 14.3362 0.28
NP_442072.1_9 Forward -397 -379 -14.3372 0.142
NP_442459.1_7 Forward -305 -286 3.53937 0.226
NP_441463.1_2 Forward -362 -344 11.0388 0.138
NP_442794.1_1 Forward -393 -381 6.72548 0.163
NP_440387.1_1 Reverse -380 -396 2.91013 0.0693
NP_441836.1_2 Forward -89 -70 -6.49039 0.298
NP_441140.1_7 Reverse -233 -251 21.7503 0.0604
NP_442087.1_7 Forward -365 -346 -3.54122 0.285
NP_440293.1_3 Reverse -100 -119 -3.83545 0.254
NP_441421.1_6 Reverse -343 -360 17.8136 0.197
NP_440422.1_10 Forward -305 -286 5.75726 0.263
NP_442835.1_1 Forward -158 -139 14.3558 0.146
NP_440643.1_6 Reverse -375 -394 18.1907 0.0436
NP_442930.1_1 Reverse -362 -372 11.1893 0.26
NP_440457.1_1 Reverse -109 -121 1.7106 0.227
NP_440801.1_8 Reverse -379 -398 1.17943 0.246
NP_441436.1_2 Reverse -110 -129 -0.295539 0.277
NP_440660.1_7 Reverse -112 -131 5.40766 0.106
NP_442862.1_3 Forward -83 -66 12.2319 0.189
NP_441845.1_5 Reverse -269 -288 15.7741 0.268
NP_441885.1_5 Forward -389 -379 -0.708283 0.222
NP_441885.1_5 Forward -395 -385 -0.904945 0.241
NP_440191.1_6 Forward -366 -352 16.1498 0.294
NP_440750.1_5 Reverse -347 -361 5.1128 0.294
NP_443059.1_10 Reverse -372 -391 1.37531 0.245
NP_440167.1_3 Reverse -113 -132 8.16093 0.281
NP_441226.1_7 Forward -115 -108 6.52862 0.253
NP_440305.1_1 Reverse -347 -361 14.9084 0.187
NP_443052.1_8 Reverse -67 -86 -7.67036 0.162
NP_440072.1_5 Reverse -323 -341 -4.20908 0.296
NP_442116.1_6 Reverse -366 -383 12.3706 0.176
NP_442403.1_8 Forward -257 -238 -2.0655 0.263
NP_440261.1_5 Reverse -387 -400 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCGGGGCTTTGGCTATCGTTTTGGTTAGAAAATTATTATTTATTTAAACTTTTTTGCTCAGAACCTCCTCCATTTCCTCAATGGGACTAATGGGGGAATTTTTCGCCATATTTCTATCTATTGCTGGATTAAGGCGACTTTTCTGTGGGCATTTTCAACGTCAGAGTAGGAGAATATTGGGAGTAATGTCAGGAAATGTATAACATTACACCAAACGACCTCAGGTTTTCTGGTGTAAATCTGTTACAATGTCTTTACAAATAAAAAGGGTCTGACCACCGTTCCCCATCCGCAGGCTGTATTTACAGAATTTGCTGATCATTGCCTGGTTTAGTCCCTACCCTACATCCCTTGGACTCGAACTCAGTCAATAGTCAGTTAATCCCTAGTAATTAATTT

CDS

ATGGGCCAAACGCCAACGATCGCCATCAACCATTTGGGTTGCGAAAAAAACCGCATTGATTCTGAACATATGTTAGGCCTGCTGGTGGAAGCGGGTTACCAAGTCGATGCCAATGAAGAATTAGCAGATTACGTCATTGTTAATACCTGTAGTTTTATCCAGGATGCTCGCCAGGAGTCGGTGAGAACCTTAGTAGAACTAGCGGAAGCAAAGAAGAAAATCGTTATTTCCGGTTGCCTGGCCCAGCATTTCCAGGAGCAACTTTTAGAAGAAATTCCCGAAGCGGTGGCCGTGGTGGGCACCGGGGATTACCAAAATATTGTTGATATTATTCGACGCACGGAACAGGGTCAGCGAGTTAAAGCCATTTCCCCCAATCCCAGTTTCATAGCCGACGAAAATTTGCCACGTTATCGCACCACCAACGAGGCGATCGCCTATCTGCGGGTGGCGGAAGGCTGTGATTATCGCTGTGCTTTTTGCATCATCCCTCAACTACGGGGCAAACAACGGTCTCGCCCGATTGAATCTATTGTGGCGGAAGCCGAACAACTGGCTAGCCAAGGGGTAAAGGAATTAATTCTCATCTCCCAAATCACCACCAATTATGGATTGGATCTGTATGGGGAGCCGAAACTGGCAGAACTATTACAGGCCCTGGGTAAAGTCGATATTCCTTGGATTCGTATTCACTACGCCTATCCCACCGGATTGACCCCCAAAGTAATTGAGGCAATTCGGGATACTCCCAACGTCCTCCCCTATTTGGATTTACCCCTGCAACATTCCCATCCCGACATTCTCAGAGCCATGAATCGCCCCTGGCAGGGCCAAGTCAACGACGACATCATCACTAGACTAAAAACTGCCCTTCCCGACGCTGTGCTACGTACCACCTTCATTGTTGGTTTTCCTGGGGAAACCGAGGAACATTTTGGGCATTTGCTAGACTTTGTCCAACGCCATCAATTTGACCATGTGGGAGTGTTTACTTTTTCCCCAGAGGAAGGCACCGCCGCCTTTGATCTGCCCAATGCTGTGCCCGAAGAAGTAATGGGCGATCGCCGGGATCGGTTAATGGCTCTGCAACAGCCCATTTCCGCCCAGAAAAATGCCGCTTGTTTGGGGCAGACCCTGGATGTGCTGATCGAGCAGGAAAATCCCAGCACTGGGGAATTCATCGGCCGATCAACCCGCTTTGCTCCAGAGGTGGACGGATTAGTCTATGTCAAGGGCAATGCCAATTTGAATGAAATCGTCCCGGTCGTGATCACTGCCACCGACGATTATGACCTGTACGGTATGACCGCCGAGGAGGCTAAGGTTTTTTAG

Protein

MGQTPTIAINHLGCEKNRIDSEHMLGLLVEAGYQVDANEELADYVIVNTCSFIQDARQESVRTLVELAEAKKKIVISGCLAQHFQEQLLEEIPEAVAVVGTGDYQNIVDIIRRTEQGQRVKAISPNPSFIADENLPRYRTTNEAIAYLRVAEGCDYRCAFCIIPQLRGKQRSRPIESIVAEAEQLASQGVKELILISQITTNYGLDLYGEPKLAELLQALGKVDIPWIRIHYAYPTGLTPKVIEAIRDTPNVLPYLDLPLQHSHPDILRAMNRPWQGQVNDDIITRLKTALPDAVLRTTFIVGFPGETEEHFGHLLDFVQRHQFDHVGVFTFSPEEGTAAFDLPNAVPEEVMGDRRDRLMALQQPISAQKNAACLGQTLDVLIEQENPSTGEFIGRSTRFAPEVDGLVYVKGNANLNEIVPVVITATDDYDLYGMTAEEAKVF