Your browser is old and dusty. Try Google Chrome!

Details for slr0081

ORF slr0081
Accession NP_442484.1
Symbol sphR
Category two-component response regulator OmpR subfamily
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -206 -192 11.8976 0.23
NP_440795.1_7 Forward -253 -246 14.6904 0.0123
NP_440795.1_7 Reverse -246 -253 14.6904 0.0123
NP_440795.1_7 Forward -242 -235 10.2655 0.154
NP_441418.1_6 Reverse -245 -264 -12.8819 0.0712
NP_440897.1_6 Forward -281 -262 -3.24622 0.237
NP_441453.1_4 Reverse -245 -253 16.539 0.00633
NP_441453.1_4 Forward -254 -246 7.8859 0.0536
NP_441453.1_4 Reverse -234 -242 4.05099 0.268
NP_441623.1_1 Forward -55 -37 -5.29072 0.288
NP_442151.1_6 Forward -254 -240 10.1277 0.13
NP_442838.1_7 Reverse -240 -259 -10.522 0.232
NP_440226.1_1 Forward -254 -235 2.65439 0.256
NP_440226.1_1 Reverse -245 -264 2.0644 0.278
NP_441465.1_8 Forward -383 -365 5.91901 0.281
NP_440931.1_3 Reverse -176 -195 13.2741 0.251
NP_442173.1_1 Forward -253 -245 15.4574 0.00633
NP_442173.1_1 Reverse -246 -254 14.1791 0.0165
NP_442752.1_4 Reverse -245 -252 13.8055 0.0199
NP_443027.1_4 Forward -256 -246 7.45319 0.24
NP_443027.1_4 Reverse -243 -253 7.25653 0.24
NP_439997.1_6 Reverse -348 -367 13.7658 0.177
NP_441812.1_1 Forward -369 -355 12.6836 0.247
NP_440784.1_7 Forward -253 -246 15.9687 0.0123
NP_440784.1_7 Reverse -246 -253 15.9687 0.0123
NP_442861.1_4 Reverse -352 -371 0.785326 0.297
NP_440061.1_9 Reverse -243 -257 9.6354 0.143
NP_440110.1_4 Reverse -234 -253 10.1275 0.121
NP_440110.1_8 Forward -256 -237 9.43923 0.0906
NP_442062.1_8 Reverse -245 -255 16.9913 0.00317
NP_442062.1_8 Reverse -234 -244 4.20827 0.228
NP_442062.1_8 Reverse -281 -291 3.51995 0.267
NP_442062.1_8 Forward -148 -138 3.22496 0.279
NP_441859.1_3 Reverse -244 -263 17.2065 0.0436
NP_440304.1_4 Reverse -243 -253 10.8948 0.051
NP_440304.1_4 Forward -256 -246 8.1415 0.0859
NP_442242.1_4 Forward -253 -246 14.3954 0.0124
NP_442242.1_4 Reverse -246 -253 14.3954 0.0124
NP_441620.1_3 Reverse -153 -172 14.8474 0.227
NP_441200.1_4 Reverse -73 -92 8.75091 0.251
NP_441935.1_1 Reverse -235 -254 6.68596 0.264
NP_441208.1_9 Reverse -305 -319 9.63603 0.207
NP_441208.1_9 Reverse -348 -362 7.07942 0.227
NP_442742.1_9 Reverse -172 -191 4.03102 0.127
NP_441546.1_2 Forward -118 -99 16.7157 0.254
NP_442110.1_7 Reverse -357 -371 4.42448 0.201
NP_440856.1_4 Reverse -238 -257 4.916 0.0969
NP_441083.1_5 Reverse -245 -255 9.61647 0.0243
NP_441083.1_5 Forward -254 -244 1.94665 0.197
NP_441141.1_4 Forward -264 -245 8.94757 0.292
NP_441738.1_2 Forward -252 -245 15.28 0.0102
NP_441738.1_2 Reverse -247 -254 11.5435 0.084
NP_441558.1_5 Forward -256 -237 9.63589 0.117
NP_440209.1_1 Reverse -245 -253 18.1123 0.00295
NP_440209.1_1 Forward -254 -246 8.47588 0.0457
NP_442136.1_4 Forward -114 -95 10.7167 0.286
NP_442889.1_1 Reverse -76 -95 -14.0619 0.271
NP_442889.1_8 Forward -236 -222 3.63724 0.273
NP_440447.1_1 Reverse -240 -258 12.3105 0.147
NP_441713.1_1 Forward -260 -241 -4.03212 0.113
NP_441713.1_1 Reverse -378 -397 -9.83364 0.187
NP_441770.1_10 Reverse -61 -80 8.55425 0.279
NP_440178.1_7 Forward -255 -236 -12.4886 0.121
NP_440178.1_7 Reverse -350 -369 -23.01 0.287
NP_442570.1_3 Reverse -74 -93 -5.80207 0.25
NP_442570.1_3 Reverse -105 -124 -7.37537 0.27
NP_441716.1_1 Reverse -245 -259 5.80112 0.216
NP_442111.1_4 Forward -255 -241 15.8309 0.0194
NP_442111.1_4 Reverse -244 -258 15.5359 0.0212
NP_440343.1_9 Reverse -72 -91 7.57094 0.278
NP_440906.1_5 Forward -253 -246 15.8704 0.0124
NP_440906.1_5 Reverse -246 -253 15.8704 0.0124
NP_441209.1_7 Forward -370 -352 19.5263 0.175
NP_440747.1_10 Reverse -242 -254 5.54551 0.0128
NP_440747.1_10 Forward -257 -245 -2.02597 0.0196
NP_440747.1_10 Forward -246 -234 -2.32097 0.0331
NP_441486.1_1 Reverse -231 -245 -6.19526 0.283
NP_442145.1_3 Forward -365 -346 10.9142 0.23
NP_442634.1_4 Reverse -243 -257 5.80112 0.051
NP_442634.1_4 Forward -256 -242 4.62115 0.0764
NP_441265.1_3 Forward -260 -246 9.63603 0.138
NP_441265.1_3 Reverse -239 -253 4.52282 0.181
NP_441667.1_1 Forward -176 -161 15.5471 0.284
NP_440403.1_10 Reverse -231 -250 5.99764 0.238
NP_441014.1_10 Reverse -361 -380 -0.886293 0.254
NP_443018.1_3 Forward -253 -246 14.8871 0.0123
NP_443018.1_3 Reverse -246 -253 14.8871 0.0123
NP_443018.1_3 Forward -242 -235 4.36568 0.254
NP_443018.1_3 Reverse -235 -242 4.07068 0.299
NP_441316.1_7 Forward -256 -241 3.71647 0.137
NP_441316.1_7 Reverse -243 -258 -3.26502 0.273
NP_441634.1_8 Forward -245 -231 15.4376 0.0248
NP_440376.1_1 Reverse -245 -254 9.73449 0.0365
NP_440376.1_1 Forward -254 -245 9.63616 0.0385
NP_441588.1_4 Forward -252 -242 7.05986 0.178
NP_442730.1_8 Reverse -237 -256 10.4217 0.185
NP_442687.1_7 Reverse -233 -243 10.9931 0.0994
NP_442687.1_7 Forward -292 -282 10.4031 0.0994
NP_442687.1_7 Forward -255 -245 8.92815 0.0994
NP_440781.1_1 Reverse -269 -283 17.6008 0.167
NP_442583.1_1 Forward -110 -91 9.3409 0.298
NP_440642.1_10 Forward -164 -150 2.35894 0.277
NP_441013.1_2 Reverse -271 -289 -4.11075 0.297
NP_441013.1_3 Reverse -357 -376 11.6025 0.204
NP_441422.1_7 Forward -245 -228 -4.38605 0.243
NP_441950.1_8 Reverse -230 -244 7.76774 0.209
NP_442296.1_5 Reverse -236 -255 8.65258 0.206
NP_441763.1_5 Reverse -381 -400 -6.58872 0.274
NP_442658.1_1 Forward -256 -246 15.8108 0.0101
NP_442658.1_1 Reverse -243 -253 13.0576 0.04
NP_442658.1_1 Forward -283 -273 8.43603 0.194
NP_440141.1_8 Forward -275 -256 4.52268 0.288
NP_441855.2_4 Forward -298 -279 9.33025 0.282
NP_442782.1_2 Reverse -234 -248 2.85119 0.271
NP_442544.1_2 Reverse -105 -119 -1.47537 0.287
NP_441414.1_9 Forward -254 -235 -0.39387 0.0903
NP_441487.1_6 Reverse -237 -256 2.45773 0.254
NP_441317.1_4 Reverse -350 -364 15.3844 0.161
NP_441958.1_5 Reverse -244 -254 12.0747 0.00222
NP_441958.1_5 Forward -255 -245 10.6981 0.0112
NP_441958.1_6 Forward -276 -262 20.3534 0.154
NP_442836.1_5 Reverse -228 -247 2.0644 0.269
NP_440203.1_5 Forward -375 -365 10.9926 0.206
NP_440203.1_5 Forward -251 -241 9.81266 0.245
NP_439905.1_1 Forward -284 -271 6.4108 0.288
NP_439990.1_6 Forward -388 -369 16.1257 0.112
NP_442376.1_2 Forward -259 -240 -11.0136 0.286
NP_442690.1_1 Forward -68 -49 -16.5201 0.289
NP_442911.1_2 Forward -264 -245 24.8772 0.00397
NP_442911.1_2 Reverse -235 -254 -8.16202 0.228
NP_442911.1_2 Forward -253 -234 -10.522 0.282
NP_442064.1_4 Reverse -353 -372 7.17681 0.245
NP_440993.1_2 Reverse -240 -256 5.56507 0.234
NP_440993.1_2 Forward -259 -243 2.12349 0.269
NP_440993.1_4 Forward -290 -273 4.46374 0.275
NP_440827.1_3 Forward -388 -369 12.4875 0.247
NP_440602.1_8 Reverse -341 -355 11.8976 0.22
NP_442210.1_9 Reverse -353 -371 12.2122 0.209
NP_441913.1_1 Forward -279 -263 14.4007 0.246
NP_441646.1_1 Forward -261 -242 -1.47551 0.287
NP_442438.1_10 Forward -259 -245 5.89945 0.125
NP_442438.1_10 Forward -248 -234 5.50613 0.132
NP_441000.1_6 Forward -255 -241 -3.34366 0.221
NP_440605.1_4 Forward -264 -245 19.0072 0.0577
NP_442771.1_1 Reverse -243 -261 -6.96235 0.169
NP_440147.1_3 Reverse -342 -361 7.27595 0.228
NP_440147.1_4 Reverse -243 -256 13.294 0.0326
NP_441295.1_4 Reverse -267 -286 1.17943 0.29
NP_441550.1_8 Forward -256 -246 16.5975 0.0116
NP_441550.1_8 Reverse -243 -253 15.3192 0.0132
NP_441916.1_7 Forward -254 -244 10.6981 0.0261
NP_441916.1_7 Reverse -245 -255 7.55152 0.0639
NP_441916.1_7 Forward -243 -233 6.96153 0.0784
NP_441916.1_10 Forward -374 -355 18.289 0.0888
NP_440345.1_3 Forward -46 -32 15.4813 0.209
NP_441041.1_4 Forward -388 -369 5.60432 0.0496
NP_441041.1_4 Forward -254 -235 -10.227 0.228
NP_441041.1_7 Forward -257 -245 16.7466 0.0131
NP_441041.1_7 Reverse -242 -254 5.37687 0.26
NP_441725.1_5 Reverse -246 -256 17.4829 0.0219
NP_441725.1_5 Forward -253 -243 1.94665 0.115
NP_439966.1_7 Reverse -243 -253 6.27276 0.185
NP_439966.1_7 Forward -256 -246 5.58445 0.216
NP_439966.1_7 Reverse -232 -242 4.40448 0.273
NP_439966.1_9 Forward -256 -247 9.24284 0.253
NP_442941.1_3 Forward -253 -243 11.0914 0.0116
NP_440289.1_2 Forward -257 -244 -4.40561 0.288
NP_440260.1_8 Forward -108 -90 -6.07737 0.285
NP_442281.1_1 Reverse -240 -254 7.76712 0.0927
NP_442281.1_1 Forward -259 -245 2.75226 0.257
NP_442281.1_1 Reverse -58 -72 1.96562 0.282
NP_441334.1_7 Forward -256 -237 6.88262 0.0214
NP_442256.1_2 Forward -256 -238 3.06741 0.107
NP_442012.1_1 Reverse -239 -258 1.86774 0.21
NP_442288.1_3 Reverse -356 -373 10.7569 0.203
NP_440498.1_1 Reverse -236 -254 -1.75081 0.231
NP_440375.1_8 Reverse -235 -254 3.53937 0.22
NP_440375.1_8 Forward -253 -234 0.196116 0.265
NP_441644.1_6 Reverse -245 -255 13.2542 0.0212
NP_441644.1_6 Forward -254 -244 9.71433 0.0705
NP_441644.1_6 Forward -243 -233 3.42118 0.282
NP_442215.1_2 Forward -256 -240 0.451859 0.151
NP_442215.1_2 Reverse -232 -248 -1.71142 0.187
NP_440929.1_8 Forward -254 -245 17.4043 0.00289
NP_440929.1_8 Reverse -245 -254 17.4043 0.00289
NP_440780.1_1 Forward -181 -162 8.83258 0.274
NP_442933.1_10 Reverse -245 -254 9.04618 0.063
NP_442933.1_10 Forward -254 -245 8.94785 0.0643
NP_442933.1_10 Forward -243 -234 5.11294 0.204
NP_441751.2_8 Reverse -246 -260 15.2409 0.0119
NP_441751.2_8 Forward -253 -239 -0.0987402 0.125
NP_442554.1_8 Forward -253 -243 16.4013 0.0065
NP_442554.1_8 Reverse -246 -256 13.648 0.0164
NP_442554.1_8 Forward -242 -232 5.48657 0.146
NP_441762.1_7 Forward -255 -243 1.41561 0.0747
NP_441762.1_7 Reverse -244 -256 -4.68091 0.181
NP_441762.1_7 Forward -244 -232 -4.9759 0.185
NP_441762.1_7 Forward -82 -70 -5.95921 0.258
NP_442142.1_4 Forward -257 -244 6.80355 0.154
NP_442142.1_4 Reverse -69 -82 6.11523 0.173
NP_442292.1_1 Forward -253 -244 17.5026 0.00435
NP_442292.1_1 Reverse -246 -255 8.94785 0.0261
NP_442476.1_2 Forward -62 -44 13.7316 0.265
NP_442476.1_6 Reverse -246 -260 6.19444 0.13
NP_441264.1_9 Forward -259 -245 17.6992 0.0876
NP_443009.1_5 Reverse -244 -255 15.9877 0.0107
NP_443009.1_5 Forward -255 -244 7.03967 0.141
NP_441865.1_3 Forward -57 -39 16.8337 0.138
NP_441715.1_4 Forward -253 -243 7.35486 0.108
NP_440357.1_3 Reverse -243 -262 -1.27885 0.299
NP_441198.1_8 Forward -256 -246 13.7596 0.108
NP_441198.1_8 Reverse -243 -253 12.783 0.116
NP_441198.1_8 Forward -379 -369 10.9275 0.232
NP_441468.1_1 Forward -253 -246 15.8704 0.0124
NP_441468.1_1 Reverse -246 -253 15.8704 0.0124
NP_441468.1_1 Forward -242 -235 4.46401 0.224
NP_441020.2_6 Forward -256 -239 8.7903 0.188
NP_441020.2_6 Reverse -243 -260 6.13536 0.275
NP_441015.1_10 Reverse -229 -248 -3.73712 0.191
NP_441673.1_1 Reverse -245 -254 11.1111 0.0121
NP_441673.1_1 Forward -254 -245 11.0128 0.018
NP_441673.1_1 Reverse -231 -240 -7.86675 0.187
NP_441673.1_1 Forward -240 -231 -7.96508 0.206
NP_441673.1_1 Forward -243 -234 -8.06341 0.254
NP_441339.1_4 Reverse -275 -294 3.83436 0.204
NP_442253.1_5 Forward -294 -277 1.61214 0.159
NP_441876.1_2 Forward -381 -362 10.6192 0.268
NP_441876.1_9 Reverse -176 -186 10.8943 0.284
NP_441826.1_2 Forward -260 -246 10.226 0.0498
NP_441826.1_2 Reverse -239 -253 -3.34366 0.284
NP_441330.1_1 Reverse -180 -199 -7.96535 0.183
NP_441764.1_8 Reverse -23 -33 14.7561 0.284
NP_442868.1_6 Forward -256 -246 7.84651 0.0669
NP_442868.1_6 Reverse -243 -253 0.963343 0.205
NP_442719.1_2 Reverse -322 -340 -8.53634 0.251
NP_441251.1_9 Reverse -205 -224 19.7187 0.0631
NP_441612.1_2 Forward -320 -310 12.9059 0.21
NP_442361.1_3 Reverse -239 -252 7.98409 0.285
NP_441944.1_10 Forward -389 -370 20.2556 0.0176
NP_441101.1_10 Reverse -241 -260 2.65439 0.173
NP_441882.1_6 Reverse -361 -380 -3.3438 0.255
NP_441849.1_9 Reverse -53 -72 16.5191 0.207
NP_440145.1_3 Forward -398 -379 2.85105 0.112
NP_440145.1_3 Forward -377 -358 -5.9004 0.282
NP_442050.1_5 Forward -256 -246 14.3359 0.0206
NP_442050.1_5 Reverse -243 -253 9.22267 0.193
NP_440558.1_2 Forward -294 -275 -5.80207 0.264
NP_440558.1_2 Forward -151 -132 -6.88371 0.283
NP_441878.1_6 Forward -255 -245 10.4031 0.0176
NP_441878.1_6 Reverse -244 -254 0.766681 0.134
NP_441878.1_6 Reverse -281 -291 -6.70647 0.194
NP_441878.1_6 Forward -244 -234 -7.19813 0.21
NP_441036.1_8 Forward -255 -245 7.45319 0.197
NP_441036.1_8 Reverse -244 -254 6.07655 0.242
NP_441557.1_5 Forward -254 -245 17.4043 0.0023
NP_441557.1_5 Reverse -245 -254 10.8161 0.00464
NP_441557.1_5 Reverse -234 -243 -0.68859 0.229
NP_442777.1_10 Forward -395 -376 16.8141 0.24
NP_440101.1_3 Forward -259 -240 1.0811 0.284
NP_442183.1_1 Reverse -245 -259 10.4227 0.0845
NP_442166.1_7 Forward -253 -239 7.57108 0.283
NP_441116.1_9 Forward -194 -180 12.8809 0.246
NP_441819.1_5 Forward -50 -31 15.326 0.195
NP_442135.1_1 Forward -284 -265 19.9096 0.134
NP_441549.1_9 Forward -258 -240 -8.04399 0.219
NP_442347.1_2 Forward -253 -244 3.34298 0.284
NP_442645.1_2 Forward -251 -232 -21.6334 0.29
NP_441037.1_4 Forward -256 -246 17.8431 0.0127
NP_441037.1_4 Reverse -243 -253 15.0168 0.028
NP_441633.1_3 Reverse -243 -256 3.46087 0.0699
NP_441633.1_3 Forward -245 -232 -5.97891 0.236
NP_440136.1_2 Forward -253 -246 15.9687 0.0123
NP_440136.1_2 Reverse -246 -253 15.9687 0.0123
NP_442590.1_10 Reverse -238 -257 12.2908 0.145
NP_442998.1_5 Forward -182 -172 15.3197 0.149
NP_442998.1_5 Reverse -121 -131 12.4681 0.169
NP_442998.1_10 Forward -252 -245 15.5754 0.0102
NP_442998.1_10 Reverse -247 -254 5.84064 0.235
NP_440299.1_1 Forward -258 -245 13.3917 0.0319
NP_440299.1_1 Reverse -230 -243 3.06699 0.261
NP_440299.1_6 Reverse -368 -387 5.89931 0.268
NP_441799.1_1 Reverse -241 -255 9.24208 0.0966
NP_441799.1_1 Forward -258 -244 6.39049 0.174
NP_440640.1_6 Forward -290 -271 1.0811 0.266
NP_441007.1_10 Forward -259 -246 8.37742 0.115
NP_441007.1_10 Reverse -240 -253 1.39592 0.203
NP_442201.1_10 Reverse -234 -253 -3.14714 0.147
NP_441229.1_10 Reverse -272 -291 -0.197208 0.288
NP_441512.1_4 Forward -258 -239 6.98095 0.293
NP_442756.1_2 Forward -262 -243 4.12936 0.296
NP_440915.1_6 Forward -258 -244 12.0943 0.0226
NP_440915.1_6 Reverse -241 -255 -0.590395 0.202
NP_441296.1_9 Reverse -369 -382 14.08 0.2
NP_441866.1_6 Reverse -189 -208 12.9783 0.163
NP_441704.1_8 Reverse -102 -121 7.17681 0.247
NP_441464.1_8 Reverse -245 -259 9.5377 0.189
NP_440695.1_6 Forward -179 -165 10.2174 0.269
NP_441939.1_3 Reverse -246 -265 7.17762 0.21
NP_441199.1_6 Reverse -241 -260 4.22769 0.172
NP_442993.1_1 Reverse -276 -292 -12.4295 0.271
NP_442386.1_9 Reverse -244 -253 6.39082 0.219
NP_442386.1_9 Forward -255 -246 5.11253 0.266
NP_442386.1_9 Reverse -233 -242 5.0142 0.27
NP_441340.1_5 Forward -253 -246 15.6737 0.0124
NP_441340.1_5 Reverse -246 -253 15.6737 0.0124
NP_441340.1_5 Reverse -235 -242 3.97235 0.274
NP_442186.1_10 Reverse -55 -74 17.1082 0.218
NP_441271.1_8 Forward -79 -69 14.6313 0.266
NP_442484.1_9 Forward -164 -145 17.1082 0.196
NP_442240.1_2 Forward -253 -234 -10.0303 0.137
NP_440586.1_8 Forward -253 -246 13.2151 0.026
NP_440586.1_8 Reverse -246 -253 13.2151 0.026
NP_442251.1_6 Forward -253 -246 15.2804 0.0124
NP_442251.1_6 Reverse -246 -253 15.2804 0.0124
NP_441912.1_3 Reverse -72 -91 7.66927 0.27
NP_441262.1_3 Forward -254 -247 14.8871 0.0223
NP_441262.1_3 Reverse -245 -252 14.7888 0.0223
NP_440027.1_3 Reverse -235 -253 3.36165 0.273
NP_443051.1_1 Reverse -244 -253 19.5676 0.00335
NP_443051.1_1 Forward -255 -246 16.0277 0.00754
NP_439937.1_9 Forward -134 -117 -12.1548 0.27
NP_439937.1_9 Reverse -244 -261 -14.9081 0.287
NP_440439.1_1 Reverse -242 -255 3.06754 0.121
NP_440439.1_1 Forward -257 -244 -1.45568 0.269
NP_440372.1_2 Forward -253 -246 16.3621 0.0124
NP_440372.1_2 Reverse -246 -253 16.3621 0.0124
NP_441572.1_7 Forward -260 -241 6.68596 0.0785
NP_441572.1_7 Reverse -239 -258 -0.295539 0.179
NP_440267.1_2 Forward -259 -245 8.45543 0.162
NP_442384.1_10 Forward -254 -241 5.52582 0.127
NP_442384.1_10 Reverse -245 -258 1.19926 0.267
NP_442121.1_4 Reverse -237 -256 -2.16383 0.226
NP_441018.1_7 Reverse -353 -372 14.5524 0.118
NP_441018.1_7 Reverse -352 -371 8.06259 0.256
NP_442790.1_4 Forward -263 -244 -9.63698 0.19
NP_442262.1_10 Forward -253 -246 14.1988 0.0123
NP_442262.1_10 Reverse -246 -253 14.1988 0.0123
NP_441689.1_5 Reverse -243 -253 8.3377 0.132
NP_441060.1_1 Reverse -348 -367 14.6161 0.248
NP_442529.1_4 Forward -263 -244 20.5506 0.134
NP_440297.1_9 Reverse -246 -256 9.81313 0.0917
NP_440297.1_9 Forward -253 -243 -0.216628 0.282
NP_440350.1_5 Reverse -360 -379 -6.68705 0.297
NP_442280.1_10 Reverse -369 -387 11.5907 0.205
NP_440937.1_5 Reverse -269 -288 10.4225 0.275
NP_442129.1_6 Reverse -30 -49 14.8191 0.246
NP_440999.1_2 Forward -371 -352 14.0608 0.165
NP_440999.1_9 Forward -244 -230 10.226 0.0548
NP_440999.1_9 Reverse -230 -244 0.392915 0.187
NP_440999.1_9 Forward -258 -244 -0.393733 0.205
NP_440888.1_2 Reverse -234 -248 9.34041 0.13
NP_440888.1_2 Reverse -357 -371 7.96378 0.175
NP_440888.1_2 Reverse -107 -121 7.27547 0.202
NP_440888.1_2 Reverse -331 -345 5.70218 0.267
NP_440491.1_1 Forward -257 -238 10.8153 0.18
NP_442277.1_4 Forward -263 -244 2.06362 0.256
NP_440575.1_1 Reverse -303 -322 -2.45958 0.294
NP_441543.1_2 Forward -253 -244 15.9293 0.00518
NP_442845.1_2 Reverse -239 -253 5.40779 0.233
NP_442845.1_2 Forward -291 -277 4.91614 0.249
NP_442845.1_2 Forward -383 -369 4.32615 0.261
NP_441551.1_5 Reverse -272 -288 16.2824 0.0707
NP_441551.1_5 Forward -258 -242 11.9559 0.162
NP_441469.1_8 Forward -255 -246 13.7661 0.0719
NP_441469.1_8 Reverse -244 -253 6.5879 0.227
NP_441469.1_8 Reverse -233 -242 5.3096 0.277
NP_442337.1_8 Reverse -362 -381 2.3594 0.217
NP_442578.1_7 Forward -253 -246 14.5921 0.026
NP_442578.1_7 Reverse -246 -253 14.5921 0.026
NP_440710.1_1 Reverse -237 -255 1.49411 0.135
NP_441462.1_2 Reverse -245 -255 11.2881 0.00441
NP_441462.1_2 Forward -254 -244 10.4031 0.011
NP_441462.1_2 Forward -240 -230 -0.511621 0.236
NP_441462.1_2 Reverse -234 -244 -0.708283 0.245
NP_441621.1_7 Forward -256 -242 13.1759 0.0331
NP_441621.1_7 Reverse -232 -246 -4.13031 0.208
NP_443062.1_1 Forward -254 -236 20.1493 0.0208
NP_443062.1_1 Reverse -379 -397 8.93595 0.145
NP_441410.1_3 Forward -263 -244 6.39097 0.23
NP_442204.1_1 Reverse -241 -252 8.51513 0.0919
NP_442204.1_5 Forward -250 -231 1.17943 0.241
NP_441560.1_8 Forward -39 -20 13.4605 0.209
NP_440454.1_5 Reverse -111 -129 15.0638 0.19
NP_440516.1_8 Reverse -245 -254 9.53783 0.0136
NP_440516.1_8 Forward -254 -245 7.07956 0.0867
NP_442428.1_5 Forward -253 -246 15.8704 0.0124
NP_442428.1_5 Reverse -246 -253 15.8704 0.0124
NP_442428.1_5 Forward -242 -235 4.759 0.223
NP_442120.1_10 Forward -200 -181 -11.5053 0.262
NP_442120.1_10 Reverse -351 -370 -15.9302 0.296
NP_441867.1_4 Reverse -30 -49 4.71934 0.256
NP_440673.1_2 Reverse -272 -291 9.12141 0.257
NP_440673.1_3 Forward -252 -245 12.4288 0.0426
NP_440673.1_3 Reverse -247 -254 5.34899 0.298
NP_443048.1_4 Forward -288 -269 16.8093 0.198
NP_441052.1_2 Forward -254 -244 1.84832 0.225
NP_441052.1_2 Reverse -245 -255 0.668351 0.256
NP_442219.1_9 Forward -253 -244 8.25953 0.0681
NP_440436.1_4 Forward -253 -244 9.24241 0.0871
NP_440436.1_4 Reverse -246 -255 6.78414 0.147
NP_441884.1_8 Forward -255 -236 -8.16202 0.261
NP_441884.1_9 Forward -259 -240 -21.3384 0.242
NP_440314.1_9 Forward -365 -346 -10.0303 0.282
NP_441719.1_4 Forward -253 -246 16.3621 0.0124
NP_441719.1_4 Reverse -246 -253 16.3621 0.0124
NP_441733.1_10 Forward -257 -244 7.59077 0.153
NP_442366.1_3 Forward -255 -237 -1.65248 0.216
NP_442366.1_5 Reverse -242 -252 14.0409 0.0497
NP_440296.1_10 Forward -257 -238 -12.4886 0.269
NP_441115.1_4 Reverse -244 -262 8.6715 0.24
NP_440328.1_4 Reverse -239 -258 1.76941 0.217
NP_443054.1_2 Reverse -61 -75 2.35953 0.245
NP_441851.1_10 Forward -255 -245 15.9097 0.00552
NP_441851.1_10 Reverse -244 -254 8.33817 0.118
NP_442515.1_1 Reverse -244 -258 -3.04867 0.285
NP_441683.1_7 Reverse -82 -101 -12.1936 0.284
NP_440593.1_9 Forward -246 -232 11.701 0.24
NP_441982.1_6 Reverse -52 -61 14.2042 0.274
NP_441982.1_6 Forward -41 -32 11.7214 0.288
NP_440463.1_5 Reverse -102 -121 22.5164 0.0795
NP_441349.1_10 Reverse -235 -254 0.491109 0.0886
NP_441349.1_10 Reverse -221 -240 -7.67036 0.258
NP_441349.1_10 Forward -253 -234 -8.85033 0.279
NP_442314.1_3 Forward -279 -265 12.586 0.277
NP_440389.1_3 Forward -246 -227 13.1758 0.25
NP_440432.1_9 Forward -253 -238 -2.38005 0.17
NP_442843.1_1 Reverse -73 -92 -9.63698 0.267
NP_439960.1_10 Forward -250 -232 -1.35749 0.242
NP_440474.1_8 Reverse -232 -246 8.3571 0.189
NP_440474.1_8 Reverse -246 -260 5.1122 0.257
NP_441124.1_1 Reverse -35 -52 17.5752 0.241
NP_440877.1_1 Forward -365 -346 9.3409 0.296
NP_440431.1_3 Forward -379 -360 -7.37537 0.204
NP_440431.1_5 Reverse -79 -98 6.19431 0.299
NP_442450.1_5 Reverse -243 -253 7.64985 0.13
NP_442168.1_5 Forward -253 -234 7.7676 0.159
NP_443047.1_7 Forward -253 -234 5.80098 0.228
NP_441570.1_1 Forward -254 -236 -0.177514 0.0437
NP_441078.1_4 Reverse -245 -254 9.93116 0.0203
NP_441078.1_4 Forward -254 -245 9.83282 0.0226
NP_441078.1_4 Forward -243 -234 -1.77023 0.266
NP_442388.1_3 Forward -287 -268 4.52268 0.293
NP_440539.1_9 Forward -283 -264 -6.78538 0.291
NP_441539.1_1 Reverse -167 -181 11.012 0.287
NP_442348.1_2 Forward -107 -98 14.7494 0.146
NP_442348.1_2 Forward -108 -99 7.57121 0.28
NP_440526.1_3 Reverse -246 -257 16.8727 0.0594
NP_440526.1_3 Forward -223 -212 3.49977 0.267
NP_441432.1_3 Forward -50 -31 17.5015 0.244
NP_441432.1_8 Reverse -244 -253 16.8143 0.00595
NP_441732.1_2 Reverse -241 -257 -7.70961 0.0885
NP_441732.1_2 Forward -370 -354 -16.6577 0.186
NP_441072.1_2 Reverse -234 -253 12.4875 0.173
NP_440713.1_4 Reverse -374 -393 5.60432 0.205
NP_442489.1_7 Reverse -245 -254 10.4228 0.0151
NP_442489.1_7 Forward -254 -245 10.3245 0.0193
NP_442489.1_7 Forward -243 -234 -1.27858 0.185
NP_440559.1_1 Reverse -246 -255 16.421 0.01
NP_440559.1_1 Forward -253 -244 8.65285 0.0586
NP_441659.2_8 Reverse -245 -255 16.008 0.0042
NP_441659.2_8 Forward -254 -244 11.3864 0.0184
NP_441659.2_8 Reverse -234 -244 3.51995 0.157
NP_440860.1_6 Reverse -216 -235 12.6841 0.293
NP_441022.1_1 Forward -37 -28 13.081 0.216
NP_440363.1_9 Reverse -273 -291 17.9154 0.16
NP_440363.1_9 Forward -252 -234 12.7038 0.265
NP_439956.1_7 Reverse -270 -289 9.63589 0.257
NP_442008.1_2 Reverse -242 -261 9.43923 0.18
NP_441800.1_7 Reverse -229 -247 -2.43913 0.263
NP_442776.1_1 Forward -290 -271 3.14605 0.293
NP_442346.1_5 Reverse -244 -254 15.0247 0.00889
NP_442346.1_5 Forward -255 -245 8.53483 0.133
NP_442346.1_5 Forward -244 -234 4.3066 0.291
NP_440545.1_3 Reverse -241 -258 23.3433 0.00514
NP_440545.1_3 Forward -258 -241 14.7885 0.0141
NP_440459.1_2 Forward -391 -374 13.6085 0.128
NP_441943.1_2 Reverse -56 -75 10.9142 0.27
NP_441943.1_8 Forward -300 -281 -4.91709 0.231
NP_442875.1_7 Forward -137 -118 14.4533 0.226
NP_440449.1_6 Forward -248 -230 8.06131 0.206
NP_440449.1_6 Forward -299 -281 5.04615 0.284
NP_441047.1_2 Reverse -67 -86 1.27776 0.239
NP_441047.1_2 Forward -371 -352 -2.75381 0.281
NP_441833.1_4 Forward -253 -246 15.9687 0.0124
NP_441833.1_4 Reverse -246 -253 15.9687 0.0124
NP_442162.1_9 Forward -253 -246 16.2637 0.0124
NP_442162.1_9 Reverse -246 -253 16.2637 0.0124
NP_440671.1_4 Forward -260 -246 6.78443 0.235
NP_442943.1_1 Reverse -162 -177 5.2111 0.211
NP_440772.1_6 Forward -262 -243 7.66927 0.292
NP_442045.1_2 Reverse -252 -271 12.2908 0.286
NP_442140.1_3 Reverse -246 -256 15.8113 0.0322
NP_442140.1_3 Forward -242 -232 7.05986 0.152
NP_442140.1_3 Forward -253 -243 6.66654 0.159
NP_440875.1_9 Forward -252 -242 8.37203 0.233
NP_440875.1_9 Reverse -247 -257 7.69067 0.255
NP_441813.1_5 Reverse -243 -253 8.63316 0.0367
NP_441813.1_5 Forward -256 -246 8.1415 0.0478
NP_442028.1_1 Forward -70 -57 7.89211 0.289
NP_440590.1_4 Forward -242 -229 -4.9956 0.272
NP_440567.1_1 Forward -253 -239 16.0275 0.0166
NP_440567.1_1 Reverse -246 -260 9.34103 0.0455
NP_442497.1_10 Reverse -246 -255 17.9943 0.00813
NP_442497.1_10 Forward -253 -244 17.601 0.00813
NP_440821.1_4 Forward -256 -246 18.9579 0.00422
NP_440821.1_4 Reverse -243 -253 2.24165 0.131
NP_440821.1_4 Reverse -232 -242 -0.609952 0.279
NP_441239.1_9 Forward -256 -244 14.4936 0.0272
NP_441239.1_9 Reverse -243 -255 10.5604 0.076
NP_441239.1_9 Reverse -232 -244 2.98891 0.3
NP_441009.1_4 Reverse -234 -253 9.53756 0.3
NP_440156.1_4 Forward -132 -122 14.5325 0.176
NP_441892.1_1 Reverse -236 -253 0.92382 0.159
NP_441892.1_1 Reverse -273 -290 -2.81276 0.228
NP_440604.1_6 Forward -254 -235 5.211 0.117
NP_442105.1_9 Forward -189 -175 14.4488 0.294
NP_440863.1_1 Forward -341 -327 14.5801 0.236
NP_442482.1_2 Reverse -358 -377 23.4022 0.0142
NP_440833.1_6 Forward -179 -165 11.7003 0.217
NP_440392.1_2 Forward -35 -16 15.8299 0.274
NP_442216.1_4 Reverse -100 -108 8.1805 0.255
NP_440876.1_5 Forward -129 -110 12.4875 0.233
NP_440354.1_7 Reverse -266 -284 6.50899 0.282
NP_441617.1_6 Reverse -185 -204 -0.885524 0.256
NP_441656.1_3 Reverse -357 -376 9.43923 0.293
NP_440462.1_6 Reverse -243 -253 10.5014 0.0396
NP_440462.1_6 Forward -390 -380 3.61828 0.234
NP_440462.1_6 Forward -256 -246 1.74999 0.294
NP_442465.1_9 Forward -365 -351 10.0294 0.298
NP_440868.1_4 Reverse -241 -253 13.2153 0.022
NP_440868.1_4 Reverse -230 -242 -0.0593532 0.242
NP_440868.1_4 Forward -258 -246 -0.256015 0.255
NP_442840.1_7 Reverse -184 -203 8.25926 0.171
NP_442402.1_2 Reverse -330 -344 11.602 0.272
NP_442402.1_4 Reverse -325 -344 -9.04772 0.285
NP_442402.1_9 Reverse -347 -366 12.9791 0.198
NP_442402.1_10 Reverse -334 -344 12.7626 0.204
NP_441848.1_7 Reverse -169 -188 -4.72118 0.298
NP_440696.1_3 Reverse -272 -290 0.510803 0.229
NP_440696.1_3 Reverse -103 -121 -1.84914 0.266
NP_440696.1_3 Forward -258 -240 -3.71743 0.289
NP_442039.1_4 Forward -253 -246 15.1821 0.0124
NP_442039.1_4 Reverse -246 -253 15.1821 0.0124
NP_442039.1_7 Forward -279 -269 6.8632 0.292
NP_440825.1_7 Reverse -246 -256 12.2265 0.177
NP_442837.1_3 Forward -253 -246 15.7721 0.0124
NP_442837.1_3 Reverse -246 -253 15.7721 0.0124
NP_442053.1_1 Reverse -245 -254 9.34117 0.0666
NP_442053.1_1 Forward -254 -245 8.84951 0.072
NP_440505.1_3 Reverse -243 -253 8.04317 0.147
NP_440505.1_7 Forward -247 -228 8.16093 0.162
NP_440505.1_7 Reverse -278 -297 0.196116 0.259
NP_441252.1_6 Forward -197 -190 11.6422 0.288
NP_441203.1_1 Forward -253 -234 -12.3902 0.143
NP_441408.2_7 Forward -374 -355 4.32602 0.191
NP_440914.1_1 Forward -254 -244 7.24882 0.242
NP_440914.1_1 Forward -388 -378 6.76087 0.267
NP_440914.1_1 Reverse -245 -255 6.27291 0.288
NP_440914.1_1 Forward -377 -367 6.17532 0.293
NP_441011.1_8 Forward -253 -244 16.6177 0.00602
NP_441011.1_8 Forward -330 -321 9.14451 0.135
NP_441011.1_8 Reverse -246 -255 6.68623 0.184
NP_442101.1_10 Reverse -237 -256 1.96607 0.0772
NP_442533.1_3 Reverse -31 -49 17.0928 0.186
NP_442533.1_6 Reverse -245 -254 7.86621 0.0862
NP_442533.1_6 Forward -254 -245 7.37455 0.0898
NP_442533.1_6 Reverse -234 -243 6.09625 0.118
NP_442533.1_6 Forward -243 -234 3.83464 0.202
NP_442533.1_6 Reverse -231 -240 2.65466 0.246
NP_442541.1_10 Forward -91 -77 1.17898 0.29
NP_442232.1_3 Forward -262 -243 -3.44213 0.163
NP_443016.1_1 Reverse -239 -258 5.30933 0.13
NP_441482.1_7 Reverse -239 -253 -10.7185 0.213
NP_441482.1_7 Forward -260 -246 -10.9151 0.222
NP_439944.1_9 Reverse -246 -256 15.2213 0.0239
NP_439944.1_9 Forward -253 -243 9.12481 0.1
NP_441028.1_6 Reverse -176 -186 10.9926 0.193
NP_441028.1_6 Forward -61 -51 7.15773 0.23
NP_441028.1_6 Forward -127 -117 5.48612 0.255
NP_442202.1_2 Reverse -179 -198 17.6982 0.244
NP_442664.1_8 Forward -63 -44 10.4217 0.24
NP_440116.1_5 Reverse -242 -259 14.0018 0.0693
NP_440116.1_8 Forward -253 -234 -2.65548 0.136
NP_441527.1_4 Forward -379 -360 -10.8388 0.275
NP_441527.1_4 Reverse -84 -103 -12.2711 0.285
NP_441527.1_4 Reverse -83 -102 -12.2711 0.285
NP_440115.1_6 Forward -257 -247 10.0098 0.115
NP_440115.1_6 Reverse -242 -252 7.35486 0.147
NP_440007.1_9 Reverse -241 -255 0.687908 0.292
NP_441347.1_5 Forward -383 -369 10.8154 0.269
NP_441972.1_5 Forward -253 -234 -5.70374 0.224
NP_441106.1_1 Reverse -244 -253 18.486 0.0028
NP_441106.1_1 Reverse -233 -242 5.60459 0.141
NP_440429.1_4 Reverse -238 -257 9.93088 0.299
NP_441825.1_4 Reverse -347 -357 13.8447 0.249
NP_442588.1_1 Reverse -101 -120 5.60432 0.281
NP_441286.1_1 Reverse -244 -256 5.64384 0.0259
NP_441286.1_1 Forward -255 -243 -4.77924 0.175
NP_440670.1_8 Reverse -245 -254 16.3227 0.00291
NP_440670.1_8 Forward -254 -245 15.1427 0.00768
NP_441930.1_2 Reverse -281 -291 11.2881 0.298
NP_440886.1_7 Reverse -233 -243 7.15773 0.103
NP_442614.1_2 Reverse -234 -248 11.6026 0.189
NP_442614.1_2 Reverse -245 -259 10.7177 0.234
NP_442072.1_9 Forward -255 -237 -11.5839 0.0789
NP_442072.1_9 Reverse -244 -262 -21.122 0.206
NP_440907.2_8 Reverse -246 -256 17.5808 0.00685
NP_440907.2_8 Forward -253 -243 15.9091 0.0161
NP_441463.1_1 Forward -209 -191 10.8356 0.273
NP_441463.1_3 Forward -264 -245 -8.35868 0.268
NP_441626.1_2 Forward -253 -246 15.7721 0.0124
NP_441626.1_2 Reverse -246 -253 15.7721 0.0124
NP_442211.1_3 Forward -388 -369 13.6968 0.22
NP_442362.1_7 Reverse -73 -91 12.1139 0.222
NP_442794.1_1 Reverse -241 -253 2.79224 0.286
NP_442615.1_1 Forward -263 -245 -1.16082 0.125
NP_442615.1_1 Reverse -236 -254 -6.56903 0.252
NP_440387.1_1 Forward -254 -238 4.77842 0.0388
NP_440387.1_1 Reverse -245 -261 -1.3181 0.142
NP_441431.1_2 Forward -257 -243 11.012 0.149
NP_441431.1_2 Reverse -235 -249 8.65209 0.209
NP_441431.1_2 Reverse -231 -245 8.06211 0.226
NP_441431.1_2 Reverse -242 -256 7.76712 0.234
NP_441488.1_8 Reverse -240 -254 11.7003 0.146
NP_441174.1_2 Forward -246 -232 13.2743 0.216
NP_440467.1_3 Reverse -246 -265 12.4282 0.24
NP_441510.2_9 Forward -253 -234 8.75091 0.165
NP_440293.1_3 Forward -250 -231 -6.1954 0.287
NP_440293.1_9 Forward -248 -234 10.6678 0.264
NP_440766.1_4 Forward -258 -244 0.294584 0.291
NP_440766.1_5 Forward -183 -171 11.38 0.267
NP_440422.1_10 Forward -65 -46 7.59671 0.225
NP_441237.1_9 Reverse -246 -256 16.7946 0.0141
NP_441311.1_2 Reverse -239 -253 23.5 0.00162
NP_442930.1_1 Reverse -97 -107 15.9091 0.19
NP_440457.1_1 Forward -258 -246 16.1653 0.0527
NP_440457.1_1 Reverse -241 -253 2.20226 0.216
NP_440798.1_6 Forward -253 -240 19.9805 0.0213
NP_440798.1_6 Reverse -246 -259 9.16406 0.103
NP_440142.1_7 Forward -387 -368 10.9142 0.203
NP_441889.1_4 Reverse -236 -255 0.392778 0.296
NP_442509.1_9 Reverse -245 -255 13.6475 0.0475
NP_442514.1_5 Forward -87 -68 -9.53937 0.296
NP_440554.1_4 Forward -253 -243 8.82982 0.0646
NP_440554.1_4 Reverse -246 -256 7.55152 0.103
NP_441885.1_5 Reverse -245 -255 2.24165 0.0822
NP_441885.1_5 Forward -254 -244 1.55333 0.109
NP_441885.1_5 Reverse -234 -244 0.865012 0.117
NP_440628.1_3 Forward -180 -166 16.1259 0.256
NP_440478.1_10 Reverse -232 -246 13.5693 0.127
NP_441756.1_5 Forward -258 -239 -3.04881 0.287
NP_441173.1_9 Forward -43 -35 13.2937 0.17
NP_442395.2_4 Reverse -244 -263 1.37531 0.244
NP_443000.1_7 Reverse -243 -253 10.6981 0.0345
NP_440275.1_3 Forward -256 -246 19.6462 0.00756
NP_440275.1_3 Reverse -243 -253 9.02648 0.0563
NP_440275.1_3 Reverse -232 -242 7.15819 0.0872
NP_440091.1_1 Forward -258 -246 3.08724 0.17
NP_440258.1_3 Reverse -28 -47 -5.01543 0.256
NP_442753.1_3 Forward -400 -382 23.2253 0.0224
NP_440641.1_6 Forward -186 -167 8.94757 0.272
NP_441105.1_3 Forward -265 -246 3.73603 0.0873
NP_441105.1_3 Forward -296 -277 -8.06369 0.265
NP_440216.1_1 Forward -254 -240 6.6861 0.0139
NP_440216.1_1 Reverse -245 -259 -2.85201 0.0608
NP_440216.1_1 Reverse -234 -248 -10.8168 0.148
NP_440216.1_9 Forward -370 -361 15.536 0.128
NP_440172.1_1 Reverse -245 -255 9.7148 0.0586
NP_440172.1_1 Forward -254 -244 7.74818 0.0738
NP_442015.1_10 Forward -258 -245 5.62415 0.137
NP_441226.1_7 Forward -253 -246 14.4934 0.0123
NP_441226.1_7 Reverse -246 -253 14.4934 0.0123
NP_441226.1_7 Forward -392 -385 9.47853 0.147
NP_441226.1_7 Reverse -380 -387 9.47853 0.147
NP_441111.1_7 Forward -253 -245 18.7023 0.00294
NP_441111.1_7 Reverse -246 -254 8.96754 0.0463
NP_441111.1_7 Forward -242 -234 -0.472234 0.131
NP_442379.1_10 Reverse -238 -255 9.67528 0.0936
NP_442379.1_10 Forward -261 -244 0.333834 0.223
NP_441766.1_2 Forward -254 -245 16.2243 0.0047
NP_441766.1_2 Reverse -245 -254 9.14451 0.0337
NP_440416.1_9 Reverse -238 -257 -8.45701 0.117
NP_440416.1_9 Reverse -372 -391 -12.6852 0.159
NP_440416.1_9 Reverse -265 -284 -17.6018 0.243
NP_440416.1_9 Forward -92 -73 -19.7651 0.278
NP_442116.1_6 Forward -47 -30 7.40502 0.258
NP_441974.1_1 Forward -359 -342 19.6067 0.239
NP_440261.1_5 Forward -253 -240 -1.16069 0.0662
NP_440261.1_5 Reverse -246 -259 -1.16069 0.0662
NP_440261.1_5 Forward -242 -229 -6.17557 0.196
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATGGAAAGCCAACGGATGGCAAAGGAATGCCAAGGAAAAGGCCAAAAACCCCGACCTGTGGGAAACGATGTTAACGCTGTGCGAAAAACATCAAGTTACATTCCAGTGGGTCAAAGCCCACGCTGGCAATAAGGAAAATGAGCGGTGCGATCGCCTAGCGGTGGCCGCCTATCAAAATAATCCCAACTTAGTAGATGAAGGCTTCGGCAAATTCTAGGGGGCAAAACTTAACCAATTTCCATTTCCTATCTAGGCTTTGCCAATTCAACGATTTTCCCTCAATAGCAAACGGGGGAATTTTTTTCGTGCCCAATTTCCAGCCCTAGCGGAGATTAGCTTTTTTCACCATGTCATTATTTTGCCAAAAAGTTTGCTGTTAACATCAATGTTCTGTGTTAT

CDS

ATGTTGGTTAAATACCATCTAGTAGGTTTCCCAATGGCAACGCTAGAAGCCCCCCCCCATAGTCTGCAACACCAGGAAATTCCCCCCAGCCATCGTATTTTGGTCGTTGAAGACGAGGTTTCCATTCGTGAAACCATTGTCCTATCACTGCAGGAAGAAGGTTATGAAGTTTATGCGGTGGACGATGGACGTGATGCCTTAGCTCTGTTGCAAGAATTTAGCGAAGACCCCGGTCAGGCCGCCGTAGACCTGATCATTCTGGACATCATGCTTCCCCAGGTAAACGGCTTAGATGTATGTCGTAGTTTGCGCTTTGGTGGCGATAATACCCCGATTTTAATTGTCAGTGCCAAAGGCAGTGAAATGGAAAAAGTAACTGGCTTGGAAGTGGGGGCCGATGACTACATCACTAAGCCCTTTAGCCTGAAGGAATTGGTGGCCCGTTGCCGCGCCATGATCCGTCGCCAGGGCTTGGCTGGTAATAACATTGCCCCATTCCGCAAATTTAGGGATTTGGTGCTTTATCCCCAGGAGTGTCGGGTGTTAATGCGGGGAGAAGAAGTGAGTTTGGCCCCGAAGGAATTTCGCCTATTGGAATTGTTCATGAGCTATCCCCGTCGAGTCTGGTCTAGGGAACAGTTAATTGAACATATTTGGGGCATTGATTTTATGGGAGACAGCAAAACGGTGGATGTCCATATCCGCTGGCTACGGGAAAAGCTGGAACAGGACCCCAGTCAGCCGGAATATTTAGTCACAGTGCGGGGCTTTGGCTATCGTTTTGGTTAG

Protein

MLVKYHLVGFPMATLEAPPHSLQHQEIPPSHRILVVEDEVSIRETIVLSLQEEGYEVYAVDDGRDALALLQEFSEDPGQAAVDLIILDIMLPQVNGLDVCRSLRFGGDNTPILIVSAKGSEMEKVTGLEVGADDYITKPFSLKELVARCRAMIRRQGLAGNNIAPFRKFRDLVLYPQECRVLMRGEEVSLAPKEFRLLELFMSYPRRVWSREQLIEHIWGIDFMGDSKTVDVHIRWLREKLEQDPSQPEYLVTVRGFGYRFG