Your browser is old and dusty. Try Google Chrome!

Details for slr0072

ORF slr0072
Accession NP_442469.1
Symbol gidB
Category Cell division
Definition glucose inhibited division protein B
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -45 -31 12.9793 0.0435
NP_441061.1_2 Reverse -218 -232 3.93283 0.158
NP_441061.1_2 Reverse -38 -52 1.17956 0.193
NP_441061.1_2 Forward -39 -25 -2.16369 0.285
NP_440557.1_1 Reverse -38 -57 10.6192 0.113
NP_440795.1_7 Forward -45 -38 14.6904 0.0123
NP_440795.1_7 Reverse -38 -45 14.6904 0.0123
NP_440795.1_7 Reverse -383 -390 7.80726 0.232
NP_440795.1_7 Reverse -90 -97 6.92228 0.26
NP_441418.1_6 Forward -46 -27 5.89931 0.00794
NP_441418.1_6 Reverse -37 -56 -19.5684 0.0906
NP_441418.1_6 Reverse -217 -236 -29.4015 0.224
NP_441418.1_6 Reverse -21 -40 -29.9915 0.249
NP_441480.1_8 Reverse -115 -134 14.7491 0.264
NP_441453.1_1 Forward -53 -35 3.75497 0.263
NP_441453.1_1 Reverse -30 -48 3.26332 0.273
NP_441453.1_4 Reverse -37 -45 16.539 0.00633
NP_441453.1_4 Forward -46 -38 16.539 0.00633
NP_441453.1_4 Forward -226 -218 14.7691 0.0119
NP_441453.1_4 Reverse -217 -225 6.80426 0.121
NP_441623.1_1 Forward -53 -35 4.9357 0.18
NP_441623.1_1 Forward -68 -50 -3.02911 0.254
NP_442877.1_3 Forward -133 -114 14.6499 0.146
NP_442151.1_1 Reverse -83 -102 10.9142 0.253
NP_442151.1_6 Reverse -37 -51 19.5675 0.0045
NP_442151.1_6 Reverse -217 -231 16.2242 0.0167
NP_442151.1_6 Forward -46 -32 15.0442 0.0276
NP_442151.1_6 Reverse -89 -103 7.47274 0.197
NP_440561.1_4 Forward -48 -29 13.3078 0.229
NP_440561.1_8 Reverse -105 -124 7.37428 0.282
NP_441818.1_1 Forward -45 -34 14.0211 0.0577
NP_441818.1_9 Reverse -113 -132 -1.57384 0.2
NP_441818.1_9 Reverse -107 -126 -9.24366 0.288
NP_440226.1_1 Forward -226 -207 16.0274 0.022
NP_440226.1_1 Reverse -37 -56 10.0292 0.0665
NP_440226.1_1 Reverse -113 -132 5.211 0.163
NP_442169.1_1 Reverse -49 -68 -1.57384 0.265
NP_441630.1_3 Forward -54 -35 10.7175 0.0882
NP_441630.1_3 Reverse -29 -48 0.884433 0.261
NP_441816.1_8 Reverse -22 -36 21.0424 0.0871
NP_442287.1_5 Reverse -112 -122 17.8763 0.19
NP_442173.1_1 Forward -45 -37 15.4574 0.00633
NP_442173.1_1 Reverse -38 -46 15.4574 0.00633
NP_442173.1_1 Forward -225 -217 12.0158 0.0316
NP_442173.1_1 Reverse -218 -226 12.0158 0.0316
NP_442752.1_4 Reverse -217 -224 13.8055 0.0199
NP_442752.1_4 Forward -46 -39 13.8055 0.0199
NP_442752.1_4 Reverse -37 -44 13.8055 0.0199
NP_442752.1_4 Reverse -113 -120 10.5605 0.1
NP_443027.1_4 Forward -48 -38 15.3197 0.0437
NP_443027.1_4 Reverse -35 -45 6.46988 0.275
NP_439997.1_6 Reverse -260 -279 8.75091 0.251
NP_439997.1_6 Reverse -178 -197 8.65258 0.253
NP_442975.1_10 Forward -50 -36 12.0937 0.0477
NP_442975.1_10 Reverse -33 -47 11.897 0.0482
NP_442975.1_10 Forward -230 -216 3.04726 0.263
NP_442975.1_10 Reverse -213 -227 2.75226 0.269
NP_440784.1_7 Forward -45 -38 15.9687 0.0123
NP_440784.1_7 Reverse -38 -45 15.9687 0.0123
NP_440784.1_7 Reverse -218 -225 6.23397 0.241
NP_440784.1_7 Forward -225 -218 6.13563 0.241
NP_442909.1_7 Forward -45 -31 19.1735 0.0437
NP_442909.1_7 Reverse -32 -46 9.14375 0.156
NP_442909.1_7 Reverse -218 -232 5.99717 0.258
NP_441934.1_8 Reverse -92 -111 11.4058 0.292
NP_442000.2_10 Reverse -88 -106 9.16393 0.26
NP_440061.1_9 Forward -48 -34 13.7653 0.076
NP_440061.1_9 Forward -72 -58 10.6187 0.124
NP_440061.1_9 Reverse -87 -101 8.16044 0.18
NP_440110.1_8 Reverse -35 -54 20.7473 0.0149
NP_440110.1_8 Reverse -367 -386 10.0292 0.0904
NP_441476.1_5 Forward -51 -32 0.392778 0.19
NP_441476.1_5 Reverse -29 -48 -7.57203 0.29
NP_441476.1_5 Reverse -32 -51 -8.26035 0.3
NP_439979.1_2 Forward -40 -21 12.3892 0.166
NP_442062.1_8 Forward -46 -36 17.6796 0.00193
NP_442062.1_8 Reverse -37 -47 10.3048 0.0493
NP_442062.1_8 Reverse -217 -227 7.94484 0.0848
NP_440761.1_4 Reverse -212 -231 -13.5702 0.257
NP_441900.1_2 Forward -102 -84 10.3431 0.114
NP_441859.1_2 Forward -115 -96 16.3215 0.126
NP_441859.1_3 Forward -47 -28 16.3215 0.0573
NP_440304.1_4 Forward -48 -38 18.9579 0.00406
NP_440304.1_4 Reverse -35 -45 17.9746 0.00654
NP_442242.1_4 Forward -45 -38 14.3954 0.0124
NP_442242.1_4 Reverse -38 -45 14.3954 0.0124
NP_440044.1_8 Forward -225 -206 5.30933 0.103
NP_440044.1_8 Reverse -218 -237 -3.04881 0.277
NP_441781.1_7 Forward -46 -27 -3.3438 0.296
NP_440893.1_5 Forward -138 -119 9.04509 0.277
NP_441208.1_9 Reverse -34 -48 18.3875 0.0647
NP_441208.1_9 Forward -49 -35 6.58777 0.241
NP_441594.1_6 Reverse -28 -47 20.4523 0.0183
NP_441594.1_6 Forward -107 -88 7.57094 0.17
NP_441594.1_6 Reverse -86 -105 -0.295539 0.298
NP_442196.1_10 Reverse -35 -54 15.2408 0.149
NP_442196.1_10 Forward -48 -29 10.2259 0.268
NP_440370.1_10 Reverse -28 -47 13.4708 0.121
NP_440132.1_1 Reverse -35 -53 9.85225 0.23
NP_442110.1_7 Reverse -37 -51 19.2725 0.0138
NP_442110.1_7 Forward -46 -32 9.5377 0.0724
NP_442110.1_7 Reverse -217 -231 8.16106 0.0979
NP_441925.1_4 Forward -69 -50 8.4551 0.0936
NP_441925.1_4 Forward -68 -49 -6.88445 0.185
NP_441925.1_4 Forward -85 -66 -7.96609 0.203
NP_441925.1_4 Forward -103 -84 -8.45774 0.209
NP_441925.1_4 Forward -111 -92 -11.9976 0.253
NP_441925.1_4 Forward -102 -83 -15.8325 0.274
NP_441925.1_4 Forward -70 -51 -16.3242 0.282
NP_441402.1_10 Reverse -208 -227 10.6192 0.203
NP_440856.1_4 Forward -53 -34 -0.688862 0.184
NP_441083.1_3 Reverse -88 -98 11.8776 0.297
NP_441083.1_5 Forward -46 -36 19.3512 0.000718
NP_441083.1_5 Reverse -217 -227 17.7779 0.00336
NP_441083.1_5 Reverse -37 -47 11.2881 0.0159
NP_441083.1_5 Forward -226 -216 10.0098 0.0214
NP_442827.1_8 Reverse -29 -48 21.6314 0.0165
NP_442827.1_8 Forward -54 -35 16.2232 0.032
NP_442115.2_7 Forward -97 -80 10.2653 0.149
NP_441434.1_7 Forward -224 -210 4.03116 0.225
NP_442245.1_7 Forward -301 -283 12.6055 0.193
NP_442245.1_7 Reverse -57 -75 10.8356 0.248
NP_441738.1_2 Forward -224 -217 15.28 0.0102
NP_441738.1_2 Forward -44 -37 15.28 0.0102
NP_441738.1_2 Reverse -39 -46 15.28 0.0102
NP_441738.1_2 Reverse -357 -364 6.23363 0.264
NP_441558.1_5 Forward -48 -29 14.1591 0.0522
NP_441558.1_5 Reverse -35 -54 11.7992 0.0766
NP_441558.1_5 Reverse -215 -234 3.83436 0.296
NP_440209.1_1 Reverse -37 -45 18.1123 0.00295
NP_440209.1_1 Forward -46 -38 18.1123 0.00295
NP_440209.1_1 Reverse -217 -225 8.57422 0.0425
NP_440209.1_1 Forward -226 -218 8.47588 0.0457
NP_442889.1_1 Reverse -83 -102 -12.2919 0.226
NP_442889.1_8 Reverse -214 -228 9.43874 0.0989
NP_440447.1_6 Reverse -29 -47 0.412472 0.291
NP_441713.1_1 Reverse -31 -50 -14.5535 0.259
NP_441713.1_1 Reverse -250 -269 -16.2252 0.278
NP_440178.1_7 Reverse -36 -55 5.01433 0.0199
NP_440178.1_7 Forward -47 -28 -20.3551 0.188
NP_440178.1_7 Forward -82 -63 -21.9284 0.246
NP_440178.1_7 Forward -227 -208 -23.2067 0.298
NP_440053.1_2 Reverse -43 -62 23.1072 0.0225
NP_442570.1_3 Reverse -87 -106 8.75091 0.129
NP_440538.1_10 Forward -127 -108 10.6192 0.279
NP_441716.1_1 Forward -46 -32 10.9143 0.0936
NP_442111.1_4 Forward -47 -33 17.1092 0.0115
NP_442111.1_4 Reverse -36 -50 10.816 0.0518
NP_442111.1_4 Forward -227 -213 3.24451 0.253
NP_441163.1_1 Forward -69 -52 5.54465 0.273
NP_440906.1_5 Forward -45 -38 15.8704 0.0124
NP_440906.1_5 Reverse -38 -45 15.8704 0.0124
NP_440906.1_5 Reverse -218 -225 6.23397 0.234
NP_440906.1_5 Forward -225 -218 6.13563 0.241
NP_440747.1_10 Reverse -34 -46 -1.92764 0.0192
NP_440747.1_10 Forward -49 -37 -1.92764 0.0192
NP_440747.1_10 Reverse -214 -226 -2.32097 0.0331
NP_440747.1_10 Forward -229 -217 -2.4193 0.0434
NP_440747.1_10 Forward -101 -89 -11.9574 0.178
NP_440747.1_10 Reverse -86 -98 -12.0557 0.199
NP_441130.1_10 Reverse -35 -49 15.2409 0.034
NP_441130.1_10 Forward -228 -214 12.7826 0.0843
NP_441130.1_10 Forward -48 -34 11.111 0.107
NP_441486.1_1 Forward -49 -35 -2.75368 0.175
NP_441486.1_1 Reverse -214 -228 -6.09693 0.278
NP_441880.2_10 Forward -45 -27 11.6222 0.151
NP_442145.1_6 Reverse -41 -60 8.35759 0.204
NP_442634.1_4 Reverse -35 -49 12.3893 0.0401
NP_442634.1_4 Forward -48 -34 4.12949 0.0841
NP_442634.1_4 Reverse -215 -229 -2.55701 0.153
NP_441265.1_3 Forward -52 -38 3.04785 0.181
NP_440403.1_4 Forward -55 -36 -3.83545 0.203
NP_440403.1_4 Reverse -28 -47 -8.85033 0.261
NP_440403.1_10 Reverse -28 -47 7.17762 0.21
NP_440403.1_10 Reverse -35 -54 0.687771 0.3
NP_440842.1_10 Reverse -58 -72 2.06454 0.278
NP_442848.1_1 Reverse -31 -45 6.48943 0.0791
NP_442848.1_1 Forward -232 -218 -1.27871 0.263
NP_442848.1_1 Forward -52 -38 -3.147 0.263
NP_442848.1_5 Forward -65 -47 -0.570838 0.276
NP_442848.1_9 Reverse -363 -382 -1.37718 0.289
NP_441012.1_4 Forward -38 -25 9.55739 0.272
NP_443018.1_3 Forward -45 -38 14.8871 0.0123
NP_443018.1_3 Reverse -38 -45 14.8871 0.0123
NP_443018.1_3 Forward -225 -218 11.7405 0.0655
NP_443018.1_3 Reverse -218 -225 5.44732 0.193
NP_441316.1_7 Reverse -35 -50 4.89645 0.121
NP_441634.1_8 Reverse -87 -101 3.44117 0.152
NP_441634.1_8 Forward -48 -34 -3.54032 0.295
NP_441634.1_8 Reverse -35 -49 -4.22864 0.295
NP_441634.1_9 Reverse -90 -109 10.9134 0.252
NP_440376.1_1 Forward -46 -37 19.4693 0.000692
NP_440376.1_1 Reverse -37 -46 19.4693 0.000692
NP_440376.1_1 Reverse -217 -226 15.7327 0.00625
NP_440376.1_1 Forward -226 -217 9.63616 0.0385
NP_440376.1_1 Forward -378 -369 5.70292 0.12
NP_440376.1_1 Reverse -89 -98 4.52295 0.156
NP_441588.1_4 Forward -224 -214 6.76487 0.185
NP_441588.1_4 Reverse -39 -49 6.66654 0.185
NP_443065.1_6 Forward -87 -68 11.3075 0.141
NP_442687.1_7 Reverse -36 -46 18.5646 0.0028
NP_442687.1_7 Forward -47 -37 9.02648 0.0994
NP_442687.1_7 Reverse -216 -226 6.76487 0.154
NP_442191.1_4 Reverse -38 -52 14.8714 0.073
NP_442191.1_4 Reverse -79 -93 11.6718 0.247
NP_442191.1_7 Reverse -22 -41 15.1424 0.206
NP_440066.1_5 Forward -69 -50 7.66846 0.256
NP_442485.1_3 Reverse -26 -45 -2.36049 0.262
NP_441846.1_10 Reverse -91 -110 -5.01543 0.181
NP_441846.1_10 Reverse -78 -97 -6.88371 0.19
NP_441846.1_10 Reverse -60 -79 -11.4069 0.19
NP_441846.1_10 Reverse -67 -86 -12.3902 0.19
NP_441846.1_10 Reverse -21 -40 -13.4719 0.206
NP_441846.1_10 Reverse -73 -92 -13.8652 0.212
NP_441846.1_10 Reverse -22 -41 -20.1584 0.256
NP_441846.1_10 Reverse -51 -70 -21.0434 0.256
NP_441846.1_10 Reverse -75 -94 -21.24 0.256
NP_441846.1_10 Reverse -94 -113 -22.42 0.259
NP_441846.1_10 Reverse -23 -42 -22.6167 0.264
NP_441846.1_10 Reverse -89 -108 -23.2067 0.279
NP_441846.1_10 Reverse -76 -95 -23.305 0.282
NP_441846.1_10 Reverse -57 -76 -23.5016 0.289
NP_441846.1_10 Reverse -36 -55 -23.5016 0.289
NP_441846.1_10 Reverse -102 -121 -23.6 0.294
NP_441013.1_2 Forward -35 -17 -1.84914 0.282
NP_442766.1_6 Forward -36 -22 16.1252 0.272
NP_441422.1_7 Forward -106 -89 3.38209 0.112
NP_441422.1_7 Forward -48 -31 -3.69774 0.235
NP_440667.1_2 Reverse -116 -135 7.07928 0.189
NP_440667.1_2 Reverse -119 -138 -8.35868 0.289
NP_441950.1_8 Reverse -91 -105 5.21113 0.281
NP_440360.1_10 Forward -44 -30 7.9644 0.227
NP_442658.1_1 Reverse -35 -45 17.6791 0.00565
NP_442658.1_1 Forward -48 -38 15.9091 0.00966
NP_440353.1_2 Reverse -139 -158 8.06178 0.259
NP_441855.2_4 Reverse -29 -48 13.8614 0.167
NP_442782.1_2 Reverse -66 -80 3.14618 0.267
NP_442782.1_2 Reverse -22 -36 1.27789 0.281
NP_442496.1_5 Reverse -53 -71 8.86894 0.247
NP_442205.1_9 Reverse -31 -47 10.5799 0.0927
NP_441414.1_9 Reverse -217 -236 0.982764 0.0776
NP_441487.1_9 Forward -227 -208 -2.75381 0.293
NP_439919.1_1 Forward -145 -128 17.246 0.183
NP_439959.1_6 Reverse -298 -317 5.99764 0.274
NP_442937.1_5 Reverse -26 -45 11.0125 0.148
NP_441958.1_5 Forward -47 -37 21.2195 0.000805
NP_441958.1_5 Reverse -36 -46 20.5312 0.000966
NP_441958.1_5 Reverse -216 -226 18.9579 0.00183
NP_441958.1_5 Forward -227 -217 2.43831 0.0422
NP_441127.1_1 Forward -178 -164 13.2743 0.199
NP_441127.1_1 Reverse -28 -42 12.6843 0.206
NP_442836.1_5 Forward -232 -213 3.44104 0.235
NP_442836.1_5 Reverse -31 -50 1.67108 0.276
NP_442836.1_10 Reverse -53 -63 14.0414 0.212
NP_440203.1_5 Forward -43 -33 12.7626 0.138
NP_439905.1_1 Forward -168 -155 11.1307 0.204
NP_439905.1_1 Forward -45 -32 9.95071 0.216
NP_439905.1_1 Forward -69 -56 8.77074 0.232
NP_440984.1_7 Forward -51 -37 10.7177 0.122
NP_440984.1_7 Reverse -212 -226 5.99778 0.231
NP_441097.1_2 Reverse -97 -114 3.87375 0.291
NP_439990.1_5 Forward -51 -38 8.57408 0.168
NP_442376.1_2 Reverse -32 -51 4.42435 0.202
NP_442911.1_2 Forward -236 -217 4.42435 0.0386
NP_442911.1_2 Reverse -27 -46 -5.11376 0.15
NP_442911.1_2 Forward -56 -37 -9.83364 0.264
NP_441580.1_6 Forward -57 -38 4.42435 0.117
NP_441580.1_6 Reverse -206 -225 3.24438 0.117
NP_441580.1_6 Reverse -26 -45 -2.65548 0.229
NP_440153.1_5 Reverse -218 -232 8.16106 0.149
NP_440153.1_5 Reverse -38 -52 5.21113 0.191
NP_440153.1_5 Forward -45 -31 5.01447 0.193
NP_440153.1_8 Forward -104 -91 3.95252 0.21
NP_440153.1_8 Forward -46 -33 2.67422 0.21
NP_440153.1_8 Forward -40 -27 -1.65234 0.225
NP_440153.1_8 Forward -98 -85 -2.53732 0.244
NP_443055.1_3 Reverse -28 -47 10.7406 0.28
NP_443055.1_6 Forward -83 -65 -2.53818 0.296
NP_440993.1_2 Forward -51 -35 24.0513 0.00922
NP_440993.1_2 Reverse -32 -48 3.69678 0.256
NP_440993.1_3 Forward -56 -37 8.35677 0.129
NP_440993.1_3 Forward -111 -92 -0.689632 0.273
NP_440169.1_7 Forward -196 -177 15.7324 0.139
NP_440827.1_3 Reverse -32 -51 10.4225 0.298
NP_441099.1_5 Reverse -27 -46 8.55425 0.0372
NP_441099.1_5 Reverse -196 -215 -4.6221 0.147
NP_441099.1_5 Forward -56 -37 -5.11376 0.15
NP_442002.1_1 Reverse -74 -92 -10.4039 0.292
NP_442002.1_9 Reverse -36 -43 14.1004 0.074
NP_442002.1_9 Forward -190 -183 11.1505 0.185
NP_440809.1_9 Forward -235 -217 -6.66736 0.225
NP_441294.1_7 Reverse -213 -227 14.338 0.0446
NP_441294.1_7 Reverse -33 -47 12.5142 0.0944
NP_441294.1_7 Forward -50 -36 11.6503 0.133
NP_440411.1_10 Reverse -254 -273 10.1641 0.275
NP_441646.1_1 Reverse -30 -49 14.4541 0.0811
NP_442438.1_10 Reverse -32 -46 11.3077 0.0463
NP_442438.1_10 Forward -51 -37 8.45605 0.0782
NP_442431.1_10 Reverse -110 -128 16.3421 0.0577
NP_442431.1_10 Reverse -86 -104 2.96908 0.226
NP_442431.1_10 Reverse -19 -37 -0.177514 0.286
NP_441000.1_6 Forward -227 -213 2.75286 0.127
NP_441000.1_6 Reverse -36 -50 -4.03198 0.225
NP_441000.1_6 Reverse -73 -87 -4.91696 0.254
NP_442771.1_1 Forward -48 -30 3.16574 0.0672
NP_442771.1_1 Reverse -35 -53 -4.70074 0.166
NP_441674.1_6 Forward -45 -26 3.04771 0.272
NP_440147.1_4 Forward -48 -35 13.3923 0.0326
NP_440147.1_4 Reverse -35 -48 12.8023 0.0326
NP_440147.1_4 Reverse -215 -228 8.47575 0.0504
NP_440147.1_4 Forward -311 -298 -0.177378 0.276
NP_440147.1_4 Forward -228 -215 -0.669033 0.294
NP_441550.1_8 Reverse -35 -45 19.8424 0.00352
NP_441550.1_8 Forward -48 -38 17.4824 0.00754
NP_441550.1_8 Reverse -215 -225 14.5325 0.0141
NP_441550.1_8 Forward -228 -218 11.3859 0.0503
NP_441331.1_5 Forward -32 -13 15.7316 0.294
NP_441916.1_7 Reverse -37 -47 18.9579 0.00144
NP_441916.1_7 Forward -46 -36 16.893 0.00407
NP_441916.1_7 Forward -226 -216 9.32148 0.037
NP_441916.1_7 Forward -378 -368 2.63497 0.246
NP_440206.1_4 Forward -35 -16 7.57013 0.209
NP_440206.1_4 Forward -108 -89 5.2102 0.247
NP_440206.1_4 Forward -56 -37 4.71854 0.255
NP_440206.1_4 Forward -97 -78 0.883656 0.289
NP_440465.1_10 Forward -49 -30 16.5191 0.065
NP_441041.1_4 Reverse -66 -85 -9.14533 0.213
NP_441041.1_4 Reverse -37 -56 -11.0136 0.239
NP_441041.1_4 Reverse -25 -44 -11.6036 0.25
NP_441041.1_4 Reverse -31 -50 -11.7019 0.251
NP_441041.1_7 Forward -49 -37 18.3015 0.00558
NP_441041.1_7 Reverse -214 -226 13.0539 0.0526
NP_441041.1_7 Reverse -34 -46 12.568 0.0611
NP_442004.1_1 Reverse -24 -43 20.7347 0.0499
NP_442004.1_6 Forward -46 -32 19.0758 0.0534
NP_442004.1_6 Reverse -229 -243 4.42448 0.215
NP_442004.1_6 Forward -238 -224 3.73617 0.232
NP_440703.1_9 Forward -169 -156 5.82024 0.29
NP_441725.1_5 Forward -45 -35 18.7612 0.0119
NP_441725.1_5 Reverse -38 -48 8.92815 0.0553
NP_441725.1_5 Reverse -218 -228 1.55333 0.133
NP_439966.1_7 Forward -228 -218 14.8275 0.0177
NP_439966.1_7 Forward -48 -38 13.8442 0.0234
NP_439966.1_7 Forward -94 -84 8.53436 0.135
NP_439966.1_7 Reverse -35 -45 8.14104 0.14
NP_439966.1_7 Forward -32 -22 4.99446 0.248
NP_439966.1_7 Reverse -215 -225 4.60114 0.265
NP_439966.1_9 Forward -48 -39 0.983037 0.253
NP_439966.1_9 Reverse -35 -44 0.983037 0.253
NP_442941.1_3 Reverse -38 -48 10.9931 0.0116
NP_442941.1_3 Reverse -218 -228 10.2065 0.0213
NP_442941.1_3 Forward -225 -215 9.41981 0.0319
NP_442941.1_3 Forward -45 -35 2.43831 0.14
NP_440289.1_2 Forward -49 -36 14.5723 0.0107
NP_440289.1_2 Reverse -34 -47 4.73917 0.0649
NP_440289.1_2 Reverse -214 -227 2.96921 0.0835
NP_440983.1_5 Forward -46 -27 -2.85214 0.232
NP_440260.1_8 Reverse -157 -175 -3.91409 0.26
NP_440260.1_8 Reverse -28 -46 -4.8974 0.273
NP_440260.1_8 Forward -78 -60 -6.86402 0.295
NP_441514.1_6 Reverse -65 -72 14.2971 0.248
NP_442281.1_1 Forward -51 -37 14.8469 0.0155
NP_442281.1_1 Reverse -32 -46 8.45543 0.0808
NP_442281.1_1 Reverse -212 -226 7.17714 0.106
NP_442281.1_1 Forward -231 -217 6.48882 0.124
NP_441334.1_7 Reverse -35 -54 8.75091 0.0185
NP_441334.1_7 Forward -48 -29 7.07928 0.0205
NP_442256.1_2 Reverse -35 -53 -6.07737 0.214
NP_440479.1_9 Forward -84 -66 12.5072 0.297
NP_440437.1_1 Forward -52 -33 8.65258 0.0548
NP_442012.1_1 Forward -52 -33 15.8307 0.058
NP_441457.1_2 Forward -85 -66 16.0274 0.111
NP_441457.1_7 Forward -48 -29 19.9606 0.0236
NP_441457.1_7 Reverse -35 -54 4.81767 0.206
NP_441556.1_10 Reverse -32 -46 14.1153 0.178
NP_441556.1_10 Forward -36 -22 12.2659 0.195
NP_441556.1_10 Forward -174 -160 10.4165 0.27
NP_442982.1_5 Forward -56 -37 -2.45882 0.286
NP_441644.1_6 Reverse -37 -47 19.0557 0.000803
NP_441644.1_6 Forward -226 -216 18.7607 0.00127
NP_441644.1_6 Forward -46 -36 15.7125 0.0048
NP_441644.1_6 Reverse -362 -372 8.3377 0.103
NP_441644.1_6 Forward -104 -94 8.3377 0.103
NP_441644.1_6 Reverse -217 -227 7.74772 0.117
NP_441644.1_6 Reverse -89 -99 3.32285 0.288
NP_440587.1_6 Reverse -176 -195 14.2574 0.115
NP_442215.1_1 Forward -177 -158 2.3594 0.295
NP_442215.1_2 Reverse -35 -51 -1.41643 0.185
NP_442215.1_2 Forward -380 -364 -1.80975 0.189
NP_442029.1_1 Reverse -101 -120 0.0977854 0.156
NP_440253.1_2 Reverse -151 -169 -3.02911 0.284
NP_440253.1_2 Forward -226 -208 -3.32411 0.291
NP_440929.1_8 Forward -46 -37 19.2726 0.000701
NP_440929.1_8 Reverse -37 -46 19.2726 0.000701
NP_440929.1_8 Forward -226 -217 16.5193 0.00413
NP_440929.1_8 Reverse -217 -226 9.53783 0.0296
NP_442933.1_10 Forward -46 -37 17.601 0.00325
NP_442933.1_10 Reverse -37 -46 17.601 0.00325
NP_442933.1_10 Forward -226 -217 8.06287 0.0885
NP_442933.1_10 Reverse -217 -226 7.96454 0.0937
NP_441751.2_8 Forward -45 -31 4.62115 0.0481
NP_441751.2_8 Reverse -38 -52 -4.4253 0.173
NP_441751.2_8 Forward -74 -60 -4.81863 0.183
NP_442554.1_8 Reverse -38 -48 19.1546 0.00369
NP_442554.1_8 Forward -45 -35 16.9913 0.0065
NP_442554.1_8 Reverse -218 -228 13.5497 0.018
NP_442554.1_8 Forward -225 -215 7.45319 0.092
NP_442863.1_5 Reverse -26 -45 15.5357 0.233
NP_441762.1_7 Reverse -36 -48 11.1504 0.0142
NP_441762.1_7 Forward -47 -35 2.69391 0.0676
NP_441762.1_7 Forward -170 -158 -6.2542 0.284
NP_442142.1_4 Forward -125 -112 13.8833 0.0324
NP_442142.1_4 Forward -49 -36 4.93527 0.206
NP_442142.1_4 Reverse -34 -47 4.64028 0.214
NP_442292.1_1 Reverse -38 -47 17.5026 0.00435
NP_442292.1_1 Forward -45 -36 9.53783 0.0183
NP_442292.1_1 Reverse -218 -227 8.75118 0.0306
NP_442292.1_1 Forward -225 -216 7.66954 0.0634
NP_442292.1_5 Forward -50 -31 -1.08219 0.257
NP_442476.1_6 Forward -45 -31 3.8345 0.154
NP_440895.1_10 Forward -38 -21 -4.09106 0.201
NP_442381.1_8 Forward -115 -96 -8.26035 0.215
NP_441711.1_4 Forward -55 -36 16.2241 0.0419
NP_441523.1_6 Forward -50 -31 3.34271 0.274
NP_443009.1_5 Forward -47 -36 17.0694 0.00659
NP_443009.1_5 Reverse -36 -47 16.7744 0.00677
NP_443009.1_5 Forward -227 -216 4.8764 0.226
NP_442301.1_2 Forward -132 -113 7.27514 0.257
NP_442301.1_2 Forward -102 -83 4.62021 0.275
NP_442301.1_2 Forward -47 -28 3.34192 0.296
NP_442408.2_1 Reverse -37 -56 -5.40875 0.27
NP_441715.1_4 Reverse -38 -48 7.25653 0.108
NP_441715.1_4 Forward -225 -215 6.96153 0.121
NP_441715.1_4 Reverse -75 -85 6.46988 0.143
NP_441715.1_4 Reverse -218 -228 5.09324 0.233
NP_440183.1_9 Forward -44 -25 -13.7669 0.26
NP_441198.1_5 Reverse -39 -52 14.2767 0.206
NP_441198.1_8 Forward -48 -38 15.4199 0.0427
NP_441198.1_8 Reverse -35 -45 15.2245 0.0427
NP_440379.1_5 Reverse -28 -47 -9.63698 0.264
NP_440379.1_5 Reverse -57 -76 -10.6203 0.281
NP_441468.1_1 Forward -45 -38 15.8704 0.0124
NP_441468.1_1 Reverse -38 -45 15.8704 0.0124
NP_441468.1_1 Reverse -218 -225 6.13563 0.209
NP_441468.1_1 Forward -225 -218 6.0373 0.223
NP_441020.2_6 Reverse -35 -52 16.7551 0.025
NP_441020.2_7 Forward -98 -79 7.27514 0.269
NP_441015.1_10 Reverse -90 -109 11.6025 0.0657
NP_441015.1_10 Reverse -84 -103 -0.688862 0.169
NP_441015.1_10 Reverse -32 -51 -1.08219 0.169
NP_441015.1_10 Reverse -26 -45 -3.3438 0.189
NP_441015.1_10 Reverse -19 -38 -7.76869 0.271
NP_441015.1_10 Reverse -212 -231 -9.53865 0.282
NP_441015.1_10 Reverse -74 -93 -9.93197 0.282
NP_441015.1_10 Reverse -50 -69 -10.0303 0.282
NP_441015.1_10 Reverse -87 -106 -10.227 0.283
NP_441015.1_10 Reverse -56 -75 -10.6203 0.286
NP_441015.1_10 Reverse -111 -130 -11.5053 0.298
NP_441673.1_1 Forward -46 -37 20.8459 0.000698
NP_441673.1_1 Reverse -37 -46 20.8459 0.000698
NP_441673.1_1 Reverse -217 -226 11.1111 0.0121
NP_441673.1_1 Forward -226 -217 11.0128 0.018
NP_441673.1_1 Reverse -89 -98 -8.06341 0.254
NP_440286.1_2 Reverse -133 -146 17.7189 0.242
NP_441956.1_9 Forward -261 -242 5.89931 0.274
NP_441426.1_6 Reverse -104 -123 16.3224 0.123
NP_441826.1_2 Reverse -31 -45 13.1759 0.0227
NP_441826.1_2 Forward -52 -38 7.17775 0.0899
NP_441826.1_2 Forward -232 -218 4.81781 0.0988
NP_441826.1_2 Forward -104 -90 -3.54032 0.286
NP_441330.1_1 Reverse -212 -231 -11.4069 0.183
NP_442490.1_9 Forward -46 -27 -8.752 0.293
NP_442868.1_6 Reverse -35 -45 16.7946 0.0131
NP_442868.1_6 Forward -48 -38 8.63316 0.0555
NP_442868.1_6 Forward -100 -90 5.48657 0.147
NP_442868.1_6 Reverse -215 -225 0.668351 0.213
NP_442868.1_6 Forward -228 -218 0.0783647 0.248
NP_442719.1_2 Reverse -181 -199 -10.8963 0.284
NP_441056.1_1 Forward -46 -27 3.04771 0.132
NP_442227.1_2 Forward -102 -83 4.12936 0.208
NP_442227.1_2 Forward -116 -97 1.57275 0.245
NP_442227.1_2 Forward -35 -16 0.884433 0.252
NP_442227.1_2 Forward -41 -22 -0.0988766 0.253
NP_442227.1_2 Forward -79 -60 -2.55715 0.276
NP_442361.1_3 Forward -52 -39 10.639 0.272
NP_442427.1_8 Reverse -208 -227 7.17762 0.219
NP_442808.1_1 Forward -227 -217 9.22267 0.0481
NP_442808.1_1 Reverse -36 -46 8.73102 0.0481
NP_442808.1_1 Forward -47 -37 8.73102 0.0481
NP_442808.1_1 Forward -62 -52 6.0761 0.131
NP_442808.1_1 Forward -123 -113 5.48612 0.151
NP_442808.1_1 Forward -76 -66 4.20782 0.203
NP_442808.1_1 Forward -63 -53 1.74956 0.281
NP_441101.1_10 Forward -69 -50 -7.57203 0.29
NP_441290.1_3 Reverse -106 -125 15.0441 0.221
NP_440918.1_2 Reverse -87 -106 12.6841 0.259
NP_440145.1_3 Reverse -207 -226 -0.590531 0.142
NP_442820.1_8 Reverse -375 -389 18.7808 0.227
NP_442542.1_2 Reverse -29 -42 9.45906 0.134
NP_442542.1_2 Reverse -215 -228 8.86907 0.145
NP_442542.1_2 Reverse -35 -48 4.64084 0.299
NP_442542.1_9 Forward -53 -39 19.5668 0.0195
NP_442542.1_9 Reverse -210 -224 11.9953 0.11
NP_442050.1_1 Reverse -91 -110 13.6675 0.187
NP_442050.1_1 Reverse -65 -84 6.98095 0.28
NP_442050.1_5 Forward -48 -38 17.1874 0.00812
NP_442050.1_5 Reverse -35 -45 14.9258 0.0175
NP_442050.1_5 Forward -228 -218 14.3359 0.0206
NP_442342.1_9 Reverse -35 -51 14.5132 0.0941
NP_442342.1_9 Forward -48 -32 2.91013 0.278
NP_442747.1_1 Reverse -73 -92 -7.57203 0.218
NP_440558.1_2 Forward -49 -30 -3.24547 0.234
NP_440558.1_2 Forward -101 -82 -5.80207 0.264
NP_440558.1_2 Forward -107 -88 -6.78538 0.28
NP_442789.1_4 Reverse -35 -54 9.0459 0.0985
NP_442593.1_5 Reverse -91 -110 11.8975 0.269
NP_441518.1_3 Forward -56 -37 -3.63879 0.114
NP_441878.1_4 Reverse -52 -71 4.916 0.271
NP_441878.1_6 Reverse -36 -46 20.2362 0.0046
NP_441878.1_6 Forward -47 -37 10.5014 0.0176
NP_441878.1_6 Reverse -216 -226 0.766681 0.134
NP_441878.1_6 Forward -227 -217 0.57002 0.14
NP_441878.1_6 Reverse -88 -98 -7.19813 0.21
NP_441878.1_6 Reverse -368 -378 -7.68978 0.255
NP_441036.1_8 Forward -47 -37 15.713 0.00724
NP_441036.1_8 Reverse -216 -226 14.4347 0.0234
NP_441036.1_8 Reverse -36 -46 8.4365 0.174
NP_441036.1_8 Forward -396 -386 8.23984 0.176
NP_442650.1_2 Forward -46 -32 5.01447 0.156
NP_441557.1_5 Forward -46 -37 19.9609 0.000699
NP_441557.1_5 Reverse -37 -46 19.9609 0.000699
NP_441557.1_5 Reverse -217 -226 10.2261 0.0144
NP_441557.1_5 Forward -226 -217 10.1278 0.0188
NP_441557.1_8 Forward -37 -27 12.4676 0.236
NP_441445.1_1 Reverse -86 -105 7.27595 0.136
NP_441445.1_1 Reverse -28 -47 0.982764 0.264
NP_441590.1_4 Forward -68 -49 2.55527 0.293
NP_441590.1_4 Forward -120 -101 1.96529 0.299
NP_442066.2_4 Reverse -37 -56 0.786102 0.16
NP_442066.2_4 Forward -46 -27 -2.95047 0.215
NP_442066.2_9 Forward -50 -37 9.85238 0.159
NP_442777.1_3 Forward -77 -59 3.16499 0.274
NP_441308.1_8 Forward -48 -38 12.4681 0.218
NP_440101.1_3 Reverse -87 -106 7.47261 0.175
NP_440101.1_3 Reverse -32 -51 5.70265 0.19
NP_442830.1_5 Forward -77 -63 4.22722 0.239
NP_442469.1_6 Forward -28 -9 23.9922 0.0186
NP_442469.1_8 Reverse -40 -54 14.4542 0.276
NP_442183.1_1 Forward -46 -32 15.2409 0.0228
NP_442183.1_1 Reverse -37 -51 10.521 0.0829
NP_442183.1_1 Reverse -217 -231 5.99778 0.193
NP_442183.1_9 Reverse -86 -96 18.5646 0.206
NP_442135.1_3 Forward -58 -39 4.71934 0.274
NP_441574.1_1 Reverse -25 -44 -2.36049 0.226
NP_441574.1_1 Reverse -316 -335 -3.54046 0.239
NP_441574.1_1 Forward -46 -27 -5.70374 0.267
NP_441549.1_9 Reverse -33 -51 -0.374176 0.14
NP_441549.1_9 Reverse -85 -103 -9.32229 0.245
NP_441549.1_9 Forward -50 -32 -9.71562 0.258
NP_440540.1_2 Reverse -83 -102 6.68596 0.271
NP_442347.1_2 Forward -45 -36 3.34298 0.284
NP_442347.1_2 Reverse -38 -47 3.34298 0.284
NP_442645.1_2 Forward -48 -29 -8.85033 0.133
NP_442645.1_2 Reverse -29 -48 -22.715 0.293
NP_441037.1_4 Reverse -35 -45 18.9151 0.00351
NP_441037.1_4 Forward -48 -38 16.5761 0.0168
NP_442594.1_8 Reverse -104 -123 9.73422 0.186
NP_442594.1_8 Reverse -50 -69 8.75091 0.202
NP_442594.1_8 Reverse -58 -77 1.96607 0.295
NP_442594.1_8 Reverse -101 -120 1.57275 0.299
NP_442317.1_6 Forward -51 -32 3.14605 0.264
NP_441633.1_3 Forward -48 -35 6.01747 0.0481
NP_441633.1_3 Reverse -35 -48 -3.52063 0.177
NP_441633.1_3 Forward -103 -90 -6.07724 0.236
NP_440136.1_2 Forward -45 -38 15.9687 0.0123
NP_440136.1_2 Reverse -38 -45 15.9687 0.0123
NP_440136.1_2 Reverse -218 -225 6.23397 0.171
NP_440136.1_2 Forward -225 -218 6.13563 0.193
NP_442590.1_9 Forward -105 -86 5.30933 0.273
NP_442590.1_10 Forward -46 -27 5.99764 0.254
NP_442998.1_10 Forward -224 -217 15.5754 0.0102
NP_442998.1_10 Forward -44 -37 15.5754 0.0102
NP_442998.1_10 Reverse -39 -46 15.5754 0.0102
NP_442998.1_10 Reverse -219 -226 5.84064 0.235
NP_442998.1_10 Reverse -371 -378 4.07068 0.276
NP_440899.1_1 Reverse -72 -91 12.5063 0.148
NP_440899.1_2 Forward -57 -38 13.175 0.106
NP_440299.1_1 Reverse -33 -46 16.2433 0.0109
NP_440299.1_1 Forward -230 -217 13.0967 0.0319
NP_440299.1_1 Forward -382 -369 10.4418 0.0573
NP_440299.1_1 Forward -102 -89 7.49186 0.112
NP_440299.1_1 Forward -50 -37 4.44361 0.207
NP_441799.1_1 Reverse -33 -47 9.43874 0.0922
NP_440640.1_6 Reverse -16 -35 4.81767 0.212
NP_442802.1_6 Reverse -216 -235 2.26107 0.204
NP_441007.1_10 Forward -51 -38 12.409 0.0499
NP_441007.1_10 Reverse -32 -45 11.4257 0.064
NP_442334.1_1 Reverse -25 -44 -1.96717 0.174
NP_442334.1_1 Forward -58 -39 -4.81876 0.259
NP_442334.1_2 Reverse -27 -44 -12.0559 0.297
NP_442334.1_2 Reverse -58 -75 -13.2358 0.297
NP_442334.1_2 Reverse -51 -68 -14.0225 0.297
NP_442333.2_5 Reverse -26 -45 -13.2752 0.255
NP_442333.2_5 Forward -237 -218 -14.4552 0.275
NP_442333.2_5 Forward -41 -22 -15.0452 0.288
NP_440256.1_1 Reverse -214 -233 16.7157 0.00588
NP_440256.1_1 Forward -229 -210 4.81767 0.0411
NP_440256.1_1 Reverse -34 -53 -6.68705 0.217
NP_440256.1_1 Forward -49 -30 -6.88371 0.223
NP_440087.1_1 Reverse -28 -47 -5.40875 0.249
NP_441512.1_4 Forward -50 -31 9.83255 0.237
NP_441559.1_8 Forward -35 -21 -4.13031 0.217
NP_441559.1_8 Reverse -32 -46 -6.58858 0.279
NP_441559.1_8 Forward -51 -37 -7.57189 0.295
NP_440915.1_6 Forward -50 -36 21.8291 0.00352
NP_440915.1_6 Reverse -33 -47 16.5192 0.0183
NP_440915.1_6 Forward -230 -216 2.75286 0.112
NP_440915.1_6 Reverse -213 -227 1.76955 0.131
NP_441296.1_9 Forward -75 -62 13.49 0.214
NP_441296.1_9 Reverse -190 -203 10.2451 0.271
NP_440717.1_1 Reverse -38 -57 15.4374 0.13
NP_440717.1_3 Forward -80 -66 7.27547 0.28
NP_442069.1_6 Forward -260 -241 10.5209 0.139
NP_442069.1_7 Forward -171 -152 10.3234 0.291
NP_442967.1_2 Forward -103 -84 12.1925 0.254
NP_442452.1_8 Forward -104 -90 15.6336 0.273
NP_442866.1_1 Reverse -32 -51 -8.94866 0.285
NP_440657.1_5 Forward -202 -183 20.7473 0.0145
NP_441464.1_8 Forward -46 -32 13.0776 0.151
NP_441464.1_10 Reverse -111 -125 8.25939 0.286
NP_440787.1_5 Forward -144 -130 10.521 0.256
NP_441939.1_3 Reverse -38 -57 15.3391 0.0592
NP_441939.1_3 Reverse -123 -142 9.14423 0.153
NP_441939.1_3 Forward -45 -26 6.58763 0.231
NP_441199.1_6 Forward -50 -31 9.53756 0.0859
NP_441199.1_6 Reverse -33 -52 0.58944 0.24
NP_441494.1_6 Reverse -32 -45 20.4721 0.0343
NP_441494.1_6 Forward -51 -38 7.09911 0.267
NP_442386.1_9 Forward -227 -218 10.029 0.142
NP_442386.1_9 Forward -47 -38 6.39082 0.219
NP_442386.1_9 Reverse -36 -45 6.39082 0.219
NP_442386.1_9 Forward -62 -53 5.30919 0.257
NP_441750.1_1 Reverse -53 -72 -7.67036 0.267
NP_441750.1_4 Forward -34 -15 2.55606 0.254
NP_441750.1_7 Reverse -28 -38 13.8447 0.254
NP_441340.1_5 Forward -45 -38 15.6737 0.0124
NP_441340.1_5 Reverse -38 -45 15.6737 0.0124
NP_441340.1_5 Reverse -218 -225 13.5105 0.0314
NP_441340.1_5 Forward -225 -218 5.84064 0.208
NP_442484.1_2 Reverse -206 -225 -0.295539 0.26
NP_440168.1_9 Forward -48 -29 -4.81876 0.296
NP_442506.1_2 Reverse -206 -225 3.34271 0.278
NP_442240.1_2 Reverse -38 -57 -12.5869 0.163
NP_440586.1_1 Reverse -27 -46 2.16274 0.227
NP_440586.1_1 Reverse -85 -104 -2.36049 0.251
NP_440586.1_1 Reverse -30 -49 -3.14714 0.263
NP_440586.1_1 Reverse -372 -391 -4.03212 0.277
NP_440586.1_1 Reverse -21 -40 -6.1954 0.297
NP_440586.1_8 Forward -45 -38 13.2151 0.026
NP_440586.1_8 Reverse -38 -45 13.2151 0.026
NP_440586.1_8 Forward -225 -218 9.47853 0.146
NP_440586.1_8 Reverse -218 -225 5.74197 0.283
NP_442251.1_6 Forward -45 -38 15.2804 0.0124
NP_442251.1_6 Reverse -38 -45 15.2804 0.0124
NP_440192.1_4 Reverse -49 -68 14.4426 0.169
NP_440969.1_3 Forward -110 -92 6.40989 0.294
NP_441262.1_3 Reverse -217 -224 14.7888 0.0223
NP_441262.1_3 Reverse -37 -44 14.7888 0.0223
NP_441262.1_3 Forward -46 -39 14.7888 0.0223
NP_440027.1_3 Forward -46 -28 15.7513 0.0944
NP_440027.1_3 Forward -122 -104 13.293 0.136
NP_440027.1_3 Reverse -21 -39 10.6381 0.171
NP_440027.1_3 Forward -104 -86 5.1316 0.246
NP_440027.1_3 Forward -93 -75 4.34495 0.262
NP_440027.1_3 Forward -40 -22 3.75497 0.267
NP_440027.1_3 Forward -98 -80 2.08335 0.293
NP_440027.1_3 Forward -56 -38 1.98502 0.295
NP_443051.1_1 Forward -47 -38 19.5676 0.00335
NP_443051.1_1 Reverse -36 -45 18.0926 0.00402
NP_443051.1_1 Reverse -216 -225 16.6177 0.00754
NP_443051.1_1 Forward -227 -218 0.589713 0.143
NP_439937.1_8 Reverse -26 -45 1.57275 0.226
NP_439937.1_8 Forward -174 -155 -4.22878 0.28
NP_439937.1_8 Reverse -81 -100 -4.32711 0.283
NP_439937.1_9 Forward -47 -30 -6.45167 0.157
NP_439937.1_9 Reverse -36 -53 -16.1864 0.287
NP_439937.1_9 Forward -64 -47 -16.678 0.287
NP_441595.1_5 Reverse -30 -48 10.9339 0.217
NP_440408.1_7 Forward -46 -27 7.07928 0.292
NP_440408.1_10 Reverse -31 -50 7.07928 0.209
NP_440439.1_1 Forward -49 -36 12.3107 0.0255
NP_440439.1_1 Reverse -34 -47 10.639 0.0362
NP_440439.1_1 Reverse -214 -227 1.49425 0.153
NP_440439.1_1 Forward -90 -77 -1.849 0.285
NP_442239.1_8 Reverse -109 -128 8.55425 0.249
NP_442239.1_8 Reverse -376 -395 7.07928 0.262
NP_442239.1_8 Reverse -85 -104 5.60432 0.269
NP_439943.1_1 Reverse -322 -341 -7.4737 0.253
NP_440372.1_2 Forward -45 -38 16.3621 0.0124
NP_440372.1_2 Reverse -38 -45 16.3621 0.0124
NP_440372.1_2 Reverse -218 -225 13.8055 0.0214
NP_440372.1_2 Forward -225 -218 6.52896 0.188
NP_440574.1_7 Reverse -128 -147 9.83255 0.283
NP_442783.1_8 Forward -66 -47 13.5683 0.295
NP_441789.1_7 Forward -120 -101 6.48849 0.193
NP_441789.1_7 Forward -55 -36 3.83357 0.193
NP_441789.1_7 Forward -123 -104 1.27698 0.245
NP_441789.1_7 Forward -69 -50 -2.16459 0.257
NP_441789.1_7 Forward -92 -73 -2.8529 0.264
NP_441789.1_7 Forward -70 -51 -3.04956 0.268
NP_440316.1_10 Forward -372 -362 12.7631 0.214
NP_440316.1_10 Reverse -150 -160 7.05986 0.251
NP_440316.1_10 Reverse -43 -53 6.07655 0.271
NP_441803.1_2 Forward -51 -32 10.4225 0.0865
NP_441803.1_2 Forward -383 -364 8.65258 0.112
NP_441803.1_2 Reverse -32 -51 0.786102 0.244
NP_439977.1_5 Forward -52 -33 13.9625 0.0531
NP_439977.1_5 Reverse -31 -50 -0.885524 0.236
NP_442368.1_10 Reverse -109 -128 19.174 0.237
NP_440139.1_1 Reverse -211 -230 9.34008 0.0996
NP_441572.1_7 Forward -52 -33 0.0977854 0.174
NP_440267.1_2 Reverse -212 -226 11.4053 0.125
NP_442384.1_10 Forward -46 -33 13.4906 0.0197
NP_442384.1_10 Reverse -217 -230 7.98409 0.0711
NP_442384.1_10 Reverse -37 -50 1.9859 0.24
NP_442384.1_10 Forward -98 -85 0.215946 0.297
NP_440693.1_8 Forward -201 -182 15.9291 0.229
NP_440693.1_8 Reverse -84 -103 11.8975 0.283
NP_442035.1_8 Forward -125 -111 21.9274 0.0784
NP_441877.1_7 Forward -57 -38 -0.787962 0.299
NP_441018.1_7 Reverse -27 -46 8.65258 0.241
NP_442790.1_4 Reverse -28 -47 2.0644 0.0729
NP_442458.1_1 Reverse -237 -256 13.175 0.13
NP_442262.1_10 Forward -45 -38 14.1988 0.0123
NP_442262.1_10 Reverse -38 -45 14.1988 0.0123
NP_442262.1_10 Forward -225 -218 13.2155 0.0213
NP_441689.1_5 Forward -228 -218 13.0576 0.0844
NP_441689.1_5 Forward -48 -38 8.43603 0.132
NP_441689.1_5 Reverse -215 -225 5.78111 0.197
NP_440163.1_10 Reverse -25 -35 16.4013 0.0762
NP_440344.1_10 Forward -53 -36 -0.649475 0.0444
NP_440344.1_10 Reverse -30 -47 -1.53445 0.0547
NP_440282.1_10 Reverse -27 -46 -5.70374 0.25
NP_440282.1_10 Forward -179 -160 -8.752 0.263
NP_440531.1_6 Forward -54 -35 5.01433 0.118
NP_440531.1_6 Reverse -152 -171 -2.36049 0.249
NP_441965.1_3 Reverse -27 -46 3.53937 0.182
NP_440297.1_9 Forward -45 -35 9.51814 0.0917
NP_440297.1_9 Reverse -38 -48 -0.314959 0.282
NP_440297.1_9 Reverse -218 -228 -0.41329 0.283
NP_440350.1_5 Reverse -263 -282 -0.590531 0.187
NP_442280.1_10 Forward -79 -61 12.5647 0.177
NP_442280.1_10 Forward -80 -62 7.49983 0.268
NP_441592.1_4 Forward -75 -56 6.58763 0.124
NP_441896.1_3 Reverse -28 -47 11.8975 0.0816
NP_440894.1_10 Reverse -32 -51 11.3075 0.147
NP_440894.1_10 Forward -51 -32 10.0292 0.155
NP_443036.1_1 Forward -41 -22 9.04509 0.287
YP_680420.1_1 Forward -48 -29 7.66927 0.257
NP_442067.1_4 Forward -57 -38 4.916 0.244
NP_440999.1_9 Forward -50 -36 11.701 0.0438
NP_440999.1_9 Reverse -33 -47 9.43936 0.0639
NP_440999.1_9 Forward -102 -88 1.27789 0.168
NP_440999.1_9 Forward -105 -91 0.294584 0.189
NP_440888.1_2 Reverse -37 -51 19.9601 0.000906
NP_440888.1_2 Forward -226 -212 13.5686 0.027
NP_440888.1_2 Forward -98 -84 12.2903 0.0476
NP_440888.1_2 Reverse -217 -231 11.4053 0.0681
NP_440888.1_2 Forward -46 -32 11.012 0.0783
NP_440888.1_2 Forward -75 -61 8.06211 0.172
NP_442892.1_9 Reverse -265 -279 14.8469 0.293
NP_440600.1_4 Forward -54 -36 -7.45401 0.291
NP_442147.1_7 Reverse -104 -123 11.9958 0.233
NP_440491.1_1 Reverse -34 -53 23.3873 0.011
NP_440052.1_5 Reverse -26 -45 -5.01543 0.271
NP_442277.1_4 Forward -55 -36 10.3234 0.0949
NP_442277.1_4 Reverse -28 -47 3.53858 0.223
NP_442033.1_10 Forward -48 -29 -5.70374 0.18
NP_442033.1_10 Reverse -35 -54 -6.88371 0.186
NP_441123.1_6 Forward -71 -53 10.6389 0.215
NP_441917.1_2 Reverse -75 -93 7.39397 0.288
NP_441543.1_2 Reverse -38 -47 15.9293 0.00518
NP_441543.1_2 Forward -45 -36 9.34117 0.0818
NP_441543.1_2 Reverse -218 -227 7.57121 0.113
NP_441543.1_2 Forward -225 -216 6.09625 0.153
NP_441543.1_3 Forward -64 -50 10.6187 0.212
NP_442845.1_2 Reverse -31 -45 8.55439 0.193
NP_442845.1_2 Reverse -89 -103 8.06273 0.195
NP_442845.1_2 Reverse -217 -231 7.66941 0.195
NP_442845.1_2 Reverse -15 -29 6.78443 0.202
NP_442845.1_2 Forward -52 -38 3.8345 0.275
NP_442845.1_2 Forward -46 -32 3.44117 0.29
NP_441551.1_5 Reverse -33 -49 7.53099 0.245
NP_441178.1_6 Forward -107 -88 5.01354 0.268
NP_441319.1_5 Forward -45 -26 8.94757 0.273
NP_441918.1_7 Reverse -112 -131 -1.67217 0.297
NP_441258.1_9 Reverse -34 -53 8.65258 0.239
NP_440982.1_1 Forward -75 -56 11.2084 0.209
NP_441469.1_8 Reverse -36 -45 13.3727 0.073
NP_441469.1_8 Forward -47 -38 6.5879 0.227
NP_442315.1_1 Reverse -149 -167 5.62401 0.256
NP_442315.1_1 Forward -253 -235 2.96908 0.294
NP_443064.1_6 Forward -46 -36 13.8273 0.0796
NP_443064.1_6 Reverse -217 -227 11.4034 0.13
NP_443064.1_6 Reverse -37 -47 10.8217 0.13
NP_443064.1_6 Forward -226 -216 8.6886 0.276
NP_442578.1_5 Forward -96 -77 3.53937 0.257
NP_442578.1_7 Forward -45 -38 14.5921 0.026
NP_442578.1_7 Reverse -38 -45 14.5921 0.026
NP_442578.1_7 Reverse -218 -225 6.0373 0.18
NP_440710.1_1 Forward -54 -36 2.87075 0.119
NP_440710.1_1 Forward -386 -368 0.21581 0.163
NP_440710.1_2 Forward -327 -308 14.0608 0.198
NP_441462.1_2 Reverse -37 -47 20.2362 0.000805
NP_441462.1_2 Forward -46 -36 20.1379 0.000967
NP_441462.1_2 Forward -226 -216 10.4031 0.011
NP_441462.1_2 Reverse -217 -227 9.81313 0.0143
NP_441462.1_2 Forward -378 -368 -0.41329 0.225
NP_441621.1_7 Reverse -35 -49 12.3893 0.0393
NP_441621.1_7 Forward -48 -34 -2.95034 0.188
NP_443062.1_1 Reverse -37 -55 9.42349 0.134
NP_443062.1_1 Forward -226 -208 7.66836 0.17
NP_443062.1_1 Reverse -217 -235 6.40076 0.202
NP_440519.1_8 Reverse -22 -38 5.36841 0.21
NP_440519.1_8 Reverse -89 -105 4.97508 0.21
NP_442204.1_1 Forward -50 -39 2.61528 0.266
NP_442204.1_1 Reverse -213 -224 2.02529 0.266
NP_442204.1_1 Reverse -33 -44 0.746988 0.281
NP_441560.1_6 Reverse -73 -92 11.7992 0.292
NP_442487.1_5 Forward -47 -28 8.4551 0.198
NP_440516.1_8 Reverse -217 -226 16.9127 0.00442
NP_440516.1_8 Forward -46 -37 16.9127 0.00442
NP_440516.1_8 Reverse -37 -46 16.9127 0.00442
NP_440516.1_8 Forward -226 -217 14.8477 0.00685
NP_442428.1_4 Reverse -36 -55 1.86774 0.278
NP_442428.1_5 Forward -45 -38 15.8704 0.0124
NP_442428.1_5 Reverse -38 -45 15.8704 0.0124
NP_442428.1_5 Reverse -218 -225 6.13563 0.209
NP_442428.1_5 Forward -225 -218 6.0373 0.212
NP_440783.1_5 Reverse -22 -41 -0.000545616 0.209
NP_441790.1_3 Reverse -38 -57 2.94938 0.153
NP_442120.1_10 Reverse -31 -50 -6.1954 0.207
NP_440603.1_9 Forward -174 -155 1.76941 0.278
NP_440673.1_2 Reverse -27 -46 20.9252 0.0267
NP_440673.1_2 Reverse -359 -378 8.24345 0.275
NP_440673.1_3 Forward -224 -217 12.4288 0.0426
NP_440673.1_3 Forward -44 -37 12.4288 0.0426
NP_440673.1_3 Reverse -39 -46 12.4288 0.0426
NP_440673.1_7 Forward -57 -38 7.86593 0.137
NP_440673.1_7 Forward -389 -370 5.80098 0.169
NP_440865.1_9 Reverse -31 -50 2.3594 0.116
NP_440865.1_9 Forward -52 -33 0.491109 0.138
NP_441052.1_2 Reverse -217 -227 10.4031 0.0285
NP_441052.1_2 Forward -46 -36 10.4031 0.0285
NP_441052.1_2 Reverse -37 -47 10.4031 0.0285
NP_441052.1_2 Forward -98 -88 5.48657 0.116
NP_441052.1_2 Forward -122 -112 4.69992 0.149
NP_441052.1_2 Forward -226 -216 0.57002 0.256
NP_442219.1_8 Reverse -27 -46 9.51997 0.23
NP_442219.1_9 Forward -45 -36 8.25953 0.0681
NP_442219.1_9 Reverse -38 -47 8.25953 0.0681
NP_442219.1_9 Reverse -218 -227 8.06287 0.0696
NP_440592.1_8 Forward -266 -247 10.3242 0.296
NP_440436.1_4 Forward -45 -36 15.9289 0.00508
NP_440436.1_4 Reverse -38 -47 9.24241 0.0871
NP_440436.1_4 Reverse -218 -227 7.66912 0.124
NP_441884.1_8 Reverse -36 -55 1.37609 0.138
NP_441884.1_8 Reverse -73 -92 -6.39206 0.223
NP_441884.1_9 Reverse -34 -53 5.40766 0.0236
NP_441884.1_9 Forward -49 -30 -2.55715 0.0594
NP_441884.1_9 Reverse -49 -68 -22.3217 0.277
NP_442086.1_4 Forward -241 -222 14.1832 0.271
NP_442902.1_1 Reverse -317 -336 16.6174 0.279
NP_440314.1_9 Forward -45 -26 -5.31042 0.221
NP_440314.1_9 Forward -225 -206 -5.40875 0.223
NP_440314.1_9 Forward -69 -50 -6.58872 0.23
NP_442907.1_2 Forward -45 -27 15.2604 0.169
NP_441719.1_4 Forward -45 -38 16.3621 0.0124
NP_441719.1_4 Reverse -38 -45 16.3621 0.0124
NP_441719.1_4 Reverse -218 -225 6.82395 0.0855
NP_441719.1_4 Forward -225 -218 6.52896 0.188
NP_441733.1_10 Forward -49 -36 16.3422 0.047
NP_441004.1_1 Reverse -31 -50 -8.35868 0.2
NP_441004.1_1 Reverse -86 -105 -8.85033 0.204
NP_441004.1_1 Reverse -72 -91 -15.0452 0.271
NP_441004.1_1 Reverse -107 -126 -15.8318 0.279
NP_441004.1_1 Reverse -16 -35 -17.2085 0.29
NP_441004.1_2 Reverse -26 -45 1.37609 0.22
NP_442813.1_4 Reverse -265 -284 -2.95047 0.287
NP_442813.1_4 Reverse -239 -258 -8.752 0.299
NP_441034.1_4 Forward -51 -32 21.3106 0.0574
NP_441034.1_4 Forward -92 -73 15.0363 0.235
NP_442873.1_3 Forward -41 -22 6.78348 0.22
NP_440296.1_10 Reverse -34 -53 -3.3438 0.209
NP_440296.1_10 Reverse -49 -68 -13.2752 0.269
NP_441729.1_5 Reverse -47 -66 18.4857 0.148
NP_441115.1_4 Reverse -216 -234 8.96649 0.229
NP_441115.1_4 Reverse -36 -54 7.68819 0.278
NP_442854.1_6 Reverse -217 -236 5.99764 0.238
NP_440328.1_4 Forward -52 -33 3.73603 0.174
NP_440328.1_8 Forward -101 -82 17.1656 0.249
NP_443054.1_2 Reverse -35 -49 4.91614 0.24
NP_443054.1_2 Forward -228 -214 2.06454 0.245
NP_443054.1_2 Forward -48 -34 0.786239 0.254
NP_442430.1_10 Forward -56 -37 11.995 0.245
NP_442308.1_3 Reverse -86 -105 12.0942 0.251
NP_441851.1_5 Reverse -66 -85 8.45592 0.23
NP_441851.1_10 Reverse -36 -46 17.4829 0.0027
NP_441851.1_10 Forward -47 -37 8.53483 0.114
NP_441851.1_10 Forward -227 -217 5.97822 0.19
NP_442208.1_5 Reverse -22 -41 2.55606 0.248
NP_442622.1_1 Forward -47 -28 -12.7836 0.276
NP_442622.1_8 Forward -46 -28 -18.6637 0.243
NP_441501.1_9 Forward -39 -20 14.1583 0.281
NP_442856.1_7 Reverse -28 -47 0.491109 0.194
NP_441668.1_4 Forward -236 -217 8.25926 0.145
NP_441668.1_4 Reverse -75 -94 0.0977854 0.247
NP_442515.1_1 Forward -47 -33 5.60446 0.107
NP_442515.1_1 Reverse -36 -50 -2.55701 0.277
NP_440593.1_3 Forward -51 -32 19.5673 0.0616
NP_440593.1_3 Forward -45 -26 -5.60541 0.264
NP_440463.1_8 Forward -114 -95 5.56364 0.277
NP_440165.1_5 Reverse -36 -55 -6.39206 0.234
NP_441349.1_10 Forward -236 -217 -7.08038 0.242
NP_441349.1_10 Reverse -376 -395 -8.752 0.278
NP_441349.1_10 Reverse -79 -98 -8.94866 0.28
NP_441409.1_6 Forward -232 -213 -9.34199 0.182
NP_441409.1_6 Reverse -31 -50 -11.3086 0.217
NP_440432.1_9 Reverse -38 -53 16.8928 0.00961
NP_440432.1_9 Forward -225 -210 12.2713 0.0258
NP_442843.1_1 Reverse -44 -63 -1.27885 0.192
NP_442843.1_1 Reverse -29 -48 -11.3086 0.288
NP_439960.1_5 Reverse -86 -105 15.4374 0.151
NP_440474.1_8 Reverse -38 -52 7.86545 0.196
NP_440396.1_7 Reverse -363 -382 15.3382 0.283
NP_441477.1_10 Forward -233 -215 8.67227 0.181
NP_442450.1_5 Reverse -35 -45 10.1081 0.115
NP_442168.1_6 Reverse -226 -245 12.6841 0.202
NP_440588.1_2 Reverse -57 -76 0.392778 0.147
NP_440195.1_4 Forward -238 -219 17.2074 0.0483
NP_440195.1_4 Forward -390 -371 5.50599 0.284
NP_440954.1_1 Reverse -116 -135 -11.7019 0.295
NP_440954.1_1 Forward -226 -207 -12.0953 0.295
NP_442006.1_2 Reverse -60 -77 -6.54933 0.164
NP_442006.1_2 Forward -371 -354 -8.90928 0.197
NP_442006.1_2 Reverse -22 -39 -15.1041 0.215
NP_442006.1_2 Reverse -28 -45 -15.8908 0.23
NP_441003.1_9 Forward -55 -36 3.6377 0.291
NP_443047.1_7 Reverse -38 -57 5.99764 0.228
NP_440483.1_1 Reverse -39 -58 -5.21209 0.223
NP_442243.1_1 Reverse -211 -229 2.08335 0.204
NP_441570.1_1 Reverse -37 -55 18.112 0.00322
NP_441570.1_1 Forward -46 -28 -8.43732 0.112
NP_441570.1_1 Reverse -217 -235 -9.42063 0.137
NP_441570.1_1 Forward -226 -208 -11.0923 0.187
NP_441078.1_4 Forward -46 -37 19.6659 0.0007
NP_441078.1_4 Reverse -37 -46 19.6659 0.0007
NP_441078.1_4 Reverse -217 -226 9.93116 0.0203
NP_441078.1_4 Forward -226 -217 9.83282 0.0226
NP_441078.1_4 Reverse -369 -378 -1.18024 0.237
NP_441078.1_4 Reverse -89 -98 -1.77023 0.266
NP_441078.1_4 Forward -98 -89 -1.77023 0.266
NP_442729.1_5 Reverse -112 -122 8.1415 0.248
NP_442729.1_8 Reverse -33 -46 9.06573 0.125
NP_442729.1_8 Forward -230 -217 8.27909 0.125
NP_442348.1_2 Reverse -136 -145 9.53783 0.28
NP_442443.1_1 Reverse -45 -64 1.37609 0.205
NP_442443.1_1 Reverse -29 -48 -4.91709 0.28
NP_442443.1_1 Reverse -143 -162 -5.11376 0.281
NP_442443.1_1 Forward -205 -186 -5.80207 0.285
NP_440526.1_3 Reverse -38 -49 11.6612 0.0646
NP_440526.1_3 Forward -45 -34 11.3662 0.0646
NP_440526.1_3 Forward -111 -100 5.76138 0.233
NP_441432.1_8 Forward -47 -38 16.8143 0.00595
NP_441432.1_8 Reverse -216 -225 14.0611 0.0258
NP_441432.1_8 Reverse -36 -45 8.35786 0.0755
NP_441432.1_8 Forward -227 -218 6.98123 0.112
NP_442320.1_8 Forward -52 -38 5.60446 0.0334
NP_442320.1_8 Forward -232 -218 2.45787 0.0775
NP_442320.1_8 Reverse -31 -45 -0.787057 0.0817
NP_442320.1_8 Reverse -211 -225 -4.13031 0.148
NP_441732.1_2 Forward -50 -34 4.28677 0.0141
NP_441732.1_2 Reverse -33 -49 -6.23465 0.0495
NP_441732.1_2 Forward -270 -254 -16.4611 0.167
NP_440497.1_2 Forward -45 -26 9.3409 0.208
NP_440321.1_1 Reverse -313 -330 11.1502 0.283
NP_442003.1_9 Reverse -53 -72 9.43923 0.219
NP_440760.1_1 Forward -46 -27 4.71934 0.0156
NP_440760.1_1 Reverse -37 -56 -13.1769 0.0989
NP_440760.1_1 Reverse -160 -179 -23.1083 0.283
NP_442797.1_1 Forward -114 -95 -1.37718 0.236
NP_442797.1_7 Forward -106 -88 7.00065 0.198
NP_442797.1_7 Reverse -82 -100 3.46073 0.234
NP_442797.1_7 Forward -105 -87 0.314141 0.276
NP_442797.1_7 Forward -54 -36 -0.669169 0.284
NP_440131.1_2 Reverse -211 -230 8.35759 0.279
NP_440578.1_8 Reverse -106 -125 12.8808 0.238
NP_441805.1_2 Forward -57 -38 5.01433 0.119
NP_440913.1_1 Reverse -35 -53 11.7205 0.168
NP_440913.1_1 Reverse -87 -105 6.60732 0.224
NP_442751.1_2 Forward -123 -104 5.2102 0.261
NP_441072.1_2 Reverse -84 -103 6.98095 0.261
NP_440713.1_4 Reverse -27 -46 9.93088 0.135
NP_440713.1_4 Reverse -79 -98 7.96426 0.174
NP_440713.1_4 Reverse -241 -260 5.01433 0.218
NP_440713.1_4 Forward -56 -37 2.75272 0.257
NP_442489.1_7 Forward -46 -37 20.1576 0.000695
NP_442489.1_7 Reverse -37 -46 20.1576 0.000695
NP_442489.1_7 Forward -226 -217 10.5211 0.0102
NP_442489.1_7 Reverse -217 -226 10.4228 0.0151
NP_442489.1_7 Reverse -89 -98 -1.27858 0.185
NP_442489.1_7 Reverse -369 -378 -1.96689 0.28
NP_440941.1_1 Reverse -51 -61 17.9746 0.127
NP_440559.1_1 Forward -45 -36 17.306 0.00658
NP_440559.1_1 Reverse -218 -227 14.651 0.0144
NP_440559.1_1 Reverse -38 -47 8.65285 0.0586
NP_442763.1_8 Reverse -87 -106 1.37609 0.283
NP_441659.2_8 Reverse -37 -47 20.9245 0.000805
NP_441659.2_8 Forward -46 -36 19.3512 0.000966
NP_441659.2_8 Forward -226 -216 17.7779 0.00179
NP_441659.2_8 Reverse -217 -227 8.63316 0.0405
NP_441659.2_8 Forward -98 -88 3.32329 0.164
NP_442749.1_5 Forward -197 -180 12.562 0.166
NP_440284.1_9 Forward -330 -311 7.37428 0.247
NP_440363.1_9 Reverse -22 -40 15.0638 0.2
NP_442913.1_10 Forward -55 -36 4.03102 0.0942
NP_442913.1_10 Reverse -28 -47 -1.18052 0.167
NP_442913.1_10 Reverse -208 -227 -2.0655 0.182
NP_441800.1_7 Forward -103 -85 8.27895 0.113
NP_441800.1_7 Forward -130 -112 1.69077 0.204
NP_441800.1_7 Forward -127 -109 0.510803 0.212
NP_441800.1_7 Forward -121 -103 -2.63579 0.264
NP_442776.1_1 Forward -340 -321 4.62101 0.274
NP_440779.1_5 Reverse -37 -54 -5.27103 0.14
NP_442346.1_5 Reverse -36 -46 17.9746 0.00128
NP_442346.1_5 Forward -47 -37 16.303 0.00248
NP_442346.1_5 Reverse -216 -226 7.15819 0.178
NP_442346.1_5 Forward -227 -217 6.8632 0.188
NP_442346.1_10 Reverse -149 -168 -1.7705 0.294
NP_440545.1_3 Forward -50 -33 19.705 0.00859
NP_440545.1_3 Reverse -33 -50 19.6067 0.00859
NP_440545.1_3 Forward -102 -85 -0.747806 0.157
NP_440545.1_3 Reverse -68 -85 -4.77938 0.232
NP_440545.1_3 Forward -395 -378 -6.64766 0.285
NP_440545.1_5 Reverse -109 -126 4.6604 0.244
NP_440831.1_3 Reverse -28 -47 15.9007 0.104
NP_441629.1_3 Forward -105 -86 4.12856 0.218
NP_441629.1_3 Forward -53 -34 -3.34455 0.277
NP_440743.1_8 Forward -225 -206 15.7316 0.215
NP_440486.1_6 Reverse -53 -72 14.5524 0.207
NP_440486.1_6 Reverse -54 -73 7.37428 0.271
NP_440459.1_2 Reverse -215 -232 18.0334 0.0733
NP_440459.1_2 Forward -278 -261 9.28195 0.23
NP_440459.1_2 Reverse -80 -97 7.217 0.299
NP_441653.1_2 Reverse -26 -45 12.0334 0.105
NP_441653.1_2 Forward -57 -38 3.14308 0.274
NP_440010.1_4 Reverse -27 -46 3.34192 0.22
NP_440010.1_4 Forward -56 -37 -1.08295 0.267
NP_440010.1_4 Forward -126 -107 -1.77127 0.268
NP_442900.1_1 Reverse -54 -73 -5.9004 0.238
NP_440847.1_3 Forward -114 -100 14.4536 0.202
NP_442603.1_7 Reverse -217 -231 21.3367 0.00504
NP_442603.1_7 Forward -46 -32 11.307 0.117
NP_442603.1_7 Forward -215 -201 6.88214 0.226
NP_440449.1_6 Forward -54 -36 12.3409 0.115
NP_440449.1_6 Reverse -29 -47 9.03394 0.188
NP_440449.1_6 Forward -70 -52 6.89415 0.239
NP_441833.1_4 Forward -45 -38 15.9687 0.0124
NP_441833.1_4 Reverse -38 -45 15.9687 0.0124
NP_441833.1_4 Forward -225 -218 6.52896 0.0924
NP_441833.1_4 Reverse -218 -225 6.23397 0.163
NP_442060.1_10 Reverse -87 -106 19.0757 0.168
NP_442162.1_9 Forward -45 -38 16.2637 0.0124
NP_442162.1_9 Reverse -38 -45 16.2637 0.0124
NP_442162.1_9 Forward -225 -218 12.9205 0.0282
NP_442162.1_9 Reverse -218 -225 12.9205 0.0282
NP_440671.1_4 Reverse -22 -36 11.6026 0.129
NP_440671.1_4 Forward -232 -218 7.07942 0.227
NP_440671.1_5 Forward -109 -95 17.0102 0.138
NP_442404.1_9 Forward -43 -29 8.55376 0.296
NP_440224.1_1 Reverse -206 -225 11.6025 0.0566
NP_442140.1_3 Forward -45 -35 14.828 0.0433
NP_442140.1_3 Reverse -38 -48 7.94484 0.124
NP_442140.1_3 Reverse -114 -124 6.96153 0.156
NP_442723.1_1 Forward -102 -83 3.34192 0.278
NP_441671.1_10 Reverse -206 -225 6.4893 0.205
NP_440875.1_9 Reverse -39 -49 16.8403 0.0145
NP_440875.1_9 Forward -224 -214 15.867 0.0233
NP_441813.1_5 Forward -228 -218 12.7631 0.0192
NP_441813.1_5 Reverse -35 -45 8.92815 0.0347
NP_441813.1_5 Forward -48 -38 8.73149 0.0367
NP_441813.1_5 Reverse -215 -225 8.4365 0.0432
NP_441813.1_7 Forward -125 -111 23.1067 0.0379
NP_440590.1_4 Forward -45 -32 12.999 0.013
NP_440590.1_4 Reverse -38 -51 12.704 0.013
NP_440590.1_4 Reverse -22 -35 10.934 0.0235
NP_440590.1_4 Reverse -218 -231 10.4424 0.027
NP_440590.1_9 Reverse -61 -79 7.09898 0.262
NP_440567.1_1 Forward -45 -31 17.8958 0.0153
NP_440567.1_1 Reverse -38 -52 16.0275 0.0166
NP_440567.1_4 Reverse -50 -69 0.58944 0.281
NP_440567.1_4 Reverse -119 -138 -0.39387 0.291
NP_442497.1_1 Forward -266 -247 7.66846 0.287
NP_442497.1_10 Forward -45 -36 19.8626 0.00532
NP_442497.1_10 Reverse -38 -47 17.601 0.00813
NP_442497.1_10 Forward -225 -216 7.76787 0.0731
NP_442497.1_10 Reverse -218 -227 0.688044 0.141
NP_440821.1_4 Reverse -35 -45 19.5479 0.00399
NP_440821.1_4 Forward -48 -38 10.7964 0.0146
NP_440821.1_4 Forward -228 -218 8.4365 0.0503
NP_441239.1_9 Forward -48 -36 18.4269 0.0114
NP_441239.1_9 Reverse -35 -47 14.4936 0.0272
NP_441239.1_9 Forward -72 -60 6.62715 0.182
NP_441239.1_9 Forward -106 -94 3.77555 0.276
NP_441239.1_9 Reverse -215 -227 3.2839 0.289
NP_441239.1_9 Forward -228 -216 3.08724 0.296
NP_441951.1_4 Reverse -31 -50 10.9142 0.228
NP_441951.1_4 Reverse -100 -119 1.47442 0.283
NP_441951.1_9 Forward -54 -35 2.85105 0.254
NP_441951.1_9 Forward -103 -84 1.17943 0.254
NP_442691.1_7 Forward -123 -104 7.27514 0.286
NP_442568.1_5 Forward -343 -324 8.84924 0.297
NP_441727.1_3 Reverse -30 -49 4.62101 0.262
NP_441892.1_1 Forward -55 -38 20.3934 0.0169
NP_441892.1_1 Reverse -28 -45 18.8201 0.0211
NP_440604.1_6 Reverse -37 -56 -5.40875 0.275
NP_442044.1_1 Forward -51 -32 -12.7836 0.273
NP_442044.1_1 Forward -136 -117 -14.3569 0.289
NP_442193.1_1 Reverse -22 -40 10.5406 0.228
NP_442270.1_9 Reverse -26 -45 -8.35868 0.217
NP_440219.1_4 Forward -365 -352 17.6735 0.157
NP_442643.1_1 Reverse -83 -102 -11.2103 0.231
NP_442216.1_4 Reverse -356 -364 8.1805 0.255
NP_440949.1_7 Reverse -23 -42 7.96345 0.298
NP_440354.1_5 Reverse -230 -249 2.65439 0.251
NP_442138.1_5 Forward -278 -259 13.1758 0.276
NP_442138.1_10 Reverse -37 -56 0.687771 0.139
NP_440412.1_1 Reverse -83 -102 16.4207 0.0792
NP_442809.1_6 Reverse -66 -85 2.16274 0.267
NP_440546.1_4 Reverse -37 -47 13.5365 0.0459
NP_440546.1_4 Forward -46 -36 12.8578 0.0572
NP_440546.1_4 Reverse -217 -227 11.0156 0.0991
NP_440546.1_4 Forward -226 -216 10.9186 0.101
NP_439974.1_4 Forward -57 -38 12.4875 0.227
NP_442349.1_6 Forward -396 -377 1.0811 0.22
NP_441230.1_5 Forward -51 -32 15.9291 0.0583
NP_441230.1_5 Reverse -212 -231 4.81767 0.185
NP_441230.1_5 Forward -92 -73 1.0811 0.253
NP_440462.1_4 Reverse -76 -90 13.5693 0.169
NP_440462.1_6 Forward -48 -38 19.4496 0.00371
NP_440462.1_6 Reverse -35 -45 10.4031 0.0396
NP_440462.1_6 Reverse -215 -225 9.22315 0.049
NP_440462.1_6 Forward -228 -218 4.79825 0.183
NP_442611.1_1 Reverse -37 -56 -2.85214 0.295
NP_440868.1_4 Reverse -213 -225 5.25052 0.102
NP_440868.1_4 Reverse -33 -45 3.2839 0.137
NP_440868.1_4 Forward -50 -38 0.432302 0.212
NP_442499.1_3 Forward -47 -29 3.55906 0.289
NP_441474.1_1 Forward -96 -77 3.14526 0.242
NP_441474.1_1 Forward -123 -104 0.785326 0.253
NP_441474.1_1 Forward -93 -74 -2.45958 0.277
NP_442402.1_4 Reverse -221 -240 -8.16275 0.278
NP_441084.1_6 Forward -373 -359 12.6407 0.158
NP_441084.1_6 Reverse -215 -229 12.2528 0.165
NP_439942.1_7 Reverse -76 -95 1.86774 0.19
NP_440696.1_3 Reverse -103 -121 -0.472507 0.243
NP_442882.1_8 Reverse -84 -103 7.47261 0.267
NP_440843.1_8 Reverse -31 -50 12.8808 0.297
NP_442039.1_4 Forward -45 -38 15.1821 0.0124
NP_442039.1_4 Reverse -38 -45 15.1821 0.0124
NP_442039.1_4 Reverse -218 -225 11.6422 0.0747
NP_442039.1_7 Forward -369 -359 9.61647 0.257
NP_441811.1_8 Reverse -31 -45 20.7474 0.0214
NP_441811.1_8 Reverse -110 -124 8.45605 0.238
NP_442380.1_10 Reverse -27 -45 7.29564 0.29
NP_442409.1_10 Reverse -232 -246 15.5352 0.293
NP_440825.1_6 Reverse -75 -94 10.4225 0.285
NP_440825.1_6 Reverse -105 -124 9.73422 0.285
NP_442837.1_3 Forward -45 -38 15.7721 0.0124
NP_442837.1_3 Reverse -38 -45 15.7721 0.0124
NP_442837.1_3 Forward -82 -75 7.11894 0.173
NP_442837.1_3 Forward -225 -218 6.0373 0.25
NP_442837.1_3 Reverse -218 -225 6.0373 0.25
NP_442053.1_1 Forward -46 -37 18.3876 0.0007
NP_442053.1_1 Reverse -37 -46 18.3876 0.0007
NP_442053.1_1 Forward -226 -217 16.6177 0.00257
NP_442053.1_1 Reverse -217 -226 8.65285 0.0741
NP_440505.1_3 Reverse -215 -225 15.6147 0.0106
NP_440505.1_3 Forward -48 -38 15.418 0.0114
NP_440505.1_3 Reverse -35 -45 7.84651 0.147
NP_440505.1_3 Forward -228 -218 6.46988 0.18
NP_440505.1_3 Reverse -87 -97 5.48657 0.227
NP_440505.1_7 Reverse -85 -104 -0.4922 0.271
NP_441203.1_1 Reverse -218 -237 -14.8485 0.205
NP_442532.1_7 Forward -46 -32 7.76774 0.171
NP_441408.2_7 Forward -177 -158 0.196116 0.228
NP_441408.2_7 Forward -48 -29 -0.590531 0.234
NP_440914.1_1 Reverse -37 -47 16.3248 0.00196
NP_440914.1_1 Forward -226 -216 14.373 0.0158
NP_440914.1_1 Reverse -217 -227 13.3971 0.0303
NP_440914.1_1 Forward -46 -36 8.51751 0.186
NP_441699.1_4 Forward -365 -346 17.109 0.237
NP_441011.1_8 Reverse -38 -47 16.6177 0.00602
NP_441011.1_8 Forward -45 -36 14.356 0.0249
NP_441011.1_8 Forward -225 -216 6.78456 0.184
NP_442101.1_10 Forward -54 -35 -5.40875 0.168
NP_442533.1_1 Reverse -86 -105 -6.1954 0.163
NP_442533.1_1 Reverse -51 -70 -15.8318 0.257
NP_442533.1_1 Reverse -50 -69 -16.5201 0.271
NP_442533.1_6 Forward -46 -37 17.2076 0.00137
NP_442533.1_6 Reverse -37 -46 17.2076 0.00137
NP_442533.1_6 Forward -226 -217 14.2577 0.0132
NP_442533.1_6 Reverse -217 -226 7.47288 0.0898
NP_442533.1_6 Forward -98 -89 7.47288 0.0898
NP_442533.1_6 Reverse -89 -98 3.83464 0.202
NP_442533.1_6 Reverse -31 -40 1.57302 0.294
NP_442541.1_10 Forward -104 -90 2.35894 0.262
NP_440263.1_3 Reverse -96 -115 9.53756 0.22
NP_440263.1_3 Reverse -211 -230 3.24438 0.261
NP_442232.1_3 Reverse -87 -106 2.26107 0.103
NP_442232.1_3 Reverse -29 -48 -5.40875 0.165
NP_442232.1_3 Reverse -58 -77 -15.8318 0.296
NP_442232.1_3 Reverse -17 -36 -15.9302 0.299
NP_442322.1_4 Forward -77 -60 0.431468 0.21
NP_442322.1_4 Forward -78 -61 -3.10843 0.243
NP_442322.1_4 Forward -95 -78 -3.20676 0.243
NP_442322.1_4 Forward -101 -84 -7.72996 0.286
NP_442322.1_4 Forward -107 -90 -8.51661 0.286
NP_442322.1_9 Forward -125 -107 12.8997 0.251
NP_441219.1_4 Reverse -85 -104 8.65258 0.204
NP_441482.1_7 Forward -232 -218 6.6861 0.0269
NP_441482.1_7 Reverse -31 -45 1.17956 0.0554
NP_441482.1_7 Forward -52 -38 -10.2268 0.209
NP_439944.1_9 Reverse -38 -48 17.7779 0.00341
NP_439944.1_9 Forward -45 -35 17.4829 0.00423
NP_439944.1_9 Reverse -218 -228 9.7148 0.1
NP_441028.1_6 Forward -109 -99 4.10949 0.278
NP_442202.1_10 Forward -170 -156 16.7159 0.106
NP_442202.1_10 Forward -63 -49 6.19444 0.255
NP_440116.1_8 Reverse -218 -237 10.8159 0.0291
NP_441527.1_4 Forward -279 -260 -7.40105 0.232
NP_440115.1_6 Reverse -34 -44 18.2696 0.0139
NP_440115.1_6 Forward -49 -39 7.84651 0.146
NP_440115.1_6 Forward -101 -91 5.28991 0.259
NP_440115.1_6 Reverse -214 -224 4.89658 0.28
NP_440007.1_9 Forward -230 -216 0.786239 0.29
NP_441347.1_5 Reverse -60 -74 9.04542 0.278
NP_441059.1_2 Forward -375 -356 4.32602 0.127
NP_443045.1_5 Reverse -73 -86 15.8981 0.197
NP_441602.1_3 Reverse -32 -51 17.994 0.0354
NP_441602.1_3 Forward -51 -32 -1.67217 0.23
NP_441602.1_3 Reverse -84 -103 -4.91709 0.277
NP_441602.1_4 Forward -57 -38 22.7139 0.0651
NP_441170.1_4 Reverse -80 -98 4.44404 0.246
NP_441972.1_5 Reverse -38 -57 7.57094 0.0748
NP_441972.1_5 Forward -45 -26 -1.67217 0.178
NP_441972.1_5 Reverse -218 -237 -6.49039 0.231
NP_441106.1_1 Forward -47 -38 18.486 0.0028
NP_441106.1_1 Reverse -36 -45 9.73449 0.0311
NP_441106.1_1 Reverse -216 -225 8.75118 0.0469
NP_441106.1_1 Reverse -30 -39 2.85133 0.255
NP_441216.1_4 Reverse -73 -92 9.0459 0.27
NP_441216.1_5 Forward -42 -23 13.8633 0.188
NP_439903.1_6 Forward -49 -30 16.1249 0.0621
NP_439903.1_6 Reverse -214 -233 1.27698 0.249
NP_442928.1_3 Forward -378 -359 12.7098 0.256
NP_442306.1_10 Forward -51 -32 -20.0601 0.202
NP_441286.1_1 Forward -47 -35 14.7886 0.00418
NP_441286.1_1 Reverse -36 -48 5.25052 0.0259
NP_441286.1_1 Reverse -216 -228 2.49725 0.06
NP_441286.1_1 Forward -227 -215 -3.89426 0.147
NP_442674.1_3 Reverse -361 -380 4.62021 0.288
NP_442674.1_3 Forward -54 -35 2.35861 0.3
NP_440670.1_8 Forward -46 -37 18.3876 0.000699
NP_440670.1_8 Reverse -37 -46 18.3876 0.000699
NP_440670.1_8 Reverse -217 -226 18.0926 0.00136
NP_440670.1_8 Forward -226 -217 15.831 0.00494
NP_440886.1_7 Forward -47 -37 8.04271 0.0805
NP_440886.1_7 Reverse -36 -46 8.04271 0.0805
NP_440886.1_7 Forward -123 -113 7.64939 0.0865
NP_440886.1_7 Forward -227 -217 6.66608 0.115
NP_440886.1_7 Forward -38 -28 5.78111 0.163
NP_440886.1_7 Forward -76 -66 5.28945 0.188
NP_440886.1_7 Forward -99 -89 4.01116 0.255
NP_440828.1_1 Forward -120 -101 -1.67294 0.287
NP_440828.1_4 Forward -47 -28 4.42355 0.135
NP_442614.1_2 Forward -46 -32 6.58777 0.291
NP_440767.1_1 Forward -63 -44 11.1109 0.204
NP_442072.1_9 Reverse -36 -54 7.00065 0.0115
NP_442072.1_9 Reverse -216 -234 -14.5338 0.15
NP_442072.1_9 Forward -47 -29 -22.007 0.216
NP_442401.1_2 Forward -47 -28 15.4366 0.109
NP_441069.1_5 Forward -178 -160 1.49411 0.261
NP_442022.1_4 Reverse -101 -120 5.99764 0.273
NP_440907.2_8 Forward -45 -35 19.449 0.00351
NP_440907.2_8 Reverse -38 -48 19.1541 0.00362
NP_440907.2_8 Forward -225 -215 7.84605 0.117
NP_442264.1_5 Reverse -160 -174 12.291 0.253
NP_441021.1_1 Forward -45 -26 2.55606 0.083
NP_441021.1_1 Forward -86 -67 -5.80207 0.177
NP_441463.1_6 Forward -48 -34 6.02939 0.283
NP_441626.1_2 Forward -45 -38 15.7721 0.0124
NP_441626.1_2 Reverse -38 -45 15.7721 0.0124
NP_441626.1_2 Reverse -218 -225 12.2322 0.0511
NP_441626.1_2 Forward -225 -218 5.93897 0.231
NP_442221.1_4 Reverse -21 -40 10.0292 0.296
NP_442365.1_7 Forward -44 -25 -6.29373 0.289
NP_442362.1_7 Reverse -67 -85 12.6055 0.222
NP_441460.1_2 Forward -72 -59 14.4733 0.234
NP_442238.1_3 Reverse -78 -97 5.89931 0.254
NP_440107.1_5 Forward -47 -28 -1.47551 0.178
NP_442794.1_1 Forward -230 -218 14.887 0.0604
NP_442615.1_1 Forward -235 -217 -2.73412 0.148
NP_441962.1_4 Reverse -32 -51 8.65258 0.0623
NP_441962.1_4 Forward -45 -26 0.982764 0.11
NP_441962.1_5 Forward -80 -61 8.25926 0.234
NP_440387.1_1 Forward -46 -30 8.41667 0.0282
NP_440387.1_1 Reverse -37 -53 0.156866 0.131
NP_440387.1_1 Reverse -217 -233 -4.46469 0.187
NP_440387.1_1 Reverse -369 -385 -6.33298 0.279
NP_440855.1_1 Reverse -19 -38 6.19431 0.147
NP_440855.1_2 Forward -71 -52 12.4867 0.299
NP_440855.1_5 Forward -77 -58 4.62021 0.285
NP_441431.1_2 Reverse -34 -48 14.9452 0.0562
NP_441431.1_2 Forward -49 -35 11.7987 0.132
NP_441431.1_2 Forward -97 -83 9.14375 0.192
NP_441431.1_2 Forward -172 -158 6.48882 0.269
NP_441431.1_3 Reverse -77 -96 13.7658 0.162
NP_441488.1_7 Reverse -31 -50 15.7324 0.0543
NP_441488.1_7 Forward -52 -33 8.65258 0.121
NP_441836.1_2 Reverse -83 -102 14.8474 0.0629
NP_440634.1_4 Forward -379 -360 8.25926 0.257
NP_441993.1_1 Reverse -31 -50 18.2221 0.0394
NP_441993.1_1 Reverse -37 -56 14.1289 0.0786
NP_441993.1_1 Reverse -89 -108 9.06107 0.136
NP_441993.1_1 Reverse -72 -91 4.67549 0.215
NP_441993.1_1 Forward -46 -27 4.57804 0.217
NP_441174.1_1 Reverse -52 -67 11.1896 0.258
NP_440467.1_3 Forward -45 -26 17.7995 0.0604
NP_440467.1_3 Reverse -38 -57 11.1586 0.284
NP_440114.1_10 Forward -226 -212 15.5359 0.0249
NP_440114.1_10 Reverse -37 -51 10.226 0.151
NP_440114.1_10 Forward -46 -32 8.84938 0.192
NP_442323.1_7 Forward -51 -32 6.78348 0.19
NP_442323.1_7 Forward -92 -73 5.50519 0.203
NP_441206.1_2 Reverse -154 -173 11.1109 0.298
NP_442324.1_7 Forward -332 -313 8.65445 0.268
NP_440287.1_6 Forward -235 -216 9.93088 0.142
NP_440293.1_3 Reverse -82 -101 2.65439 0.195
NP_440293.1_3 Reverse -29 -48 -1.67217 0.239
NP_440293.1_9 Reverse -84 -98 19.2682 0.0935
NP_440293.1_9 Forward -75 -61 12.3106 0.243
NP_440293.1_10 Reverse -75 -94 0.58944 0.219
NP_440293.1_10 Reverse -22 -41 -1.96717 0.271
NP_440766.1_4 Forward -50 -36 14.1593 0.0339
NP_440766.1_4 Reverse -33 -47 8.06273 0.0871
NP_439988.1_7 Forward -44 -30 11.602 0.292
NP_441237.1_9 Forward -45 -35 17.2863 0.00348
NP_441979.1_5 Reverse -15 -34 -9.34199 0.228
NP_441979.1_5 Forward -46 -27 -11.1119 0.228
NP_442743.1_1 Forward -125 -106 4.22689 0.296
NP_441311.1_2 Forward -52 -38 12.8803 0.23
NP_439998.1_7 Reverse -179 -198 14.9458 0.267
NP_440457.1_1 Reverse -33 -45 17.0502 0.0455
NP_440457.1_1 Forward -50 -38 5.44718 0.141
NP_440457.1_1 Reverse -98 -110 4.16888 0.171
NP_440457.1_1 Reverse -85 -97 3.38223 0.196
NP_440457.1_1 Reverse -213 -225 1.7106 0.227
NP_440457.1_1 Reverse -102 -114 0.23564 0.25
NP_442940.1_2 Forward -46 -27 2.45773 0.276
NP_440798.1_6 Forward -45 -32 2.96921 0.158
NP_440798.1_6 Forward -225 -212 2.2809 0.182
NP_440798.1_6 Reverse -38 -51 1.9859 0.188
NP_441801.1_4 Forward -57 -47 2.63497 0.29
NP_440942.1_6 Forward -107 -88 6.29183 0.259
NP_441984.1_3 Reverse -213 -231 17.7187 0.0928
NP_441332.1_6 Forward -38 -28 13.6798 0.184
NP_441332.1_6 Forward -76 -66 13.4862 0.184
NP_441332.1_6 Forward -105 -95 13.1957 0.19
NP_441332.1_6 Forward -62 -52 11.9372 0.239
NP_441332.1_6 Forward -63 -53 10.8723 0.282
NP_441436.1_8 Reverse -101 -120 15.4374 0.215
NP_442509.1_5 Forward -38 -21 13.8044 0.259
NP_442509.1_8 Forward -36 -20 18.0524 0.184
NP_442509.1_9 Forward -46 -36 17.3841 0.00128
NP_442509.1_9 Reverse -37 -47 8.04271 0.192
NP_442509.1_9 Reverse -21 -31 7.74772 0.205
NP_442509.1_9 Forward -61 -51 6.76441 0.254
NP_442784.1_3 Reverse -90 -109 11.8975 0.291
NP_441253.1_7 Forward -108 -90 5.91901 0.287
NP_440524.1_2 Forward -29 -10 9.63589 0.146
NP_442514.1_5 Forward -77 -58 -5.50783 0.26
NP_441440.1_8 Reverse -25 -38 13.9823 0.299
NP_440554.1_4 Reverse -38 -48 15.418 0.0199
NP_440554.1_4 Forward -225 -215 15.0247 0.02
NP_440554.1_4 Forward -45 -35 6.27322 0.123
NP_441885.1_5 Reverse -217 -227 18.6629 0.00274
NP_441885.1_5 Forward -46 -36 11.3864 0.00668
NP_441885.1_5 Reverse -37 -47 11.3864 0.00668
NP_441885.1_5 Forward -226 -216 1.55333 0.109
NP_441885.1_5 Forward -98 -88 -0.118297 0.186
NP_441428.1_8 Reverse -29 -48 8.25926 0.206
NP_442341.1_7 Reverse -36 -50 10.521 0.0625
NP_442341.1_7 Forward -47 -33 10.226 0.0678
NP_442341.1_7 Reverse -368 -382 6.48943 0.126
NP_442341.1_7 Reverse -216 -230 5.50613 0.154
NP_442341.1_9 Reverse -215 -229 12.2903 0.108
NP_441756.1_5 Reverse -33 -52 6.29264 0.175
NP_441756.1_5 Forward -79 -60 -0.197208 0.242
NP_441756.1_5 Reverse -27 -46 -4.91709 0.297
NP_440409.1_1 Forward -54 -35 2.0644 0.18
NP_440423.1_6 Reverse -209 -228 -4.81876 0.131
NP_440423.1_6 Reverse -29 -48 -11.8003 0.184
NP_443000.1_7 Forward -48 -38 10.7964 0.0345
NP_443000.1_7 Reverse -215 -225 10.5998 0.0345
NP_443000.1_7 Forward -228 -218 7.25653 0.0927
NP_443000.1_7 Reverse -35 -45 2.14332 0.226
NP_441842.1_1 Forward -44 -31 14.375 0.11
NP_441842.1_10 Forward -53 -39 18.2892 0.0173
NP_441842.1_10 Reverse -30 -44 10.521 0.161
NP_440275.1_3 Reverse -35 -45 19.5479 0.00756
NP_440275.1_3 Forward -48 -38 18.6629 0.0082
NP_440275.1_3 Reverse -215 -225 13.5497 0.0268
NP_440091.1_1 Forward -50 -38 3.2839 0.163
NP_440091.1_1 Reverse -33 -45 0.825626 0.227
NP_442275.1_1 Forward -98 -79 5.99764 0.264
NP_440679.1_10 Reverse -21 -40 -21.535 0.294
NP_443010.1_10 Forward -49 -32 5.18664 0.207
NP_441359.1_5 Reverse -34 -53 0.982764 0.29
NP_442451.1_2 Reverse -29 -48 10.0292 0.0755
NP_442451.1_2 Forward -54 -35 0.491109 0.153
NP_439962.1_4 Forward -39 -20 5.30933 0.176
NP_439962.1_4 Reverse -29 -48 1.27776 0.197
NP_439962.1_4 Forward -48 -29 -6.98204 0.286
NP_439962.1_4 Forward -45 -26 -8.752 0.298
NP_439962.1_4 Forward -64 -45 -9.047 0.298
NP_440175.1_4 Reverse -35 -54 -3.24547 0.122
NP_440880.1_6 Reverse -344 -363 12.4867 0.286
NP_440149.1_8 Reverse -217 -236 -1.18052 0.157
NP_440149.1_8 Forward -46 -27 -5.21209 0.221
NP_440149.1_8 Reverse -89 -108 -7.08038 0.272
NP_440149.1_10 Reverse -37 -56 -11.5053 0.285
NP_441105.1_3 Reverse -26 -45 -1.7705 0.151
NP_441105.1_3 Forward -57 -38 -2.85214 0.169
NP_440216.1_1 Forward -226 -212 23.4024 0.000687
NP_440216.1_1 Reverse -37 -51 7.9644 0.00737
NP_440216.1_1 Forward -46 -32 -1.27871 0.0303
NP_440216.1_1 Reverse -217 -231 -10.6202 0.145
NP_440216.1_1 Reverse -386 -400 -12.6851 0.296
NP_440172.1_1 Reverse -37 -47 17.5813 0.00421
NP_440172.1_1 Forward -46 -36 16.303 0.00854
NP_440172.1_1 Forward -226 -216 14.6313 0.011
NP_440172.1_1 Reverse -217 -227 5.28991 0.146
NP_440167.1_3 Reverse -27 -46 15.0441 0.151
NP_442015.1_10 Reverse -33 -46 13.4906 0.0354
NP_442015.1_10 Forward -230 -217 7.6891 0.08
NP_441226.1_7 Forward -45 -38 14.4934 0.0123
NP_441226.1_7 Reverse -38 -45 14.4934 0.0123
NP_441226.1_7 Reverse -218 -225 12.7234 0.0312
NP_441226.1_7 Forward -225 -218 11.5435 0.0757
NP_441111.1_7 Forward -45 -37 18.7023 0.00294
NP_441111.1_7 Reverse -38 -46 18.7023 0.00294
NP_441111.1_7 Reverse -218 -226 8.96754 0.0463
NP_441111.1_7 Forward -225 -217 8.86921 0.0589
NP_442379.1_10 Forward -53 -36 7.41366 0.102
NP_442379.1_10 Reverse -30 -47 -2.41943 0.23
NP_441766.1_2 Forward -46 -37 17.5026 0.00297
NP_441766.1_2 Reverse -37 -46 17.5026 0.00297
NP_441766.1_2 Forward -226 -217 13.9627 0.0114
NP_441766.1_2 Reverse -217 -226 7.76787 0.0714
NP_441766.1_9 Reverse -45 -64 2.55606 0.237
NP_440416.1_1 Forward -226 -207 -11.8003 0.272
NP_440416.1_9 Forward -105 -86 -8.26035 0.112
NP_440416.1_9 Forward -53 -34 -13.2752 0.164
NP_440416.1_9 Forward -41 -22 -15.0452 0.184
NP_440416.1_9 Forward -233 -214 -16.5201 0.216
NP_443052.1_8 Reverse -27 -46 -7.96535 0.166
NP_443052.1_9 Forward -63 -44 1.0811 0.186
NP_443052.1_9 Forward -105 -86 -0.4922 0.211
NP_443052.1_9 Forward -102 -83 -4.03212 0.254
NP_443052.1_9 Forward -44 -25 -5.80207 0.274
NP_440072.1_5 Reverse -104 -122 7.98396 0.234
NP_440591.1_9 Reverse -30 -48 13.6872 0.0931
NP_440591.1_9 Reverse -67 -85 4.14905 0.288
NP_442154.1_1 Reverse -108 -126 -14.1405 0.217
NP_442154.1_1 Reverse -23 -41 -15.3205 0.218
NP_442154.1_1 Reverse -143 -161 -15.5171 0.22
NP_442154.1_1 Reverse -105 -123 -16.0088 0.229
NP_442154.1_1 Reverse -51 -69 -17.1888 0.249
NP_442154.1_1 Reverse -75 -93 -18.6637 0.284
NP_442154.1_1 Reverse -96 -114 -18.7621 0.285
NP_442154.1_1 Reverse -50 -68 -19.0571 0.289
NP_441430.1_6 Reverse -26 -45 12.1925 0.238
NP_442564.1_10 Forward -71 -57 11.2093 0.266
NP_440261.1_5 Forward -45 -32 7.09911 0.0316
NP_440261.1_5 Reverse -38 -51 -1.16069 0.0662
NP_440261.1_5 Forward -168 -155 -12.3704 0.284
NP_440261.1_5 Reverse -90 -103 -12.3704 0.284
NP_440988.1_10 Forward -100 -86 13.9024 0.158
NP_440988.1_10 Forward -106 -92 3.83388 0.277
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAACAGGAGTGCGACACCCTACGGCGACAGACCATGGGGGAACTAGAGCAAATCAAGCAAGTTACCCATCAGGAAATCCAACAGTTTCGTCAGCAAACTGTGCAGGAATGTGAAGCCCTACAAAAACAAACGGAACAGGAAGCCACCGAAATGCAGAGGGATGTGGATACCTATGCCGATCGCCTGTTGAGCCGCCTGGAAGGAGAATTAGGGCAAATGATGCGCAGTGTGAGCCAAAGCCGCCAGATCCTCTACGAAAATTCCGCTGAACATAACGCCACCATCACCAACCGTCCCCCCGTGGCCACCCCCAGCCCAGTGCTCCCGCCTTCCCCTGGCCCCAAACCCCCCAGAGGCGATCGCCCCCGCCGCCGTTCCCGTTAAGCTGAAGTAAGTTATT

CDS

GTGTCATTGAATCTAGACAAAGATAATCGCGACCTATCGTCAAACCAGGGGCATTTAGGGGAATTTCGTCGGGGGTTAGAAAATTGGCCCCCAGGTTTGGTTTGGCAACCTGACGGGGAACAGATTGAGGCCATGGTCAAGCTCTACCAAGGAGTCCTGGTCGGTAATGCCCGCTTGAATTTGACCCGCATTACCGCTCCCCTGGATTTCCTAGAAAAACACCTTTGGGATTCCCTGGCGGGGGTTTTATTGTCGGACCATAGCCGTAATTGCCCCCAAGCTCGGGTGATCGACATTGGCACTGGGGGAGGATTCCCTGGATTGCCAGTGGCCTTGGTGTGGCCCCAGTGGTCTGTGGCCCTGTTGGATTCCACCCATAAAAAAATTAACTATCTAGAGGAATTGGGGCACCGTTTGGGCTTAGCTAATTTGGCCTATCTGGTGGCCAGGGCGGAAGCTGTGGGGAACCAGCCCCAGCATCGCTCCCAGTATGATTTGGCTTTAATTCGGGCCGTGGGAGAGGGGGTTGTCTGTGCGGAATATGCCCTACCTTTGGTGAAGGTGGGGGGCACGGTGGTGCTTTACCGGGGTCAATGGTCAGCGGCGGAAGCAGAACAATTGGAACGGGCCTGCGCTCTATTGGGGGGCAAAGTCAGTGCCACGGTGGCAGCCGTTACCCCCTGGAGTGGGGCCCAGCGACACTTTATCTATCTAACCAAGGAAAAACCTACTCCCAGTGATTTTCCCCGGGCGATCGGAGTACCCCGTTCCCATCCCTTGGGGGTGGAGAATTAA

Protein

MSLNLDKDNRDLSSNQGHLGEFRRGLENWPPGLVWQPDGEQIEAMVKLYQGVLVGNARLNLTRITAPLDFLEKHLWDSLAGVLLSDHSRNCPQARVIDIGTGGGFPGLPVALVWPQWSVALLDSTHKKINYLEELGHRLGLANLAYLVARAEAVGNQPQHRSQYDLALIRAVGEGVVCAEYALPLVKVGGTVVLYRGQWSAAEAEQLERACALLGGKVSATVAAVTPWSGAQRHFIYLTKEKPTPSDFPRAIGVPRSHPLGVEN