Your browser is old and dusty. Try Google Chrome!

Details for slr0069

ORF slr0069
Accession NP_442229.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -232 -218 15.6342 0.104
NP_441061.1_2 Forward -16 -2 8.16106 0.0927
NP_441061.1_2 Reverse -224 -238 4.32615 0.151
NP_441061.1_2 Reverse -193 -207 3.04785 0.168
NP_441061.1_2 Reverse -337 -351 0.982901 0.196
NP_441061.1_2 Forward -128 -114 0.687908 0.202
NP_441061.1_2 Forward -44 -30 -1.08205 0.249
NP_441061.1_2 Reverse -160 -174 -2.06536 0.281
NP_440795.1_7 Forward -44 -37 14.6904 0.0123
NP_440795.1_7 Reverse -37 -44 14.6904 0.0123
NP_440795.1_7 Forward -283 -276 6.92228 0.26
NP_440795.1_7 Forward -161 -154 5.74231 0.279
NP_441418.1_6 Forward -232 -213 -26.9432 0.201
NP_441418.1_6 Forward -45 -26 -28.8115 0.211
NP_442291.1_5 Reverse -222 -238 -2.5964 0.221
NP_441453.1_4 Reverse -36 -44 16.539 0.00633
NP_441453.1_4 Forward -45 -37 16.539 0.00633
NP_441453.1_4 Reverse -223 -231 7.19758 0.0757
NP_441453.1_4 Reverse -153 -161 6.90259 0.121
NP_441453.1_4 Forward -232 -224 6.80426 0.121
NP_441453.1_4 Forward -162 -154 6.70593 0.121
NP_442151.1_6 Reverse -36 -50 12.0943 0.0818
NP_441818.1_1 Reverse -154 -165 10.9729 0.21
NP_441818.1_9 Forward -345 -326 -0.590531 0.196
NP_441818.1_9 Forward -342 -323 -9.44032 0.291
NP_440226.1_1 Forward -232 -213 3.93269 0.209
NP_440226.1_1 Forward -45 -26 3.83436 0.212
NP_440996.1_3 Forward -337 -319 9.36059 0.281
NP_442287.1_1 Reverse -228 -238 14.7292 0.256
NP_442173.1_1 Forward -44 -36 15.4574 0.00633
NP_442173.1_1 Reverse -37 -45 15.4574 0.00633
NP_442173.1_1 Reverse -154 -162 11.7208 0.034
NP_442173.1_1 Forward -231 -223 7.68924 0.142
NP_442173.1_1 Forward -161 -153 7.49257 0.171
NP_442173.1_1 Forward -150 -142 6.01761 0.2
NP_442173.1_1 Reverse -224 -232 5.72262 0.203
NP_442752.1_4 Forward -232 -225 13.8055 0.0199
NP_442752.1_4 Forward -45 -38 13.8055 0.0199
NP_442752.1_4 Reverse -36 -43 13.8055 0.0199
NP_442752.1_4 Forward -336 -329 7.90559 0.144
NP_443027.1_4 Forward -234 -224 10.2065 0.138
NP_443027.1_4 Reverse -293 -303 7.94484 0.223
NP_443027.1_4 Forward -164 -154 7.35486 0.24
NP_443027.1_4 Forward -47 -37 7.25653 0.24
NP_443027.1_4 Forward -240 -230 5.97822 0.294
NP_443027.1_4 Reverse -34 -44 5.87989 0.294
NP_441812.1_3 Reverse -35 -49 7.47274 0.272
NP_442975.1_10 Reverse -32 -46 11.5037 0.0497
NP_442975.1_10 Reverse -291 -305 5.70218 0.212
NP_442975.1_10 Reverse -219 -233 3.44058 0.259
NP_442975.1_10 Forward -49 -35 2.06395 0.284
NP_440784.1_7 Forward -44 -37 15.9687 0.0123
NP_440784.1_7 Reverse -37 -44 15.9687 0.0123
NP_440784.1_7 Reverse -154 -161 6.43063 0.218
NP_440784.1_7 Forward -231 -224 6.23397 0.241
NP_440784.1_7 Forward -161 -154 6.23397 0.241
NP_440784.1_7 Reverse -224 -231 6.13563 0.241
NP_441250.1_3 Forward -195 -176 7.07928 0.212
NP_440061.1_9 Reverse -190 -204 9.73373 0.14
NP_440061.1_9 Reverse -272 -286 6.29216 0.251
NP_440061.1_9 Reverse -221 -235 6.29216 0.251
NP_441054.1_4 Reverse -143 -161 1.98577 0.169
NP_439979.1_9 Forward -243 -225 8.18062 0.269
NP_442062.1_8 Forward -45 -35 19.4496 0.000558
NP_442062.1_8 Forward -232 -222 16.6963 0.00399
NP_442062.1_8 Reverse -36 -46 10.3048 0.0493
NP_442062.1_8 Forward -162 -152 7.55152 0.0946
NP_442062.1_8 Reverse -153 -163 5.5849 0.163
NP_442062.1_8 Reverse -223 -233 5.09324 0.184
NP_440761.1_4 Forward -356 -337 -12.9802 0.257
NP_441900.1_2 Reverse -324 -342 -4.2098 0.288
NP_440304.1_4 Forward -164 -154 16.6963 0.0199
NP_440304.1_4 Forward -47 -37 10.8948 0.051
NP_440304.1_4 Forward -332 -322 4.99491 0.239
NP_440304.1_4 Reverse -34 -44 1.84832 0.299
NP_442242.1_4 Forward -44 -37 14.3954 0.0124
NP_442242.1_4 Reverse -37 -44 14.3954 0.0124
NP_442242.1_4 Reverse -154 -161 13.3138 0.027
NP_442242.1_4 Reverse -224 -231 10.8555 0.127
NP_442242.1_4 Forward -303 -296 10.7572 0.153
NP_440044.1_8 Reverse -37 -56 3.53937 0.128
NP_441035.1_3 Reverse -375 -394 2.16274 0.227
NP_440307.1_8 Forward -123 -104 13.4708 0.177
NP_441208.1_9 Forward -48 -34 7.76774 0.219
NP_441594.1_6 Reverse -226 -245 1.27776 0.269
NP_441594.1_6 Reverse -321 -340 0.786102 0.281
NP_441109.1_3 Reverse -314 -333 9.43841 0.251
NP_442110.1_7 Reverse -36 -50 2.2612 0.222
NP_442110.1_7 Forward -129 -115 1.86788 0.222
NP_442110.1_7 Reverse -223 -237 1.17956 0.236
NP_442110.1_7 Reverse -262 -276 1.08123 0.239
NP_441925.1_4 Reverse -329 -348 -15.6359 0.269
NP_440856.1_4 Forward -52 -33 5.50599 0.0852
NP_440856.1_7 Reverse -192 -211 2.0644 0.157
NP_441083.1_5 Forward -45 -35 11.3864 0.0159
NP_441083.1_5 Reverse -36 -46 11.2881 0.0159
NP_441083.1_5 Reverse -153 -163 7.25653 0.0608
NP_441083.1_5 Forward -151 -141 5.38824 0.12
NP_441083.1_5 Reverse -223 -233 1.74999 0.198
NP_441083.1_5 Forward -162 -152 0.176696 0.241
NP_442827.1_4 Reverse -332 -351 15.7316 0.064
NP_441434.1_7 Forward -43 -29 1.76955 0.295
NP_441738.1_2 Reverse -225 -232 15.28 0.0102
NP_441738.1_2 Forward -43 -36 15.28 0.0102
NP_441738.1_2 Reverse -38 -45 15.28 0.0102
NP_441738.1_2 Reverse -155 -162 13.3134 0.0335
NP_441738.1_2 Reverse -122 -129 8.29857 0.176
NP_441558.1_5 Forward -164 -145 6.09597 0.229
NP_441558.1_5 Forward -234 -215 4.71934 0.271
NP_441558.1_5 Forward -47 -28 4.32602 0.283
NP_440209.1_1 Reverse -36 -44 18.1123 0.00295
NP_440209.1_1 Forward -45 -37 18.1123 0.00295
NP_440209.1_1 Forward -232 -224 8.57422 0.0425
NP_440209.1_1 Forward -162 -154 8.27922 0.0687
NP_440209.1_1 Reverse -223 -231 5.32929 0.139
NP_440870.1_4 Forward -244 -226 11.0322 0.163
NP_442889.1_8 Reverse -33 -47 12.487 0.0625
NP_442889.1_8 Reverse -220 -234 3.44058 0.278
NP_441713.1_1 Reverse -30 -49 -14.1602 0.257
NP_441713.1_1 Forward -51 -32 -16.1268 0.277
NP_441713.1_8 Reverse -357 -375 7.29564 0.294
NP_441770.1_4 Forward -209 -190 -1.7705 0.186
NP_441770.1_4 Forward -143 -124 -6.68705 0.228
NP_440178.1_7 Reverse -35 -54 -20.1584 0.186
NP_440178.1_7 Forward -163 -144 -21.24 0.215
NP_441716.1_1 Forward -238 -224 10.3243 0.0963
NP_441716.1_1 Reverse -192 -206 3.04785 0.282
NP_442111.1_4 Reverse -152 -166 4.03116 0.223
NP_442111.1_4 Forward -233 -219 2.2612 0.283
NP_442111.1_4 Reverse -35 -49 1.76955 0.294
NP_441533.1_7 Reverse -308 -326 13.3914 0.296
NP_440906.1_5 Forward -44 -37 15.8704 0.0124
NP_440906.1_5 Reverse -37 -44 15.8704 0.0124
NP_440906.1_5 Reverse -154 -161 6.52896 0.199
NP_440906.1_5 Forward -231 -224 6.23397 0.234
NP_440906.1_5 Reverse -224 -231 6.13563 0.241
NP_440906.1_5 Forward -161 -154 6.0373 0.262
NP_440747.1_10 Forward -48 -36 15.2803 0.0019
NP_440747.1_10 Reverse -33 -45 5.44718 0.0137
NP_440747.1_10 Forward -235 -223 -2.32097 0.0331
NP_440747.1_10 Reverse -220 -232 -12.2524 0.254
NP_441130.1_10 Forward -164 -150 7.27608 0.164
NP_441486.1_1 Reverse -33 -47 14.5526 0.00628
NP_441486.1_1 Forward -48 -34 4.91614 0.0399
NP_441486.1_1 Reverse -220 -234 0.491246 0.134
NP_441486.1_1 Forward -235 -221 -4.52363 0.201
NP_442634.1_4 Reverse -34 -48 -1.27871 0.149
NP_442634.1_4 Forward -164 -150 -6.09693 0.299
NP_440403.1_4 Reverse -142 -161 -9.44032 0.275
NP_441014.1_8 Reverse -335 -354 -9.047 0.289
NP_442848.1_1 Forward -238 -224 -4.13031 0.282
NP_442848.1_9 Reverse -269 -288 2.16274 0.255
NP_443018.1_3 Forward -44 -37 14.8871 0.0123
NP_443018.1_3 Reverse -37 -44 14.8871 0.0123
NP_443018.1_3 Forward -231 -224 12.6255 0.0471
NP_443018.1_3 Forward -10 -3 7.6106 0.156
NP_443018.1_3 Reverse -224 -231 5.25066 0.214
NP_443018.1_3 Reverse -154 -161 5.15232 0.226
NP_443018.1_3 Forward -161 -154 5.05399 0.238
NP_441316.1_7 Reverse -34 -49 3.71647 0.137
NP_441634.1_8 Forward -234 -220 1.08123 0.209
NP_441634.1_8 Reverse -227 -241 -0.197071 0.25
NP_441634.1_8 Forward -47 -33 -4.22864 0.295
NP_440376.1_1 Forward -45 -36 19.4693 0.000692
NP_440376.1_1 Reverse -36 -45 19.4693 0.000692
NP_440376.1_1 Forward -284 -275 4.52295 0.156
NP_440376.1_1 Forward -216 -207 1.37636 0.252
NP_440376.1_1 Reverse -153 -162 0.196389 0.283
NP_440376.1_1 Forward -232 -223 -0.000272808 0.285
NP_440376.1_1 Reverse -223 -232 -0.0986038 0.285
NP_440376.1_1 Forward -162 -153 -0.196935 0.285
NP_441857.1_5 Reverse -216 -234 1.59244 0.297
NP_441857.1_5 Reverse -146 -164 1.10079 0.299
NP_441588.1_4 Forward -43 -33 16.4996 0.0369
NP_441588.1_4 Reverse -38 -48 7.05986 0.178
NP_442687.1_7 Reverse -35 -45 15.8113 0.0125
NP_442687.1_7 Forward -46 -36 9.02648 0.0994
NP_442687.1_7 Forward -163 -153 7.74818 0.125
NP_442687.1_7 Reverse -274 -284 4.89658 0.23
NP_440066.1_5 Reverse -330 -349 10.1267 0.251
NP_442485.1_3 Forward -243 -224 -1.57384 0.26
NP_442485.1_3 Reverse -190 -209 -4.72043 0.285
NP_442485.1_3 Forward -118 -99 -5.9004 0.296
NP_441846.1_10 Forward -346 -327 -21.24 0.256
NP_441846.1_10 Forward -337 -318 -22.3217 0.259
NP_441846.1_10 Reverse -8 -27 -22.6167 0.264
NP_441846.1_10 Forward -345 -326 -23.305 0.282
NP_441013.1_2 Forward -112 -94 3.3624 0.23
NP_441013.1_2 Reverse -91 -109 -3.52077 0.29
NP_441013.1_2 Reverse -218 -236 -4.8974 0.299
NP_440042.1_2 Reverse -26 -45 -1.86883 0.253
NP_441422.1_7 Reverse -221 -238 7.02034 0.0992
NP_441422.1_7 Reverse -34 -51 -3.10775 0.227
NP_440667.1_2 Forward -330 -311 0.294447 0.208
NP_441950.1_7 Forward -342 -323 -1.08219 0.191
NP_441950.1_7 Forward -225 -206 -8.65367 0.287
NP_441950.1_7 Forward -288 -269 -8.94866 0.287
NP_442296.1_5 Reverse -144 -163 5.89931 0.251
NP_442296.1_5 Reverse -333 -352 3.53937 0.251
NP_442296.1_9 Forward -44 -25 -0.295539 0.197
NP_442296.1_9 Reverse -217 -236 -3.54046 0.254
NP_441763.1_10 Reverse -25 -44 13.3716 0.121
NP_442658.1_1 Reverse -34 -44 15.9091 0.00966
NP_442658.1_1 Forward -47 -37 13.0576 0.04
NP_442658.1_1 Reverse -151 -161 7.0594 0.214
NP_442658.1_1 Reverse -221 -231 6.56775 0.224
NP_442658.1_1 Forward -164 -154 5.09279 0.284
NP_440141.1_8 Forward -327 -308 5.01433 0.278
NP_440662.1_2 Reverse -145 -164 2.0644 0.19
NP_442782.1_2 Forward -351 -337 6.48943 0.223
NP_442782.1_2 Reverse -98 -112 4.71948 0.25
NP_442782.1_2 Reverse -36 -50 3.24451 0.267
NP_442496.1_5 Reverse -9 -27 10.3439 0.217
NP_442205.1_9 Forward -238 -222 -3.8747 0.297
NP_440656.1_8 Reverse -284 -303 -2.0655 0.184
NP_442544.1_2 Forward -152 -138 -0.393733 0.22
NP_441414.1_9 Forward -45 -26 5.11266 0.0483
NP_441414.1_9 Reverse -142 -161 -6.39206 0.194
NP_440184.1_1 Reverse -362 -381 1.72772 0.263
NP_441487.1_6 Reverse -145 -164 2.16274 0.254
NP_441256.1_1 Reverse -339 -358 -6.39206 0.239
NP_441958.1_5 Forward -46 -36 21.2195 0.000805
NP_441958.1_5 Reverse -35 -45 12.2714 0.00183
NP_441958.1_5 Forward -163 -153 9.41981 0.0219
NP_441958.1_5 Forward -233 -223 1.55333 0.095
NP_441958.1_5 Reverse -152 -162 1.06167 0.116
NP_442486.1_6 Reverse -336 -355 -7.17871 0.298
NP_440203.1_5 Reverse -226 -236 12.0743 0.166
NP_440203.1_5 Reverse -195 -205 10.501 0.224
NP_439905.1_1 Reverse -230 -243 7.88576 0.241
NP_439905.1_1 Reverse -328 -341 6.21414 0.295
NP_439905.1_2 Reverse -322 -336 11.6026 0.208
NP_439905.1_3 Forward -211 -192 14.9458 0.199
NP_440984.1_7 Reverse -270 -284 10.6193 0.122
NP_440984.1_7 Reverse -31 -45 9.04604 0.131
NP_440984.1_7 Forward -243 -229 6.78443 0.2
NP_440984.1_7 Forward -50 -36 5.99778 0.231
NP_442690.1_1 Reverse -172 -191 -15.6352 0.28
NP_442911.1_2 Reverse -143 -162 2.94938 0.0472
NP_442911.1_2 Forward -21 -2 -2.16383 0.0946
NP_442911.1_2 Forward -344 -325 -7.67036 0.216
NP_441580.1_6 Reverse -212 -231 11.4058 0.0538
NP_440153.1_8 Reverse -324 -337 -3.02898 0.276
NP_440369.1_10 Reverse -103 -122 17.7974 0.181
NP_440993.1_2 Reverse -148 -164 2.91013 0.262
NP_440993.1_3 Reverse -305 -324 -1.18128 0.279
NP_440827.1_3 Reverse -108 -127 11.5042 0.268
NP_442995.1_5 Forward -50 -31 11.5042 0.211
NP_441099.1_5 Reverse -213 -232 -8.94866 0.209
NP_442002.1_9 Forward -163 -156 14.1004 0.074
NP_442002.1_9 Reverse -35 -42 10.7572 0.185
NP_441294.1_7 Reverse -32 -46 8.96266 0.269
NP_442438.1_10 Reverse -148 -162 11.7993 0.0436
NP_442438.1_10 Forward -237 -223 2.5562 0.173
NP_442431.1_10 Forward -351 -333 4.44404 0.206
NP_441752.1_6 Reverse -326 -345 -0.4922 0.279
NP_440377.1_1 Reverse -119 -136 11.3703 0.288
NP_440377.1_1 Forward -138 -121 10.7905 0.293
NP_441000.1_6 Forward -46 -32 -3.24533 0.221
NP_441000.1_6 Forward -233 -219 -3.63866 0.225
NP_441000.1_6 Reverse -35 -49 -5.31028 0.273
NP_441000.1_6 Forward -163 -149 -5.80194 0.296
NP_440605.1_4 Forward -55 -36 12.9884 0.25
NP_442771.1_1 Reverse -151 -169 -7.06068 0.169
NP_440147.1_4 Reverse -34 -47 12.114 0.0326
NP_440147.1_4 Forward -47 -34 11.7207 0.0326
NP_440147.1_4 Forward -164 -151 8.57408 0.0491
NP_441550.1_8 Forward -47 -37 15.3192 0.0132
NP_441550.1_8 Reverse -34 -44 8.3377 0.124
NP_441550.1_8 Reverse -151 -161 5.58445 0.242
NP_441550.1_8 Forward -164 -154 5.58445 0.242
NP_441916.1_7 Reverse -36 -46 18.9579 0.00144
NP_441916.1_7 Forward -45 -35 18.4663 0.00144
NP_441916.1_7 Reverse -153 -163 7.84651 0.0575
NP_441916.1_7 Reverse -223 -233 7.74818 0.0608
NP_441916.1_7 Forward -232 -222 6.66654 0.0875
NP_441916.1_7 Forward -162 -152 4.99491 0.15
NP_441916.1_10 Reverse -112 -131 11.6025 0.135
NP_441916.1_10 Forward -209 -190 -0.0988766 0.298
NP_440206.1_4 Reverse -338 -357 3.53858 0.278
NP_440206.1_4 Forward -21 -2 0.490334 0.289
NP_440465.1_7 Reverse -325 -343 12.2114 0.262
NP_440465.1_10 Forward -339 -320 5.60432 0.212
NP_441041.1_4 Forward -357 -338 1.17943 0.0814
NP_441041.1_4 Reverse -36 -55 -0.787193 0.0974
NP_441041.1_4 Forward -45 -26 -1.37718 0.1
NP_441041.1_4 Reverse -223 -242 -2.45882 0.112
NP_441041.1_4 Forward -330 -311 -4.6221 0.14
NP_441041.1_4 Forward -336 -317 -5.21209 0.15
NP_441041.1_4 Forward -351 -332 -9.44032 0.216
NP_441041.1_7 Reverse -33 -45 18.9817 0.00435
NP_441041.1_7 Forward -48 -36 14.4144 0.0348
NP_441041.1_7 Reverse -150 -162 8.97244 0.125
NP_441041.1_7 Reverse -220 -232 7.32042 0.169
NP_440016.1_9 Reverse -342 -361 12.1925 0.259
NP_442396.1_5 Reverse -32 -45 9.45906 0.129
NP_442396.1_5 Forward -236 -223 7.49244 0.196
NP_441547.1_2 Forward -295 -277 3.95239 0.263
NP_442004.1_6 Reverse -223 -237 16.7159 0.0577
NP_442004.1_6 Reverse -36 -50 4.91614 0.202
NP_442004.1_6 Reverse -229 -243 4.03116 0.227
NP_441725.1_4 Forward -50 -36 2.45727 0.287
NP_441725.1_5 Reverse -154 -164 11.2881 0.0247
NP_441725.1_5 Forward -44 -34 2.04498 0.115
NP_441725.1_5 Reverse -37 -47 1.94665 0.115
NP_441725.1_5 Reverse -224 -234 1.455 0.135
NP_441725.1_5 Forward -161 -151 -0.118297 0.232
NP_441725.1_5 Reverse -322 -332 -0.511621 0.26
NP_439966.1_7 Reverse -34 -44 9.91099 0.0968
NP_439966.1_7 Reverse -221 -231 7.45273 0.15
NP_439966.1_7 Forward -47 -37 6.27276 0.185
NP_439966.1_7 Forward -234 -224 6.0761 0.195
NP_439966.1_9 Reverse -34 -43 0.884706 0.253
NP_440736.1_3 Forward -47 -28 1.76941 0.282
NP_440202.1_8 Forward -236 -217 9.41727 0.297
NP_442941.1_3 Reverse -37 -47 11.0914 0.0116
NP_442941.1_3 Reverse -224 -234 10.1081 0.024
NP_442941.1_3 Forward -44 -34 2.63497 0.14
NP_442941.1_3 Reverse -154 -164 1.94665 0.147
NP_440289.1_2 Reverse -33 -46 5.82081 0.0605
NP_440289.1_2 Reverse -150 -163 2.57589 0.0936
NP_440289.1_2 Reverse -220 -233 1.88757 0.112
NP_440289.1_2 Forward -165 -152 -3.22564 0.267
NP_442281.1_1 Reverse -31 -45 20.4518 0.00192
NP_442281.1_1 Forward -50 -36 16.7152 0.0074
NP_442281.1_1 Reverse -218 -232 10.422 0.0589
NP_442281.1_1 Reverse -290 -304 4.71887 0.184
NP_441334.1_7 Forward -218 -199 -20.65 0.277
NP_440437.1_1 Reverse -217 -236 -2.65548 0.22
NP_442012.1_1 Reverse -30 -49 3.34271 0.18
NP_442012.1_5 Forward -358 -339 4.22769 0.261
NP_440498.1_1 Reverse -27 -45 17.6204 0.0181
NP_440498.1_1 Forward -54 -36 3.75572 0.14
NP_440375.1_8 Reverse -224 -243 -0.197208 0.266
NP_443030.1_4 Reverse -1 -20 -0.590531 0.222
NP_441644.1_6 Reverse -36 -46 19.0557 0.000803
NP_441644.1_6 Forward -45 -35 10.1076 0.0628
NP_441644.1_6 Reverse -223 -233 6.0761 0.167
NP_441644.1_6 Reverse -153 -163 3.61784 0.272
NP_441644.1_6 Reverse -229 -239 3.32285 0.288
NP_443049.1_6 Forward -233 -223 12.3241 0.24
NP_441795.1_5 Reverse -360 -379 5.99764 0.255
NP_442215.1_2 Forward -131 -115 1.82849 0.127
NP_442215.1_2 Reverse -111 -127 -0.0397962 0.159
NP_442215.1_2 Reverse -34 -50 -0.826444 0.173
NP_442215.1_2 Forward -47 -31 -2.20308 0.193
NP_442215.1_2 Reverse -273 -289 -5.64466 0.254
NP_442029.1_1 Forward -240 -221 -12.1936 0.246
NP_442029.1_1 Forward -342 -323 -19.4701 0.29
NP_442029.1_6 Forward -345 -326 5.30933 0.253
NP_442247.1_8 Forward -164 -150 10.3243 0.247
NP_440253.1_2 Forward -45 -27 -2.43913 0.268
NP_440929.1_8 Forward -45 -36 19.2726 0.000701
NP_440929.1_8 Reverse -36 -45 19.2726 0.000701
NP_440780.1_1 Reverse -50 -69 6.92274 0.289
NP_442933.1_10 Forward -45 -36 17.601 0.00325
NP_442933.1_10 Reverse -36 -45 17.601 0.00325
NP_442933.1_10 Reverse -223 -232 15.1427 0.00958
NP_442933.1_10 Reverse -153 -162 7.96454 0.0937
NP_442933.1_10 Forward -232 -223 7.96454 0.0937
NP_442933.1_10 Forward -162 -153 7.76787 0.11
NP_441751.2_8 Reverse -224 -238 23.5007 0.00466
NP_441751.2_8 Reverse -154 -168 -1.5737 0.129
NP_441751.2_8 Reverse -37 -51 -2.26202 0.132
NP_441751.2_8 Forward -44 -30 -4.03198 0.158
NP_441751.2_8 Reverse -343 -357 -5.90027 0.244
NP_442926.1_1 Forward -342 -323 1.27776 0.205
NP_442554.1_8 Reverse -37 -47 16.4013 0.0065
NP_442554.1_8 Forward -44 -34 13.2547 0.0187
NP_442554.1_8 Reverse -154 -164 12.1731 0.0287
NP_442554.1_8 Reverse -230 -240 7.15819 0.0975
NP_442554.1_8 Reverse -224 -234 6.07655 0.126
NP_441762.1_7 Forward -46 -34 10.2654 0.0142
NP_441762.1_7 Reverse -35 -47 9.47875 0.0142
NP_441762.1_7 Reverse -222 -234 -5.76255 0.238
NP_441762.1_7 Forward -337 -325 -5.95921 0.258
NP_441762.1_7 Forward -163 -151 -6.15587 0.276
NP_441762.1_7 Reverse -152 -164 -6.35254 0.284
NP_441762.1_7 Forward -229 -217 -6.84419 0.284
NP_442142.1_4 Forward -48 -35 14.1783 0.0311
NP_442142.1_4 Reverse -33 -46 13.195 0.0381
NP_442142.1_4 Forward -235 -222 12.4084 0.0458
NP_442142.1_4 Reverse -339 -352 4.64028 0.214
NP_442142.1_4 Reverse -216 -229 4.34528 0.223
NP_442292.1_1 Reverse -37 -46 17.5026 0.00435
NP_442292.1_1 Forward -44 -35 9.63616 0.0183
NP_442292.1_1 Reverse -224 -233 8.65285 0.0335
NP_442292.1_1 Reverse -154 -163 7.47288 0.0696
NP_442476.1_6 Forward -161 -147 11.5043 0.056
NP_442476.1_6 Forward -44 -30 4.91614 0.141
NP_440895.1_6 Forward -51 -38 10.4424 0.202
NP_442197.1_5 Reverse -329 -348 19.9598 0.127
NP_442381.1_8 Reverse -33 -52 -13.2752 0.268
NP_443009.1_5 Forward -46 -35 19.626 0.00102
NP_443009.1_5 Reverse -35 -46 7.82632 0.118
NP_443009.1_5 Forward -163 -152 7.62965 0.124
NP_443009.1_5 Forward -233 -222 7.53132 0.126
NP_443009.1_5 Reverse -274 -285 5.17139 0.214
NP_443009.1_5 Reverse -192 -203 5.07306 0.218
NP_443009.1_5 Reverse -152 -163 4.77807 0.23
NP_442250.1_6 Forward -358 -339 10.6192 0.262
NP_442408.2_1 Reverse -193 -212 -2.0655 0.241
NP_441715.1_4 Forward -44 -34 9.41981 0.097
NP_441715.1_4 Forward -231 -221 7.84651 0.107
NP_441715.1_4 Reverse -37 -47 7.35486 0.108
NP_441715.1_4 Reverse -154 -164 5.97822 0.165
NP_441715.1_4 Reverse -224 -234 4.99491 0.24
NP_440183.1_9 Reverse -100 -119 -14.5535 0.266
NP_440183.1_9 Forward -208 -189 -20.4534 0.286
NP_441198.1_8 Forward -240 -230 12.783 0.116
NP_441198.1_8 Forward -47 -37 12.783 0.116
NP_440379.1_5 Forward -54 -35 -11.6036 0.299
NP_441468.1_1 Forward -44 -37 15.8704 0.0124
NP_441468.1_1 Reverse -37 -44 15.8704 0.0124
NP_441468.1_1 Reverse -154 -161 13.0188 0.0383
NP_441468.1_1 Forward -231 -224 6.13563 0.209
NP_441468.1_1 Reverse -224 -231 6.0373 0.223
NP_441468.1_1 Forward -161 -154 6.0373 0.223
NP_441020.2_6 Forward -47 -30 8.10198 0.209
NP_441020.2_6 Reverse -34 -51 7.11867 0.241
NP_441015.1_10 Forward -243 -224 7.17762 0.0996
NP_441015.1_10 Forward -350 -331 -8.16202 0.272
NP_441015.1_10 Reverse -3 -22 -9.44032 0.282
NP_441015.1_10 Forward -341 -322 -10.1286 0.283
NP_441015.1_10 Forward -345 -326 -11.1119 0.291
NP_441015.1_10 Forward -237 -218 -11.6036 0.298
NP_441673.1_1 Forward -45 -36 20.8459 0.000698
NP_441673.1_1 Reverse -36 -45 20.8459 0.000698
NP_441673.1_1 Reverse -153 -162 1.37636 0.114
NP_441673.1_1 Forward -232 -223 1.27803 0.155
NP_441673.1_1 Reverse -223 -232 1.27803 0.155
NP_441673.1_1 Forward -162 -153 1.1797 0.163
NP_441673.1_1 Forward -284 -275 -8.06341 0.254
NP_441339.1_4 Forward -108 -89 -3.73712 0.237
NP_441320.1_9 Reverse -133 -152 18.0092 0.231
NP_442253.1_5 Forward -204 -187 0.333834 0.203
NP_440265.1_8 Forward -198 -180 14.3755 0.224
NP_441826.1_2 Forward -238 -224 4.12949 0.105
NP_441826.1_2 Forward -168 -154 4.12949 0.105
NP_441826.1_6 Forward -226 -212 15.4376 0.172
NP_441330.1_1 Forward -50 -31 -12.8819 0.183
NP_442811.1_2 Forward -234 -215 -0.39387 0.252
NP_442868.1_6 Forward -47 -37 0.963343 0.205
NP_442868.1_6 Reverse -34 -44 0.865012 0.205
NP_442868.1_6 Forward -234 -224 0.176696 0.247
NP_442868.1_6 Forward -164 -154 -0.41329 0.295
NP_442719.1_2 Reverse -295 -313 -10.9946 0.286
NP_441056.1_1 Reverse -223 -242 -2.95047 0.221
NP_442227.1_2 Reverse -323 -342 3.04771 0.219
NP_442227.1_2 Reverse -320 -339 2.3594 0.233
NP_442227.1_2 Reverse -317 -336 -1.57384 0.264
NP_442227.1_2 Reverse -225 -244 -2.95047 0.285
NP_443058.1_7 Forward -196 -177 13.8641 0.184
NP_442808.1_1 Reverse -35 -45 18.4657 0.00201
NP_442808.1_1 Reverse -335 -345 13.0576 0.0481
NP_442808.1_1 Forward -46 -36 8.73102 0.0481
NP_442808.1_1 Reverse -222 -232 8.63269 0.0481
NP_442808.1_1 Forward -24 -14 2.33954 0.27
NP_442775.1_6 Forward -329 -310 13.5691 0.27
NP_440145.1_3 Forward -55 -36 19.174 0.00887
NP_442718.1_2 Reverse -379 -398 -6.49039 0.295
NP_442050.1_1 Forward -337 -318 19.6656 0.116
NP_442050.1_5 Reverse -151 -161 11.4843 0.0959
NP_442050.1_5 Forward -47 -37 9.22267 0.193
NP_442050.1_5 Forward -234 -224 6.76441 0.282
NP_441493.2_10 Reverse -25 -44 4.71934 0.281
NP_441114.1_3 Forward -275 -266 7.96454 0.231
NP_441114.1_3 Forward -200 -191 7.37455 0.239
NP_440558.1_2 Forward -241 -222 12.4875 0.0772
NP_440558.1_2 Reverse -225 -244 6.39097 0.136
NP_440558.1_2 Forward -54 -35 -0.295539 0.2
NP_440558.1_2 Forward -20 -1 -1.57384 0.215
NP_440558.1_2 Forward -367 -348 -2.55715 0.229
NP_440558.1_2 Reverse -333 -352 -4.42544 0.245
NP_440558.1_2 Reverse -339 -358 -6.98204 0.284
NP_440558.1_2 Reverse -104 -123 -7.08038 0.287
NP_441878.1_6 Forward -46 -36 10.5014 0.0176
NP_441878.1_6 Reverse -35 -45 10.4031 0.0176
NP_441878.1_6 Forward -285 -275 2.63497 0.0333
NP_441878.1_6 Reverse -152 -162 0.766681 0.134
NP_441878.1_6 Forward -163 -153 0.57002 0.14
NP_441878.1_6 Reverse -274 -284 -0.118297 0.167
NP_441878.1_6 Forward -331 -321 -6.90313 0.198
NP_441878.1_6 Reverse -1 -11 -7.39479 0.222
NP_441878.1_6 Forward -337 -327 -7.78811 0.266
NP_441036.1_8 Reverse -35 -45 17.7779 0.000554
NP_441036.1_8 Forward -46 -36 15.713 0.00724
NP_441036.1_8 Reverse -222 -232 8.1415 0.176
NP_441036.1_8 Reverse -152 -162 6.66654 0.22
NP_441557.1_5 Forward -45 -36 19.9609 0.000699
NP_441557.1_5 Reverse -36 -45 19.9609 0.000699
NP_441557.1_5 Forward -232 -223 8.94785 0.0289
NP_441557.1_5 Forward -162 -153 8.84951 0.0343
NP_441557.1_5 Reverse -153 -162 0.786375 0.106
NP_441557.1_5 Reverse -223 -232 0.688044 0.128
NP_441445.1_1 Forward -241 -222 5.30933 0.172
NP_441445.1_1 Forward -54 -35 2.85105 0.226
NP_441445.1_1 Reverse -133 -152 0.0977854 0.283
NP_442066.2_9 Reverse -32 -45 9.2624 0.176
NP_442419.1_2 Reverse -218 -237 -5.01543 0.295
NP_441739.1_2 Reverse -119 -135 4.58108 0.241
NP_442830.1_5 Reverse -336 -350 -0.0993192 0.297
NP_442192.1_2 Forward -398 -379 19.469 0.17
NP_442183.1_1 Forward -45 -31 13.8643 0.0389
NP_442183.1_1 Reverse -36 -50 5.40779 0.218
NP_441407.1_5 Forward -55 -36 7.47261 0.173
NP_441549.1_1 Forward -368 -349 15.5349 0.281
NP_441549.1_9 Reverse -149 -167 -8.14232 0.221
NP_442170.1_5 Reverse -36 -55 0.786102 0.219
NP_442347.1_2 Reverse -224 -233 12.2911 0.056
NP_442347.1_2 Forward -44 -35 11.1111 0.056
NP_442347.1_2 Reverse -37 -46 3.34298 0.284
NP_442645.1_2 Forward -240 -221 10.4225 0.0177
NP_442645.1_2 Forward -53 -34 -3.04881 0.0487
NP_442645.1_2 Reverse -184 -203 -17.0118 0.246
NP_442965.1_2 Forward -237 -218 -5.9004 0.255
NP_441037.1_4 Forward -47 -37 15.0168 0.028
NP_441037.1_4 Reverse -34 -44 14.7245 0.028
NP_442594.1_8 Forward -240 -221 10.1275 0.184
NP_442594.1_8 Reverse -6 -25 2.55606 0.295
NP_442317.1_6 Reverse -31 -50 1.67108 0.298
NP_441633.1_3 Reverse -34 -47 3.36254 0.0699
NP_441633.1_3 Forward -47 -34 1.39592 0.109
NP_440136.1_2 Forward -44 -37 15.9687 0.0123
NP_440136.1_2 Reverse -37 -44 15.9687 0.0123
NP_440136.1_2 Reverse -154 -161 6.52896 0.116
NP_440136.1_2 Forward -231 -224 6.23397 0.171
NP_440136.1_2 Reverse -224 -231 6.13563 0.193
NP_440136.1_2 Forward -161 -154 6.13563 0.193
NP_442590.1_10 Forward -30 -11 3.83436 0.283
NP_442590.1_10 Reverse -330 -349 3.6377 0.289
NP_442998.1_2 Reverse -325 -344 6.1935 0.257
NP_442998.1_10 Reverse -225 -232 15.5754 0.0102
NP_442998.1_10 Forward -43 -36 15.5754 0.0102
NP_442998.1_10 Reverse -38 -45 15.5754 0.0102
NP_442998.1_10 Reverse -155 -162 12.3305 0.0564
NP_440299.1_1 Forward -236 -223 14.8666 0.0215
NP_440299.1_1 Forward -166 -153 12.9984 0.0319
NP_440299.1_1 Forward -49 -36 3.55864 0.241
NP_440299.1_1 Reverse -32 -45 2.18201 0.294
NP_441799.1_1 Forward -49 -35 19.1735 0.00693
NP_441799.1_1 Reverse -32 -46 15.5352 0.0178
NP_441799.1_1 Reverse -149 -163 6.48882 0.17
NP_441799.1_1 Forward -236 -222 5.21053 0.218
NP_440640.1_6 Forward -357 -338 -0.688862 0.292
NP_441007.1_10 Forward -50 -37 3.36254 0.182
NP_441007.1_10 Reverse -31 -44 2.87088 0.183
NP_441007.1_10 Forward -243 -230 2.08423 0.2
NP_441007.1_10 Forward -335 -322 0.0192843 0.254
NP_440256.1_1 Forward -235 -216 16.3224 0.0061
NP_440256.1_1 Forward -48 -29 -1.27885 0.102
NP_440256.1_1 Reverse -33 -52 -6.49039 0.213
NP_440087.1_1 Forward -345 -326 -4.6221 0.246
NP_440087.1_1 Forward -241 -222 -4.72043 0.246
NP_441559.1_8 Forward -206 -192 -5.90027 0.271
NP_440915.1_6 Reverse -32 -46 5.70279 0.0879
NP_440915.1_6 Reverse -219 -233 1.47456 0.138
NP_440915.1_6 Reverse -149 -163 1.08123 0.147
NP_440915.1_6 Forward -349 -335 -0.492064 0.197
NP_440915.1_6 Forward -288 -274 -2.26202 0.265
NP_440717.1_3 Reverse -156 -170 7.76712 0.28
NP_442452.1_3 Forward -369 -350 1.76941 0.282
NP_442866.1_1 Reverse -148 -167 -8.752 0.282
NP_440748.1_5 Reverse -306 -325 5.99764 0.188
NP_441464.1_2 Forward -109 -99 12.9597 0.299
NP_441464.1_8 Reverse -275 -289 5.01447 0.26
NP_441464.1_8 Forward -45 -31 3.63784 0.291
NP_441464.1_10 Forward -293 -279 14.6509 0.166
NP_440026.1_7 Reverse -229 -244 15.5162 0.208
NP_440695.1_5 Reverse -223 -242 -1.37718 0.284
NP_441939.1_3 Forward -161 -142 5.50599 0.273
NP_441494.1_6 Forward -221 -208 8.47575 0.23
NP_441494.1_6 Forward -243 -230 7.29578 0.267
NP_442993.1_1 Forward -45 -29 0.451859 0.0636
NP_442993.1_1 Reverse -36 -52 -11.1512 0.235
NP_442993.1_1 Reverse -361 -377 -11.8395 0.26
NP_440677.1_1 Forward -210 -191 13.8641 0.129
NP_442386.1_9 Reverse -35 -44 15.7322 0.0144
NP_442386.1_9 Reverse -228 -237 9.5374 0.159
NP_442386.1_9 Reverse -335 -344 8.75075 0.184
NP_442386.1_9 Reverse -222 -231 6.9808 0.219
NP_442386.1_9 Forward -46 -37 6.39082 0.219
NP_440570.1_5 Forward -361 -342 -3.3438 0.289
NP_441750.1_1 Reverse -10 -29 -5.31042 0.21
NP_441750.1_1 Forward -345 -326 -6.29373 0.234
NP_441340.1_5 Forward -44 -37 15.6737 0.0124
NP_441340.1_5 Reverse -37 -44 15.6737 0.0124
NP_441340.1_5 Forward -231 -224 6.23397 0.132
NP_441340.1_5 Reverse -154 -161 5.93897 0.198
NP_441340.1_5 Reverse -224 -231 5.84064 0.208
NP_441340.1_5 Forward -161 -154 5.84064 0.208
NP_441271.1_8 Reverse -357 -367 14.1397 0.266
NP_442484.1_2 Reverse -212 -231 5.80098 0.161
NP_442240.1_2 Forward -294 -275 -16.3235 0.244
NP_440586.1_1 Forward -343 -324 -3.24547 0.265
NP_440586.1_1 Forward -220 -201 -6.39206 0.299
NP_440586.1_8 Forward -231 -224 14.69 0.026
NP_440586.1_8 Forward -44 -37 13.2151 0.026
NP_440586.1_8 Reverse -37 -44 13.2151 0.026
NP_440586.1_8 Reverse -253 -260 9.18354 0.171
NP_442251.1_6 Forward -44 -37 15.2804 0.0124
NP_442251.1_6 Reverse -37 -44 15.2804 0.0124
NP_442251.1_6 Reverse -154 -161 13.0188 0.0408
NP_442251.1_6 Reverse -224 -231 12.0355 0.0627
NP_440684.1_9 Reverse -30 -44 12.8809 0.168
NP_441262.1_3 Reverse -36 -43 14.7888 0.0223
NP_441262.1_3 Forward -232 -225 14.7888 0.0223
NP_441262.1_3 Forward -45 -38 14.7888 0.0223
NP_440027.1_3 Reverse -219 -237 2.18168 0.292
NP_440027.1_8 Forward -26 -7 7.76679 0.255
NP_440027.1_8 Reverse -220 -239 7.4718 0.261
NP_443051.1_1 Forward -46 -37 19.5676 0.00335
NP_443051.1_1 Reverse -35 -44 10.4228 0.00754
NP_443051.1_1 Forward -163 -154 8.25953 0.0414
NP_443051.1_1 Forward -233 -224 0.884706 0.125
NP_443051.1_1 Reverse -152 -161 -0.983583 0.269
NP_439937.1_9 Forward -163 -146 2.29975 0.0807
NP_439937.1_9 Forward -389 -372 -4.48506 0.157
NP_439937.1_9 Forward -388 -371 -10.3849 0.227
NP_439937.1_9 Reverse -324 -341 -11.3682 0.251
NP_439937.1_9 Reverse -35 -52 -16.4814 0.287
NP_439937.1_9 Reverse -274 -291 -16.5797 0.287
NP_440626.1_1 Forward -44 -25 12.6833 0.204
NP_440439.1_1 Forward -48 -35 9.2624 0.0465
NP_440439.1_1 Reverse -33 -46 1.10092 0.162
NP_440439.1_1 Forward -235 -222 -1.45568 0.269
NP_440372.1_2 Forward -44 -37 16.3621 0.0124
NP_440372.1_2 Reverse -37 -44 16.3621 0.0124
NP_440372.1_2 Forward -231 -224 6.82395 0.0854
NP_440372.1_2 Reverse -154 -161 6.62729 0.151
NP_440372.1_2 Reverse -224 -231 6.52896 0.188
NP_440372.1_2 Forward -161 -154 6.52896 0.188
NP_441789.1_7 Reverse -326 -345 17.1082 0.164
NP_441789.1_7 Reverse -332 -351 -2.16459 0.257
NP_440316.1_10 Reverse -1 -11 7.25653 0.251
NP_440316.1_10 Forward -352 -342 6.8632 0.251
NP_440316.1_10 Forward -239 -229 6.37155 0.263
NP_442488.1_5 Forward -183 -164 14.5524 0.267
NP_441803.1_2 Forward -237 -218 9.43923 0.0999
NP_441803.1_2 Forward -50 -31 5.11266 0.171
NP_441803.1_2 Reverse -331 -350 2.3594 0.213
NP_439977.1_5 Reverse -342 -361 -1.86883 0.263
NP_440139.1_1 Forward -168 -149 3.34192 0.208
NP_440139.1_1 Reverse -147 -166 2.6536 0.225
NP_440139.1_1 Reverse -217 -236 1.76863 0.249
NP_441572.1_7 Reverse -217 -236 9.0459 0.074
NP_441572.1_7 Reverse -147 -166 5.60432 0.0867
NP_440267.1_2 Reverse -229 -243 13.1753 0.125
NP_442384.1_10 Reverse -153 -166 7.78743 0.0743
NP_442384.1_10 Reverse -36 -49 6.50913 0.0995
NP_442384.1_10 Forward -45 -32 6.50913 0.0995
NP_442384.1_10 Reverse -223 -236 6.4108 0.102
NP_441018.1_7 Forward -133 -114 6.58763 0.285
NP_441018.1_7 Forward -242 -223 6.29264 0.294
NP_442790.1_4 Reverse -27 -46 -14.3569 0.274
NP_442262.1_10 Forward -44 -37 14.1988 0.0123
NP_442262.1_10 Reverse -37 -44 14.1988 0.0123
NP_442262.1_10 Forward -231 -224 12.9205 0.0422
NP_442262.1_10 Reverse -154 -161 10.6589 0.14
NP_442262.1_10 Forward -10 -3 8.8889 0.219
NP_441689.1_5 Forward -47 -37 8.3377 0.132
NP_441689.1_5 Forward -234 -224 5.78111 0.197
NP_440163.1_10 Forward -235 -225 12.4681 0.159
NP_440344.1_10 Reverse -29 -46 0.432165 0.0358
NP_440344.1_10 Forward -52 -35 -0.551145 0.0435
NP_440344.1_10 Reverse -216 -233 -5.95935 0.111
NP_441060.1_3 Reverse -100 -119 13.0775 0.184
NP_442910.1_1 Forward -291 -272 -6.88371 0.254
NP_441335.1_4 Forward -212 -193 10.1275 0.26
NP_441965.1_10 Reverse -226 -242 4.18844 0.247
NP_441965.1_10 Reverse -33 -49 2.61514 0.285
NP_440297.1_9 Reverse -154 -164 9.32148 0.0917
NP_440297.1_9 Reverse -114 -124 4.20827 0.238
NP_440297.1_9 Reverse -322 -332 0.471689 0.282
NP_440297.1_9 Forward -44 -34 -0.118297 0.282
NP_440297.1_9 Reverse -37 -47 -0.216628 0.282
NP_440297.1_9 Reverse -224 -234 -0.511621 0.289
NP_441592.1_4 Forward -45 -26 1.76941 0.21
NP_441679.1_6 Forward -206 -187 5.50599 0.115
NP_441679.1_8 Forward -176 -157 23.1063 0.0396
NP_440999.1_9 Reverse -219 -233 11.406 0.0448
NP_440999.1_9 Reverse -32 -46 8.45605 0.075
NP_440999.1_9 Reverse -323 -337 -0.885388 0.22
NP_440999.1_9 Reverse -228 -242 -1.08205 0.226
NP_440999.1_9 Reverse -206 -220 -3.04867 0.283
NP_440888.1_2 Reverse -192 -206 11.7987 0.0588
NP_440888.1_2 Reverse -342 -356 10.8154 0.0842
NP_440888.1_2 Forward -17 -3 10.6187 0.0893
NP_440888.1_2 Forward -45 -31 5.80051 0.262
NP_440888.1_2 Reverse -153 -167 5.80051 0.262
NP_440888.1_2 Forward -232 -218 5.01387 0.298
NP_442147.1_7 Forward -345 -326 7.7676 0.288
NP_442948.1_2 Forward -233 -214 4.22769 0.269
NP_441949.1_2 Forward -398 -379 2.75272 0.261
NP_442077.1_9 Reverse -124 -143 -6.09707 0.288
NP_441543.1_2 Forward -44 -35 18.486 0.00236
NP_441543.1_2 Reverse -37 -46 15.9293 0.00518
NP_441543.1_2 Forward -231 -222 13.5694 0.0248
NP_441543.1_2 Reverse -224 -233 7.07956 0.131
NP_442845.1_2 Forward -51 -37 12.1926 0.114
NP_442845.1_2 Forward -238 -224 10.6193 0.145
NP_442845.1_2 Reverse -2 -16 8.16106 0.195
NP_442845.1_2 Forward -244 -230 6.58777 0.207
NP_442845.1_2 Reverse -8 -22 6.29277 0.212
NP_442845.1_2 Forward -351 -337 4.62115 0.256
NP_440982.1_1 Reverse -327 -346 3.9319 0.294
NP_441469.1_8 Reverse -35 -44 16.126 0.00797
NP_441469.1_8 Forward -46 -37 6.5879 0.227
NP_442315.1_1 Forward -347 -329 5.13236 0.256
NP_442315.1_1 Forward -341 -323 5.03403 0.256
NP_443064.1_6 Reverse -36 -46 10.8217 0.13
NP_443064.1_6 Reverse -349 -359 9.07643 0.247
NP_443064.1_6 Reverse -223 -233 8.88251 0.262
NP_442578.1_7 Forward -231 -224 14.6904 0.026
NP_442578.1_7 Forward -44 -37 14.5921 0.026
NP_442578.1_7 Reverse -37 -44 14.5921 0.026
NP_442578.1_7 Forward -161 -154 5.15232 0.291
NP_440710.1_1 Reverse -334 -352 -1.35749 0.179
NP_441462.1_2 Reverse -36 -46 20.2362 0.000805
NP_441462.1_2 Forward -45 -35 11.5831 0.00406
NP_441462.1_2 Forward -162 -152 9.32148 0.0234
NP_441462.1_2 Forward -232 -222 1.25834 0.0964
NP_441462.1_2 Reverse -153 -163 0.668351 0.135
NP_441462.1_2 Reverse -275 -285 -1.00328 0.274
NP_441621.1_7 Reverse -34 -48 4.22782 0.0934
NP_443062.1_1 Reverse -223 -241 14.8839 0.0427
NP_443062.1_1 Reverse -36 -54 8.74094 0.148
NP_443062.1_1 Forward -45 -27 7.86337 0.166
NP_443062.1_1 Forward -261 -243 6.30325 0.204
NP_441601.1_4 Reverse -323 -342 6.98095 0.162
NP_440519.1_8 Forward -324 -308 7.53169 0.199
NP_440519.1_8 Reverse -2 -18 1.23851 0.29
NP_440519.1_8 Forward -351 -335 0.845183 0.298
NP_442204.1_1 Forward -49 -38 8.51513 0.0919
NP_442204.1_1 Forward -236 -225 -0.0396598 0.285
NP_442204.1_5 Forward -340 -321 7.7676 0.125
NP_442204.1_5 Reverse -26 -45 5.80098 0.154
NP_441560.1_8 Forward -50 -31 12.1944 0.261
NP_441560.1_10 Forward -366 -347 10.4225 0.195
NP_440516.1_2 Reverse -30 -48 11.8189 0.0708
NP_440516.1_8 Forward -45 -36 16.9127 0.00442
NP_440516.1_8 Reverse -36 -45 16.9127 0.00442
NP_440516.1_8 Reverse -142 -151 7.17789 0.0754
NP_440516.1_8 Forward -232 -223 0.983037 0.13
NP_440516.1_8 Forward -162 -153 -0.393597 0.255
NP_442428.1_5 Forward -44 -37 15.8704 0.0124
NP_442428.1_5 Reverse -37 -44 15.8704 0.0124
NP_442428.1_5 Reverse -154 -161 6.3323 0.193
NP_442428.1_5 Forward -231 -224 6.13563 0.209
NP_442428.1_5 Forward -161 -154 6.13563 0.209
NP_442428.1_5 Reverse -224 -231 6.0373 0.212
NP_442120.1_10 Forward -330 -311 -4.6221 0.199
NP_440673.1_3 Forward -43 -36 12.4288 0.0426
NP_440673.1_3 Reverse -225 -232 12.4288 0.0426
NP_440673.1_3 Reverse -38 -45 12.4288 0.0426
NP_440673.1_3 Forward -9 -2 8.98723 0.203
NP_440673.1_3 Reverse -317 -324 6.72562 0.277
NP_440865.1_9 Forward -238 -219 -7.86702 0.251
NP_441052.1_2 Forward -45 -35 10.5014 0.0285
NP_441052.1_2 Reverse -36 -46 10.4031 0.0285
NP_441052.1_2 Reverse -229 -239 2.92996 0.187
NP_441052.1_2 Reverse -223 -233 1.65166 0.233
NP_442219.1_8 Forward -314 -295 7.78057 0.263
NP_442219.1_9 Forward -44 -35 8.35786 0.0681
NP_442219.1_9 Reverse -37 -46 8.25953 0.0681
NP_442219.1_9 Reverse -224 -233 7.96454 0.0696
NP_440436.1_4 Forward -44 -35 18.1905 0.00233
NP_440436.1_4 Reverse -37 -46 9.24241 0.0871
NP_440436.1_4 Reverse -224 -233 7.57079 0.124
NP_440436.1_4 Forward -231 -222 7.37413 0.132
NP_440436.1_4 Reverse -154 -163 6.19416 0.167
NP_440436.1_4 Forward -161 -152 5.0142 0.227
NP_441884.1_8 Reverse -35 -54 -13.1769 0.276
NP_441884.1_9 Reverse -189 -208 -22.8133 0.284
NP_441884.1_9 Reverse -207 -226 -23.5016 0.284
NP_442086.1_3 Reverse -37 -56 10.8159 0.196
NP_440314.1_9 Forward -44 -25 -6.39206 0.228
NP_440314.1_9 Forward -201 -182 -9.93197 0.281
NP_440041.1_6 Forward -201 -182 19.1731 0.177
NP_441719.1_4 Forward -44 -37 16.3621 0.0124
NP_441719.1_4 Reverse -37 -44 16.3621 0.0124
NP_441719.1_4 Forward -231 -224 13.5105 0.026
NP_441719.1_4 Reverse -154 -161 6.62729 0.151
NP_441719.1_4 Reverse -224 -231 6.52896 0.188
NP_441719.1_4 Forward -161 -154 6.52896 0.188
NP_441733.1_10 Forward -235 -222 5.91914 0.203
NP_441733.1_10 Forward -48 -35 5.82081 0.203
NP_441733.1_10 Forward -165 -152 4.8375 0.24
NP_441004.1_1 Forward -342 -323 -6.98204 0.193
NP_441004.1_1 Forward -363 -344 -7.27704 0.197
NP_441004.1_1 Forward -237 -218 -12.1936 0.245
NP_441004.1_1 Forward -330 -311 -15.8318 0.279
NP_441004.1_1 Forward -259 -240 -17.0118 0.288
NP_441004.1_2 Forward -335 -316 -1.96717 0.263
NP_441004.1_2 Forward -287 -268 -2.45882 0.264
NP_441004.1_4 Reverse -111 -121 8.63316 0.269
NP_441004.1_10 Reverse -49 -59 16.6357 0.191
NP_442366.1_3 Reverse -35 -53 2.96908 0.118
NP_442366.1_3 Reverse -222 -240 0.805796 0.163
NP_442366.1_5 Forward -48 -38 14.0409 0.0497
NP_442366.1_5 Reverse -33 -43 12.7626 0.108
NP_442366.1_5 Reverse -272 -282 11.3859 0.189
NP_442139.1_7 Forward -341 -322 13.2741 0.167
NP_440129.1_10 Forward -365 -351 1.86788 0.293
NP_441115.1_4 Forward -325 -307 10.4414 0.179
NP_441115.1_4 Forward -46 -28 8.08151 0.263
NP_442206.1_10 Forward -330 -315 3.32315 0.186
NP_442206.1_10 Forward -45 -30 2.92983 0.196
NP_440328.1_4 Reverse -30 -49 3.83436 0.172
NP_443054.1_2 Forward -47 -33 11.2093 0.0761
NP_443054.1_2 Forward -389 -375 2.2612 0.245
NP_443054.1_2 Reverse -377 -391 1.47456 0.245
NP_442586.1_6 Forward -341 -322 9.83255 0.232
NP_441851.1_9 Forward -355 -336 12.1925 0.197
NP_441851.1_10 Reverse -35 -45 16.008 0.00552
NP_441851.1_10 Forward -233 -223 13.0581 0.0372
NP_441851.1_10 Forward -203 -193 10.4031 0.0935
NP_441851.1_10 Forward -163 -153 9.22315 0.114
NP_441851.1_10 Forward -46 -36 8.53483 0.114
NP_441851.1_10 Forward -285 -275 5.28991 0.218
NP_441157.1_1 Reverse -124 -138 5.60385 0.235
NP_442622.1_5 Reverse -34 -53 5.80098 0.0634
NP_442515.1_1 Forward -163 -149 -4.32697 0.298
NP_441396.1_5 Forward -290 -281 9.4395 0.205
NP_441396.1_5 Forward -227 -218 7.37455 0.279
NP_440593.1_3 Reverse -350 -369 -0.787193 0.209
NP_440593.1_3 Reverse -269 -288 -4.52377 0.251
NP_440593.1_3 Forward -127 -108 -4.6221 0.251
NP_440593.1_3 Reverse -344 -363 -5.9004 0.268
NP_442709.1_3 Forward -239 -220 4.52268 0.24
NP_441349.1_10 Forward -55 -36 6.88262 0.0342
NP_441409.1_6 Reverse -30 -49 -13.1769 0.234
NP_441409.1_6 Reverse -92 -111 -14.6519 0.263
NP_440432.1_9 Forward -161 -146 -6.41162 0.299
NP_442843.1_1 Forward -395 -376 -7.96535 0.252
NP_440474.1_8 Forward -44 -30 6.19383 0.23
NP_441477.1_10 Forward -239 -221 2.0841 0.25
NP_442450.1_5 Forward -164 -154 9.7148 0.115
NP_442450.1_5 Forward -47 -37 7.64985 0.13
NP_442450.1_5 Reverse -34 -44 7.55152 0.13
NP_442450.1_5 Forward -234 -224 6.07655 0.204
NP_442168.1_5 Reverse -37 -56 -3.24547 0.281
NP_440588.1_2 Forward -54 -35 6.19431 0.0594
NP_440588.1_2 Reverse -27 -46 -1.86883 0.157
NP_440588.1_2 Reverse -318 -337 -2.16383 0.161
NP_442006.1_2 Reverse -1 -18 -17.3657 0.274
NP_440483.1_9 Forward -228 -209 12.1925 0.082
NP_441570.1_1 Forward -351 -333 -8.83064 0.122
NP_441570.1_1 Forward -238 -220 -14.9272 0.227
NP_441078.1_4 Forward -45 -36 19.6659 0.0007
NP_441078.1_4 Reverse -36 -45 19.6659 0.0007
NP_441078.1_4 Reverse -153 -162 0.196389 0.205
NP_441078.1_4 Forward -162 -153 0.196389 0.205
NP_441078.1_4 Reverse -223 -232 0.0980582 0.205
NP_441078.1_4 Forward -232 -223 0.0980582 0.205
NP_441078.1_4 Reverse -275 -284 -1.77023 0.266
NP_441078.1_4 Forward -284 -275 -1.77023 0.266
NP_441528.1_5 Forward -119 -105 18.7801 0.141
NP_442348.1_2 Forward -388 -379 13.5694 0.179
NP_442443.1_1 Forward -344 -325 5.70265 0.157
NP_441091.1_5 Reverse -219 -238 5.80098 0.235
NP_440526.1_3 Reverse -194 -205 5.07306 0.258
NP_440526.1_3 Forward -44 -33 2.02482 0.267
NP_440526.1_3 Reverse -349 -360 1.23817 0.267
NP_441432.1_8 Forward -46 -37 16.8143 0.00595
NP_441432.1_8 Reverse -35 -44 8.25953 0.0755
NP_441432.1_8 Forward -233 -224 7.27622 0.101
NP_441432.1_8 Forward -352 -343 5.80125 0.137
NP_441432.1_8 Reverse -141 -150 5.21127 0.185
NP_441432.1_8 Reverse -1 -10 3.83464 0.243
NP_441432.1_8 Reverse -7 -16 2.55633 0.298
NP_442320.1_8 Reverse -30 -44 5.89945 0.0309
NP_442320.1_8 Reverse -217 -231 4.91614 0.0442
NP_442320.1_8 Forward -51 -37 -0.983719 0.0817
NP_442344.1_7 Forward -44 -25 2.65439 0.0638
NP_442344.1_7 Reverse -37 -56 2.16274 0.0644
NP_441732.1_2 Forward -49 -33 -7.70961 0.0885
NP_440497.1_2 Forward -341 -322 4.71934 0.287
NP_442815.1_2 Forward -329 -311 4.44404 0.243
NP_440760.1_1 Reverse -92 -111 -17.9951 0.206
NP_442797.1_1 Reverse -323 -342 -3.83545 0.284
NP_442797.1_7 Reverse -335 -353 0.805796 0.271
NP_442797.1_7 Reverse -152 -170 -1.45582 0.299
NP_440199.1_10 Forward -235 -225 7.64985 0.231
NP_442353.1_4 Reverse -217 -236 5.50519 0.183
NP_440913.1_1 Reverse -250 -268 3.95239 0.285
NP_441072.1_2 Forward -356 -337 8.35759 0.24
NP_442489.1_7 Forward -45 -36 20.1576 0.000695
NP_442489.1_7 Reverse -36 -45 20.1576 0.000695
NP_442489.1_7 Reverse -223 -232 7.57121 0.057
NP_442489.1_7 Reverse -153 -162 0.688044 0.152
NP_442489.1_7 Forward -232 -223 0.589713 0.17
NP_442489.1_7 Forward -162 -153 0.491382 0.178
NP_442489.1_7 Forward -284 -275 -1.27858 0.185
NP_440757.1_6 Reverse -321 -340 9.43923 0.28
NP_440386.1_3 Reverse -367 -386 -6.39206 0.264
NP_440559.1_1 Forward -44 -35 8.75118 0.0586
NP_440559.1_1 Reverse -37 -46 8.65285 0.0586
NP_440559.1_1 Reverse -224 -233 7.76787 0.0918
NP_440559.1_1 Reverse -154 -163 7.57121 0.106
NP_440559.1_1 Forward -161 -152 7.57121 0.106
NP_440559.1_1 Forward -231 -222 5.80125 0.136
NP_441659.2_8 Reverse -36 -46 20.9245 0.000805
NP_441659.2_8 Forward -45 -35 11.9764 0.0147
NP_441659.2_8 Reverse -153 -163 7.35486 0.0612
NP_441659.2_8 Reverse -223 -233 6.27322 0.0797
NP_441659.2_8 Reverse -275 -285 4.50326 0.132
NP_441659.2_8 Forward -162 -152 -0.118297 0.287
NP_442913.1_10 Forward -211 -192 -3.63879 0.214
NP_442913.1_10 Reverse -183 -202 -4.72043 0.244
NP_441040.1_2 Forward -293 -274 -11.8003 0.255
NP_439956.1_7 Forward -133 -114 1.57275 0.287
NP_439956.1_7 Reverse -96 -115 1.27776 0.292
NP_442776.1_6 Reverse -151 -170 8.75091 0.243
NP_442346.1_1 Forward -351 -332 10.7175 0.27
NP_442346.1_2 Forward -243 -224 5.99764 0.281
NP_442346.1_5 Forward -46 -36 16.303 0.00248
NP_442346.1_5 Reverse -35 -45 9.02648 0.118
NP_442346.1_5 Forward -163 -153 7.84651 0.156
NP_442346.1_5 Forward -233 -223 7.05986 0.183
NP_442346.1_5 Reverse -152 -162 6.17489 0.212
NP_440545.1_3 Forward -49 -32 2.98877 0.0903
NP_440545.1_3 Reverse -149 -166 -2.81276 0.193
NP_440831.1_3 Forward -345 -326 5.51345 0.28
NP_441629.1_1 Reverse -28 -47 11.0125 0.154
NP_441629.1_3 Reverse -268 -287 0.588665 0.235
NP_441629.1_3 Reverse -342 -361 -2.36125 0.269
NP_440004.1_5 Forward -50 -31 16.9124 0.199
NP_440486.1_6 Forward -217 -198 5.30933 0.298
NP_440459.1_2 Forward -360 -343 7.31533 0.296
NP_441653.1_2 Reverse -212 -231 5.07576 0.248
NP_440010.1_10 Forward -342 -323 4.71934 0.244
NP_442551.1_4 Forward -240 -225 -3.26502 0.287
NP_442900.1_1 Forward -348 -329 -2.55715 0.195
NP_440847.1_3 Reverse -212 -226 12.0937 0.254
NP_442603.1_7 Forward -162 -148 7.17714 0.211
NP_442603.1_9 Forward -40 -22 4.9357 0.293
NP_441888.1_7 Reverse -31 -45 2.16287 0.225
NP_441888.1_7 Reverse -218 -232 1.86788 0.235
NP_440449.1_6 Reverse -28 -46 4.85163 0.288
NP_441047.1_2 Forward -110 -91 -2.45882 0.277
NP_441502.1_3 Reverse -244 -263 7.47261 0.244
NP_441833.1_4 Forward -44 -37 15.9687 0.0124
NP_441833.1_4 Reverse -37 -44 15.9687 0.0124
NP_441833.1_4 Reverse -154 -161 12.9205 0.0393
NP_441833.1_4 Reverse -224 -231 6.52896 0.0924
NP_441833.1_4 Forward -231 -224 6.23397 0.163
NP_441833.1_4 Forward -161 -154 6.13563 0.198
NP_441895.1_10 Forward -235 -216 -27.7299 0.29
NP_442162.1_9 Forward -44 -37 16.2637 0.0124
NP_442162.1_9 Reverse -37 -44 16.2637 0.0124
NP_442162.1_9 Forward -231 -224 6.62729 0.142
NP_442162.1_9 Reverse -224 -231 6.52896 0.178
NP_442162.1_9 Reverse -154 -161 6.52896 0.178
NP_442162.1_9 Forward -161 -154 6.43063 0.208
NP_442162.1_9 Forward -150 -143 5.93897 0.214
NP_442796.1_10 Forward -181 -162 6.78429 0.281
NP_440671.1_4 Forward -238 -224 16.5192 0.0288
NP_440671.1_4 Forward -51 -37 7.07942 0.227
NP_440671.1_4 Forward -364 -350 5.70279 0.275
NP_442821.1_2 Forward -38 -19 4.81767 0.177
NP_442199.1_5 Forward -53 -34 10.9142 0.0558
NP_442140.1_3 Forward -44 -34 16.2046 0.0255
NP_442140.1_3 Reverse -37 -47 6.66654 0.159
NP_442140.1_3 Forward -227 -217 5.97822 0.189
NP_442140.1_3 Forward -231 -221 4.69992 0.238
NP_442140.1_3 Forward -161 -151 4.69992 0.238
NP_442723.1_1 Reverse -203 -222 3.53858 0.278
NP_440875.1_2 Reverse -224 -243 14.9458 0.0693
NP_440875.1_9 Forward -230 -220 8.95605 0.233
NP_440875.1_9 Forward -43 -33 8.46937 0.233
NP_440875.1_9 Reverse -38 -48 8.37203 0.233
NP_440875.1_9 Reverse -231 -241 6.81464 0.297
NP_441813.1_5 Reverse -34 -44 9.91146 0.021
NP_441813.1_5 Reverse -221 -231 9.02648 0.0313
NP_441813.1_5 Forward -47 -37 8.63316 0.0367
NP_441813.1_5 Forward -164 -154 6.27322 0.0971
NP_441813.1_5 Forward -234 -224 6.17489 0.1
NP_441813.1_7 Reverse -324 -338 8.06211 0.297
NP_440594.1_8 Forward -161 -148 11.7201 0.152
NP_440590.1_4 Forward -44 -31 3.06754 0.0772
NP_440590.1_4 Forward -231 -218 2.96921 0.0783
NP_440567.1_1 Forward -44 -30 13.6676 0.0207
NP_440567.1_1 Forward -161 -147 12.8809 0.0215
NP_440567.1_1 Reverse -224 -238 12.7826 0.0216
NP_440567.1_1 Reverse -37 -51 9.14437 0.0488
NP_440567.1_1 Reverse -154 -168 4.32615 0.123
NP_440567.1_1 Forward -231 -217 -0.000409212 0.261
NP_442497.1_10 Reverse -37 -46 17.601 0.00813
NP_442497.1_10 Forward -44 -35 10.4228 0.0087
NP_442497.1_10 Reverse -154 -163 10.1278 0.0166
NP_442497.1_10 Forward -161 -152 8.1612 0.0625
NP_442497.1_10 Reverse -224 -233 0.589713 0.153
NP_442497.1_10 Forward -231 -222 -1.18024 0.256
NP_440821.1_4 Reverse -34 -44 10.2065 0.0163
NP_440821.1_4 Forward -164 -154 10.0098 0.0221
NP_440821.1_4 Forward -234 -224 8.53483 0.0468
NP_440821.1_4 Forward -47 -37 2.24165 0.131
NP_440821.1_4 Reverse -151 -161 1.25834 0.139
NP_441239.1_9 Forward -47 -35 13.707 0.0355
NP_441239.1_9 Reverse -151 -163 12.3303 0.0477
NP_441239.1_9 Reverse -34 -46 12.3303 0.0477
NP_441239.1_9 Reverse -325 -337 9.18376 0.113
NP_441239.1_9 Reverse -221 -233 3.2839 0.289
NP_441951.1_4 Forward -339 -320 0.392778 0.297
NP_441009.1_4 Reverse -275 -294 11.9958 0.249
NP_442568.1_8 Reverse -70 -84 8.35772 0.287
NP_440400.1_1 Reverse -339 -358 10.0284 0.217
NP_441892.1_1 Reverse -220 -237 -1.92778 0.215
NP_442044.1_1 Forward -243 -224 -6.1954 0.201
NP_442044.1_1 Reverse -322 -341 -13.6686 0.277
NP_442270.1_6 Forward -328 -310 16.2438 0.279
NP_442643.1_7 Reverse -90 -109 12.3892 0.118
NP_442629.1_3 Forward -299 -280 2.3594 0.275
NP_442772.1_6 Forward -140 -121 17.5248 0.196
NP_441769.1_1 Reverse -215 -234 18.9773 0.187
NP_441526.1_6 Forward -240 -221 5.01433 0.27
NP_441617.1_6 Forward -136 -117 0.982764 0.217
NP_442052.1_8 Reverse -111 -121 12.4681 0.268
NP_442052.1_8 Reverse -273 -283 12.0747 0.287
NP_442809.1_6 Forward -336 -317 2.65439 0.265
NP_442284.1_3 Reverse -127 -145 19.9803 0.0981
NP_440546.1_4 Reverse -36 -46 13.5365 0.0459
NP_440546.1_4 Forward -45 -35 11.8882 0.0679
NP_440546.1_4 Forward -162 -152 10.9186 0.101
NP_442041.1_5 Reverse -376 -395 5.89931 0.218
NP_441230.1_5 Reverse -218 -237 8.16093 0.154
NP_440675.1_1 Forward -132 -113 7.86593 0.195
NP_440462.1_6 Forward -47 -37 10.5014 0.0396
NP_440462.1_6 Reverse -34 -44 9.02648 0.0498
NP_440462.1_6 Reverse -221 -231 6.96153 0.0932
NP_440462.1_6 Forward -234 -224 4.50326 0.197
NP_442340.1_3 Reverse -194 -213 -6.88371 0.227
NP_442592.1_3 Forward -41 -22 11.2092 0.228
NP_442592.1_3 Reverse -319 -338 10.8159 0.233
NP_440868.1_4 Forward -49 -37 12.9203 0.0231
NP_440868.1_4 Reverse -32 -44 10.7571 0.0364
NP_440868.1_4 Forward -236 -224 3.67722 0.134
NP_441868.1_2 Reverse -90 -109 15.4374 0.158
NP_441474.1_1 Reverse -213 -232 8.06178 0.212
NP_441474.1_1 Reverse -326 -345 5.89851 0.212
NP_442402.1_9 Forward -126 -107 17.8957 0.139
NP_442460.1_7 Forward -244 -225 1.67108 0.249
NP_440696.1_6 Reverse -24 -43 5.89931 0.266
NP_442923.1_4 Forward -330 -311 -5.01543 0.263
NP_442039.1_4 Forward -44 -37 15.1821 0.0124
NP_442039.1_4 Reverse -37 -44 15.1821 0.0124
NP_442039.1_4 Reverse -154 -161 11.3472 0.086
NP_442039.1_4 Forward -303 -296 8.29892 0.213
NP_440825.1_7 Forward -44 -34 12.4217 0.155
NP_442837.1_3 Forward -44 -37 15.7721 0.0124
NP_442837.1_3 Reverse -37 -44 15.7721 0.0124
NP_442837.1_3 Reverse -224 -231 12.1338 0.0702
NP_442837.1_3 Reverse -154 -161 6.52896 0.2
NP_442837.1_3 Forward -231 -224 6.0373 0.25
NP_442837.1_3 Forward -161 -154 6.0373 0.25
NP_440160.1_9 Reverse -36 -55 10.3242 0.235
NP_442053.1_1 Forward -45 -36 18.3876 0.0007
NP_442053.1_1 Reverse -36 -45 18.3876 0.0007
NP_442053.1_1 Reverse -223 -232 6.8829 0.111
NP_442053.1_1 Forward -162 -153 5.60459 0.176
NP_440505.1_3 Forward -47 -37 8.04317 0.147
NP_440505.1_3 Forward -234 -224 7.45319 0.154
NP_440505.1_3 Reverse -34 -44 6.76487 0.169
NP_440505.1_7 Forward -288 -269 2.45773 0.235
NP_441203.1_1 Reverse -263 -282 -14.5535 0.193
NP_442532.1_7 Forward -336 -322 4.32615 0.174
NP_440914.1_1 Reverse -36 -46 16.3248 0.00196
NP_440914.1_1 Forward -201 -191 9.68861 0.178
NP_440914.1_1 Forward -45 -35 8.6151 0.186
NP_440914.1_1 Reverse -2 -12 8.02955 0.211
NP_440914.1_1 Reverse -223 -233 7.24882 0.242
NP_441011.1_8 Forward -44 -35 16.9127 0.00602
NP_441011.1_8 Reverse -37 -46 16.6177 0.00602
NP_441011.1_8 Forward -231 -222 8.55452 0.144
NP_441011.1_8 Forward -161 -152 5.89959 0.214
NP_442101.1_10 Forward -53 -34 -7.57203 0.214
NP_442533.1_1 Forward -342 -323 -8.06369 0.201
NP_442533.1_1 Forward -355 -336 -11.0136 0.235
NP_442533.1_1 Reverse -5 -24 -16.2252 0.263
NP_442533.1_6 Forward -45 -36 17.2076 0.00137
NP_442533.1_6 Reverse -36 -45 17.2076 0.00137
NP_442533.1_6 Reverse -275 -284 7.47288 0.0898
NP_442533.1_6 Forward -162 -153 6.19458 0.115
NP_442533.1_6 Reverse -229 -238 5.99792 0.121
NP_442533.1_6 Forward -232 -223 5.40793 0.14
NP_442533.1_6 Forward -284 -275 3.83464 0.202
NP_442322.1_9 Reverse -342 -360 15.4563 0.203
NP_442229.1_1 Forward -47 -33 17.7968 0.0734
NP_442229.1_1 Reverse -34 -48 10.0287 0.184
NP_442229.1_2 Forward -312 -293 21.4356 0.0768
NP_442229.1_3 Forward -287 -270 17.4434 0.207
NP_442229.1_9 Forward -199 -180 17.9932 0.12
NP_442229.1_10 Forward -20 -1 21.6314 0.108
NP_441482.1_7 Forward -51 -37 -1.27871 0.0666
NP_441482.1_7 Forward -238 -224 -9.34185 0.198
NP_441482.1_7 Forward -168 -154 -11.3085 0.254
NP_441482.1_7 Forward -364 -350 -11.7018 0.281
NP_439944.1_9 Forward -161 -151 11.9764 0.0887
NP_439944.1_9 Reverse -296 -306 10.3048 0.0887
NP_439944.1_9 Reverse -224 -234 9.22315 0.1
NP_439944.1_9 Reverse -37 -47 9.12481 0.1
NP_439944.1_9 Reverse -154 -164 7.64985 0.134
NP_442202.1_10 Reverse -228 -242 5.1128 0.255
NP_440116.1_4 Forward -246 -227 6.19431 0.293
NP_440116.1_8 Reverse -3 -22 -3.93378 0.159
NP_440116.1_8 Forward -231 -212 -9.14533 0.268
NP_440115.1_6 Forward -235 -225 9.41981 0.115
NP_440115.1_6 Forward -48 -38 7.35486 0.147
NP_440115.1_6 Reverse -150 -160 7.25653 0.152
NP_440115.1_6 Reverse -204 -214 5.87989 0.214
NP_439965.1_1 Forward -241 -222 -4.81876 0.197
NP_443045.1_9 Reverse -328 -346 7.78652 0.263
NP_441602.1_3 Forward -342 -323 -5.50708 0.288
NP_441602.1_3 Reverse -343 -362 -5.60541 0.291
NP_441602.1_6 Reverse -334 -353 14.3558 0.277
NP_441972.1_5 Forward -161 -142 -8.752 0.272
NP_441106.1_1 Forward -46 -37 18.486 0.0028
NP_441106.1_1 Reverse -35 -44 18.191 0.0028
NP_441106.1_1 Reverse -222 -231 7.66954 0.0776
NP_441420.1_4 Forward -345 -326 15.9291 0.282
NP_440429.1_2 Reverse -343 -362 16.6174 0.157
NP_440429.1_9 Reverse -192 -211 0.491109 0.297
NP_442249.1_10 Reverse -375 -394 8.06259 0.288
NP_442306.1_10 Forward -341 -322 -20.4534 0.21
NP_442306.1_10 Reverse -206 -225 -20.65 0.219
NP_441286.1_1 Forward -46 -34 -3.40261 0.145
NP_441286.1_1 Reverse -35 -47 -3.59927 0.145
NP_441286.1_1 Forward -163 -151 -4.28759 0.154
NP_441286.1_1 Reverse -152 -164 -4.38592 0.156
NP_441286.1_1 Reverse -320 -332 -6.15587 0.251
NP_440670.1_8 Forward -45 -36 18.3876 0.000699
NP_440670.1_8 Reverse -36 -45 18.3876 0.000699
NP_440670.1_8 Forward -162 -153 5.70292 0.14
NP_441930.1_2 Reverse -1 -11 13.5497 0.24
NP_440886.1_7 Reverse -35 -45 17.7774 0.0011
NP_440886.1_7 Forward -46 -36 8.04271 0.0805
NP_440886.1_7 Reverse -326 -336 7.35439 0.0966
NP_440886.1_7 Reverse -274 -284 4.10949 0.253
NP_440828.1_4 Reverse -314 -333 -0.197979 0.19
NP_442614.1_2 Forward -330 -316 7.07942 0.275
NP_439995.1_5 Reverse -26 -45 8.55425 0.235
NP_442072.1_9 Forward -163 -145 -11.2889 0.0789
NP_442072.1_9 Reverse -152 -170 -21.122 0.206
NP_442072.1_9 Forward -46 -28 -21.8103 0.212
NP_442072.1_9 Forward -359 -341 -22.4986 0.241
NP_442072.1_9 Forward -233 -215 -22.7936 0.259
NP_441753.1_10 Reverse -144 -163 4.03102 0.203
NP_441651.1_4 Forward -260 -241 15.0441 0.218
NP_441651.1_7 Forward -394 -375 18.0924 0.185
NP_440907.2_8 Reverse -37 -47 15.9091 0.0161
NP_440907.2_8 Forward -44 -34 14.2375 0.0312
NP_440907.2_8 Forward -161 -151 7.35439 0.121
NP_442264.1_2 Forward -334 -317 9.57695 0.196
NP_441021.1_1 Reverse -316 -335 -11.2103 0.258
NP_441021.1_1 Forward -201 -182 -11.2103 0.258
NP_441021.1_1 Forward -161 -142 -11.8003 0.274
NP_441021.1_8 Forward -50 -32 3.55906 0.226
NP_442459.1_8 Forward -335 -316 14.5524 0.0937
NP_441463.1_3 Reverse -26 -45 0.294447 0.132
NP_441463.1_3 Forward -55 -36 -2.16383 0.151
NP_441463.1_3 Reverse -317 -336 -3.14714 0.17
NP_441463.1_3 Reverse -332 -351 -7.37537 0.257
NP_441463.1_3 Forward -172 -153 -10.6203 0.299
NP_441463.1_6 Reverse -6 -20 11.9241 0.224
NP_441463.1_6 Reverse -190 -204 7.67217 0.254
NP_441626.1_2 Forward -44 -37 15.7721 0.0124
NP_441626.1_2 Reverse -37 -44 15.7721 0.0124
NP_441626.1_2 Forward -231 -224 6.13563 0.177
NP_441626.1_2 Reverse -154 -161 6.0373 0.212
NP_441626.1_2 Reverse -224 -231 5.93897 0.231
NP_441626.1_2 Forward -161 -154 5.93897 0.231
NP_441626.1_6 Reverse -219 -237 8.17984 0.254
NP_442211.1_3 Forward -330 -311 13.8914 0.22
NP_442211.1_3 Forward -357 -338 13.3078 0.232
NP_442365.1_5 Forward -44 -25 10.4225 0.183
NP_442365.1_7 Reverse -225 -244 -5.80207 0.279
NP_442794.1_1 Forward -49 -37 2.79224 0.286
NP_442615.1_1 Forward -54 -36 16.6371 0.00808
NP_442615.1_1 Forward -171 -153 4.83737 0.0426
NP_442615.1_1 Reverse -27 -45 3.85406 0.0512
NP_441962.1_4 Forward -50 -31 -7.67036 0.192
NP_441962.1_4 Forward -335 -316 -12.7836 0.265
NP_441962.1_4 Forward -221 -202 -14.2585 0.285
NP_440387.1_1 Forward -45 -29 6.64671 0.0282
NP_440387.1_1 Reverse -223 -239 2.02515 0.0896
NP_440387.1_1 Reverse -36 -52 -2.30141 0.147
NP_440387.1_1 Forward -38 -22 -4.56302 0.19
NP_441431.1_2 Reverse -33 -47 15.1419 0.0537
NP_441431.1_2 Forward -48 -34 13.8636 0.0784
NP_441431.1_2 Forward -154 -140 8.65209 0.209
NP_441431.1_3 Forward -351 -332 2.65439 0.282
NP_441488.1_7 Forward -342 -323 2.85105 0.242
NP_441836.1_1 Forward -56 -37 13.9343 0.209
NP_440814.1_4 Forward -171 -152 -4.81876 0.183
NP_440467.1_3 Forward -122 -103 14.1861 0.178
NP_440114.1_10 Forward -45 -31 14.5526 0.0382
NP_440114.1_10 Reverse -36 -50 11.6026 0.107
NP_440114.1_10 Reverse -185 -199 5.80112 0.292
NP_441858.1_2 Forward -397 -378 14.6152 0.222
NP_442323.1_7 Reverse -310 -329 2.75194 0.262
NP_440287.1_6 Reverse -313 -332 7.57094 0.151
NP_440287.1_6 Forward -47 -28 0.196116 0.296
NP_440766.1_4 Forward -236 -222 2.06454 0.2
NP_440766.1_4 Forward -338 -324 1.76955 0.214
NP_441237.1_9 Forward -201 -191 10.4031 0.233
NP_442743.1_5 Forward -50 -31 5.70265 0.202
NP_439910.1_2 Reverse -28 -45 -12.3509 0.0837
NP_439910.1_2 Reverse -215 -232 -12.9408 0.113
NP_439910.1_2 Reverse -145 -162 -22.2823 0.22
NP_440457.1_1 Forward -236 -224 10.5604 0.092
NP_440457.1_1 Forward -166 -154 9.57708 0.092
NP_440457.1_1 Forward -288 -276 4.5622 0.158
NP_440457.1_1 Reverse -149 -161 0.530633 0.25
NP_440798.1_6 Reverse -37 -50 9.85238 0.0874
NP_440798.1_6 Forward -161 -148 2.87088 0.159
NP_440142.1_7 Reverse -37 -56 6.78429 0.259
NP_441332.1_6 Forward -17 -7 10.6786 0.294
NP_442509.1_9 Forward -45 -35 16.2041 0.00739
NP_442509.1_9 Reverse -36 -46 8.04271 0.192
NP_442509.1_9 Reverse -142 -152 6.17443 0.286
NP_440554.1_4 Forward -231 -221 8.82982 0.0646
NP_440554.1_4 Reverse -37 -47 8.82982 0.0646
NP_440554.1_4 Forward -44 -34 7.35486 0.103
NP_440554.1_4 Forward -303 -293 5.19158 0.158
NP_440554.1_4 Reverse -154 -164 3.71661 0.217
NP_441885.1_5 Forward -45 -35 11.4848 0.00668
NP_441885.1_5 Reverse -36 -46 11.3864 0.00668
NP_441885.1_5 Reverse -223 -233 1.35667 0.11
NP_441885.1_5 Forward -232 -222 0.766681 0.123
NP_441885.1_5 Forward -162 -152 0.57002 0.137
NP_442228.1_2 Reverse -55 -74 24.2872 0.0112
NP_442228.1_10 Reverse -94 -113 17.6007 0.0904
NP_442703.1_4 Reverse -223 -242 2.85027 0.283
NP_442703.1_4 Reverse -153 -172 0.686995 0.287
NP_441466.1_4 Reverse -181 -200 13.5691 0.162
NP_442341.1_7 Forward -46 -32 7.57108 0.102
NP_442341.1_7 Reverse -348 -362 2.85119 0.243
NP_442341.1_9 Reverse -34 -48 15.6336 0.0435
NP_442341.1_9 Forward -47 -33 10.1271 0.137
NP_442341.1_9 Forward -333 -319 5.30886 0.274
NP_441756.1_5 Reverse -323 -342 9.3409 0.128
NP_442395.2_4 Forward -325 -306 2.6536 0.22
NP_443000.1_7 Forward -47 -37 10.6981 0.0345
NP_443000.1_7 Forward -234 -224 7.35486 0.0859
NP_443000.1_7 Reverse -34 -44 1.94665 0.226
NP_443000.1_7 Reverse -221 -231 1.06167 0.274
NP_440507.2_3 Reverse -318 -337 8.94676 0.237
NP_441842.1_1 Forward -160 -147 16.2433 0.0484
NP_441842.1_10 Reverse -29 -43 11.3077 0.134
NP_441842.1_10 Forward -52 -38 7.17775 0.264
NP_440275.1_3 Forward -47 -37 9.02648 0.0563
NP_440275.1_3 Reverse -34 -44 8.33817 0.0602
NP_440275.1_3 Reverse -151 -161 1.25834 0.291
NP_440091.1_1 Reverse -32 -44 3.18557 0.166
NP_440091.1_1 Reverse -149 -161 2.79224 0.184
NP_440091.1_1 Forward -236 -224 -0.74767 0.286
NP_442275.1_1 Forward -387 -368 4.03102 0.274
NP_440679.1_10 Forward -343 -324 -0.688862 0.0968
NP_441359.1_5 Reverse -333 -352 0.982764 0.29
NP_439962.1_4 Reverse -323 -342 -8.26035 0.292
NP_440175.1_4 Forward -360 -341 -13.0786 0.239
NP_440175.1_7 Forward -328 -310 10.7294 0.25
NP_440149.1_8 Forward -238 -219 -7.86702 0.294
NP_440149.1_8 Reverse -2 -21 -7.86702 0.294
NP_441105.1_3 Forward -127 -108 1.67108 0.111
NP_441105.1_3 Reverse -316 -335 -4.81876 0.207
NP_441105.1_3 Forward -56 -37 -7.37537 0.251
NP_441105.1_3 Forward -173 -154 -8.752 0.278
NP_442373.1_1 Forward -209 -190 -3.3438 0.222
NP_440216.1_1 Reverse -36 -50 5.40779 0.0209
NP_440216.1_1 Forward -232 -218 -1.47537 0.0328
NP_440216.1_1 Forward -45 -31 -1.47537 0.0328
NP_440216.1_1 Forward -162 -148 -1.96703 0.0431
NP_440216.1_1 Reverse -153 -167 -3.04867 0.0682
NP_440216.1_9 Reverse -115 -124 5.50626 0.292
NP_440172.1_1 Reverse -36 -46 17.5813 0.00421
NP_440172.1_1 Forward -162 -152 16.6963 0.00854
NP_440172.1_1 Forward -45 -35 8.73149 0.0586
NP_440172.1_1 Forward -351 -341 3.12662 0.244
NP_440172.1_6 Forward -57 -38 5.70265 0.278
NP_442015.1_3 Reverse -326 -345 14.4533 0.21
NP_442015.1_10 Forward -49 -36 2.47756 0.191
NP_442015.1_10 Reverse -32 -45 1.78924 0.204
NP_442015.1_10 Forward -15 -2 -0.865694 0.285
NP_441226.1_7 Forward -44 -37 14.4934 0.0123
NP_441226.1_7 Reverse -37 -44 14.4934 0.0123
NP_441111.1_7 Forward -44 -36 18.7023 0.00294
NP_441111.1_7 Reverse -37 -45 18.7023 0.00294
NP_441111.1_7 Reverse -154 -162 8.96754 0.0463
NP_441111.1_7 Reverse -224 -232 8.86921 0.0589
NP_442379.1_10 Reverse -146 -163 1.90713 0.223
NP_442379.1_10 Forward -239 -222 -1.0428 0.223
NP_441177.1_7 Reverse -332 -351 18.5831 0.107
NP_441766.1_2 Forward -45 -36 17.5026 0.00297
NP_441766.1_2 Reverse -36 -45 17.5026 0.00297
NP_441766.1_2 Forward -162 -153 14.0611 0.0111
NP_441766.1_2 Forward -232 -223 8.1612 0.0645
NP_442417.1_5 Forward -232 -218 6.48943 0.219
NP_440416.1_1 Reverse -36 -55 -2.45882 0.116
NP_440416.1_1 Forward -45 -26 -2.75381 0.116
NP_440416.1_9 Reverse -212 -231 -7.08038 0.0964
NP_440416.1_9 Forward -239 -220 -9.63698 0.133
NP_440416.1_9 Reverse -320 -339 -11.4069 0.151
NP_440416.1_9 Reverse -341 -360 -14.5535 0.178
NP_440416.1_9 Forward -52 -33 -15.0452 0.184
NP_440416.1_9 Forward -169 -150 -17.9951 0.25
NP_443052.1_8 Reverse -26 -45 -4.13045 0.112
NP_443052.1_8 Reverse -143 -162 -11.8003 0.237
NP_443052.1_9 Reverse -323 -342 -0.787193 0.216
NP_443052.1_9 Reverse -332 -351 -3.63879 0.251
NP_443052.1_9 Reverse -320 -339 -7.27704 0.295
NP_440072.1_5 Forward -345 -327 4.9357 0.236
NP_440072.1_5 Forward -351 -333 0.412472 0.236
NP_440072.1_5 Forward -247 -229 -2.43913 0.271
NP_442154.1_1 Forward -231 -213 -11.7806 0.216
NP_442154.1_1 Forward -347 -329 -15.6155 0.222
NP_442154.1_1 Forward -345 -327 -18.8604 0.286
NP_440261.1_5 Forward -161 -148 -3.22564 0.12
NP_440261.1_5 Reverse -328 -341 -6.56889 0.201
NP_440261.1_5 Forward -44 -31 -10.4038 0.201
NP_440261.1_5 Reverse -154 -167 -10.5021 0.201
NP_440261.1_5 Reverse -37 -50 -10.6005 0.201
NP_440988.1_10 Reverse -227 -241 10.6108 0.187
NP_440988.1_10 Reverse -6 -20 4.02751 0.275
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTCAGCAAAGCGGGCATTTTCCGCTAAAAATCCGTAACCAGGGTGAATGGCAGTGGCGTTGCGGGTGAGGGCGGCGGCAATGATATTGGGAATGTTGAGATAGCTTTTATTGCTGGGGGGTGGCCCAATGCACACACTCTCGTTGGCTAGTTGCACGTGGAGGGCATGGCGATCGATGGTGGAGTGGACTGCCACGGTGGGAATGCCCAATTCTTCGCAACTGTGAATGATGCGTAGGGCGATCTCTCCCCGATTGGCAATTAAAATTTTGGCGAATTGCATTGGCCCACCCAGCTCTAGCGTTGGAAAACGATGTGTTTAGTCTTTTAGTAGAATATCGGGTTTTGTTGACTAGGCGATCGCCGATATACTGACCCCGCGTCCCCATTCCCATTGCCC

CDS

ATGACTTCCCCACCAACTCCAGACCAGGCCGCCGATGAGTATTTTGAGTATCATTTTGCCCATCGGGTCACCCCGGACCACCACGAAATTTTTCTGGAATGCCAAGAACAGTTAAAAATATTAGTAACAAAATATCCTGGTTATATTAGCAGTGAATCCACGGAATTAAGATCTGAAGGGGATATTTTTGTAGCGGAGACTGTAATCCGTTTTGATACACTGGAAAACTTTATGGGCTGGATAGATAGCCCGGAAAGAAGGCAACTAATTTACCTAGAAGAAAATGCTGGTTATCAGTTTGAAGGTAAAGTTAATACGGAAGGTTACAGTCGTTGGCTAAAACGCAAGTTGAGCAAACCTTCCCCTGTGTGGAAAATCAATCTTTTGGTGTTGTTGGTGCTTTATCCCACTGTGATGGGCTTTAACCTATTATTCCGTAAACCGGATTTTATCGACTTTCCCACCTGGATGCTATTTGGTAATTTTTGTAGCGTCTCTATCACGGGTTGGTTTGCGGTACCTTGGGTCAGTGGCATTTATCAACGCTGGCTAGAAGGTCAAGGCACAAAAAAAGAGCAAGCACTGGCTTTAGTAACCATTATTCTTGCCCTGCTTTTACTACTGCAATTTTTCCGGGTAATTTTCCAACAATTGGCCTAA

Protein

MTSPPTPDQAADEYFEYHFAHRVTPDHHEIFLECQEQLKILVTKYPGYISSESTELRSEGDIFVAETVIRFDTLENFMGWIDSPERRQLIYLEENAGYQFEGKVNTEGYSRWLKRKLSKPSPVWKINLLVLLVLYPTVMGFNLLFRKPDFIDFPTWMLFGNFCSVSITGWFAVPWVSGIYQRWLEGQGTKKEQALALVTIILALLLLLQFFRVIFQQLA