Your browser is old and dusty. Try Google Chrome!

Details for slr0066

ORF slr0066
Accession NP_442225.1
Symbol ribD
Category Riboflavin
Definition riboflavin biosynthesis protein RibD
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_7 Forward -379 -372 12.9205 0.23
NP_440120.1_4 Forward -107 -93 16.8142 0.256
NP_440931.1_7 Reverse -211 -229 14.5713 0.23
NP_442287.1_5 Forward -193 -183 14.7297 0.218
NP_440061.1_6 Forward -96 -78 16.0463 0.202
NP_440061.1_9 Reverse -311 -325 6.19383 0.255
NP_442062.1_8 Forward -259 -249 7.45319 0.0985
NP_442062.1_8 Forward -69 -59 4.50326 0.212
NP_441900.1_2 Reverse -183 -201 -4.70145 0.288
NP_441859.1_3 Forward -268 -249 2.06362 0.267
NP_441781.1_7 Forward -322 -303 0.294447 0.246
NP_441492.1_7 Forward -314 -295 16.7149 0.0931
NP_441352.1_2 Forward -206 -187 18.3873 0.0679
NP_441935.1_1 Forward -68 -49 7.47261 0.24
NP_441208.1_1 Forward -112 -93 -4.81876 0.263
NP_441434.1_3 Forward -243 -224 5.40766 0.194
NP_440178.1_7 Forward -322 -303 -13.0786 0.129
NP_442570.1_3 Forward -229 -210 -4.42544 0.23
NP_440842.1_10 Forward -113 -99 1.96621 0.281
NP_440057.1_6 Reverse -119 -138 17.4054 0.179
NP_441634.1_8 Forward -153 -139 -1.18038 0.282
NP_441002.1_6 Reverse -330 -349 12.585 0.275
NP_442687.1_7 Forward -59 -49 4.60159 0.243
NP_442485.1_3 Reverse -289 -308 11.3075 0.105
NP_440642.1_10 Reverse -173 -187 13.6669 0.128
NP_440642.1_10 Forward -153 -139 4.42388 0.255
NP_440642.1_10 Forward -15 -1 3.53891 0.271
NP_441080.1_7 Reverse -28 -46 7.68819 0.238
NP_441950.1_7 Forward -224 -205 -8.94866 0.287
NP_440360.1_10 Forward -278 -264 7.17775 0.227
NP_440528.1_1 Reverse -39 -52 17.041 0.257
NP_442496.1_5 Forward -197 -179 7.88563 0.256
NP_440607.1_4 Forward -228 -209 11.5042 0.217
NP_441127.1_1 Reverse -291 -305 10.3243 0.251
NP_441127.1_5 Forward -119 -100 13.0855 0.274
NP_442690.1_1 Forward -57 -38 -10.6203 0.217
NP_442690.1_1 Reverse -81 -100 -15.8318 0.28
NP_442002.1_1 Forward -229 -211 1.59244 0.183
NP_441654.1_5 Forward -167 -148 13.2959 0.252
NP_441674.1_5 Forward -386 -367 2.26107 0.152
NP_441125.1_6 Forward -181 -168 13.4906 0.244
NP_441041.1_7 Reverse -57 -69 6.73736 0.195
NP_441041.1_8 Reverse -363 -382 15.899 0.277
NP_440569.1_10 Reverse -109 -128 2.91208 0.28
NP_441725.1_4 Reverse -56 -70 2.06395 0.297
NP_442029.1_6 Reverse -285 -304 5.80098 0.248
NP_440929.1_8 Forward -345 -336 2.16301 0.262
NP_440045.1_3 Reverse -44 -61 11.3462 0.138
NP_443009.1_5 Forward -70 -59 3.69644 0.282
NP_440183.1_9 Reverse -176 -195 -16.3235 0.276
NP_440852.1_7 Reverse -196 -215 15.6332 0.281
NP_441637.1_9 Forward -135 -117 9.16393 0.223
NP_441764.1_8 Forward -106 -96 11.6935 0.284
NP_441251.1_8 Forward -250 -237 11.5208 0.27
NP_442677.1_3 Forward -390 -371 -5.70374 0.287
NP_442808.1_1 Reverse -211 -221 4.20782 0.203
NP_442808.1_1 Reverse -182 -192 2.24121 0.274
NP_442342.1_1 Reverse -289 -303 18.012 0.259
NP_440558.1_2 Forward -245 -226 -7.67036 0.298
NP_442593.1_5 Reverse -227 -246 14.5524 0.269
NP_442593.1_9 Forward -110 -91 15.4932 0.268
NP_441590.1_4 Forward -307 -288 1.6703 0.299
NP_442888.1_6 Forward -291 -272 2.0644 0.271
NP_441037.1_4 Forward -347 -337 9.65667 0.21
NP_442594.1_8 Forward -207 -188 4.32602 0.266
NP_442998.1_5 Forward -348 -338 13.648 0.157
NP_442998.1_5 Forward -105 -95 11.6814 0.179
NP_442998.1_5 Forward -106 -96 11.0914 0.196
NP_442998.1_5 Reverse -165 -175 8.92815 0.26
NP_441559.1_8 Reverse -55 -69 4.62115 0.115
NP_442069.1_8 Reverse -65 -84 4.32602 0.275
NP_441464.1_10 Forward -223 -209 8.84938 0.267
NP_442386.1_5 Reverse -44 -63 11.3067 0.148
NP_441750.1_1 Reverse -300 -319 -12.1936 0.3
NP_442484.1_2 Reverse -280 -299 4.52268 0.186
NP_442240.1_1 Forward -382 -363 3.83357 0.279
NP_440192.1_4 Forward -71 -52 9.49463 0.276
NP_440027.1_3 Reverse -313 -331 3.75497 0.267
NP_439984.1_1 Reverse -81 -100 13.0901 0.236
NP_439937.1_9 Forward -304 -287 -1.83013 0.132
NP_442294.1_3 Reverse -91 -105 13.7653 0.252
NP_440271.1_9 Reverse -99 -118 19.764 0.235
NP_441181.1_6 Forward -198 -180 11.0322 0.219
NP_440819.1_5 Forward -185 -177 7.98423 0.228
NP_441293.1_3 Reverse -118 -136 20.1508 0.153
NP_440267.1_2 Reverse -241 -255 5.30886 0.272
NP_442556.1_10 Forward -30 -11 7.68492 0.299
NP_441103.1_9 Forward -12 -2 12.4895 0.291
NP_440999.1_9 Forward -304 -290 4.32615 0.116
NP_442147.1_7 Forward -201 -182 18.7807 0.0993
NP_442225.1_10 Forward -384 -365 19.0748 0.0453
NP_442948.1_2 Reverse -290 -309 9.83255 0.166
NP_442277.1_4 Forward -334 -315 3.73524 0.216
NP_442845.1_2 Reverse -136 -150 4.62115 0.256
NP_441319.1_8 Forward -309 -291 10.2456 0.19
NP_443064.1_6 Reverse -49 -59 8.97947 0.254
NP_440071.1_6 Forward -115 -101 17.5862 0.125
NP_440220.1_4 Reverse -88 -107 -2.45958 0.271
NP_442736.1_10 Reverse -82 -101 19.5664 0.211
NP_440936.1_2 Reverse -146 -165 21.1406 0.0442
NP_440504.1_3 Forward -112 -93 11.0125 0.239
NP_442120.1_10 Forward -321 -302 -16.1268 0.296
NP_440673.1_3 Reverse -260 -267 8.29892 0.221
NP_440673.1_3 Forward -52 -45 7.80726 0.244
NP_442412.1_5 Forward -71 -52 4.71934 0.294
NP_441004.1_1 Reverse -300 -319 -15.8318 0.279
NP_442813.1_2 Reverse -164 -183 -1.86883 0.273
NP_440328.1_4 Reverse -240 -259 -0.590531 0.284
NP_441851.1_10 Forward -376 -366 8.23984 0.12
NP_441851.1_10 Forward -70 -60 4.50326 0.266
NP_441157.1_1 Reverse -88 -102 5.70218 0.235
NP_441501.1_9 Forward -311 -292 14.7483 0.253
NP_441982.1_6 Reverse -113 -122 10.7665 0.292
NP_441046.1_2 Forward -204 -185 -2.16383 0.295
NP_442843.1_1 Reverse -143 -162 -5.11376 0.241
NP_440474.1_8 Reverse -191 -205 7.96378 0.196
NP_441124.1_5 Reverse -165 -175 15.2045 0.198
NP_439950.1_1 Reverse -376 -385 14.7494 0.195
NP_442006.1_2 Reverse -370 -387 -18.7424 0.295
NP_441003.1_9 Reverse -92 -111 11.7008 0.213
NP_440483.1_1 Forward -118 -99 -8.752 0.295
NP_440078.1_4 Forward -202 -183 9.43923 0.295
NP_440707.1_9 Forward -210 -191 5.01433 0.255
NP_442003.1_9 Forward -198 -179 3.24438 0.281
NP_440760.1_1 Reverse -336 -355 -17.0118 0.191
NP_440760.1_9 Reverse -310 -329 11.7992 0.223
NP_442797.1_7 Forward -331 -313 -0.865831 0.288
NP_441057.1_3 Reverse -41 -60 -11.7019 0.24
NP_440913.1_1 Forward -376 -358 7.68896 0.196
NP_440280.1_4 Reverse -265 -279 15.6342 0.298
NP_442400.1_10 Reverse -119 -132 15.054 0.173
NP_442400.1_10 Reverse -84 -97 7.70113 0.282
NP_442749.1_5 Forward -112 -95 8.60932 0.231
NP_442913.1_9 Reverse -184 -203 6.19431 0.296
NP_441040.1_2 Reverse -263 -282 -7.08038 0.207
NP_442776.1_6 Reverse -240 -259 10.5209 0.207
NP_440545.1_5 Forward -225 -208 8.10198 0.21
NP_440010.1_3 Reverse -260 -279 -7.57203 0.278
NP_442828.1_7 Forward -194 -175 4.916 0.202
NP_441948.1_4 Forward -76 -58 -5.58572 0.271
NP_441044.1_4 Reverse -310 -328 3.46073 0.235
NP_441813.1_3 Reverse -364 -383 14.6251 0.242
NP_441892.1_1 Forward -331 -314 -2.12444 0.218
NP_441892.1_1 Forward -119 -102 -4.48438 0.261
NP_442193.1_1 Forward -127 -109 9.36059 0.245
NP_442216.1_4 Forward -385 -377 8.08217 0.255
NP_442899.1_4 Reverse -83 -99 10.6776 0.232
NP_440401.1_9 Reverse -216 -223 14.5917 0.287
NP_442402.1_4 Reverse -42 -61 -7.08111 0.27
NP_442402.1_10 Forward -123 -113 13.5492 0.2
NP_441848.1_4 Forward -111 -95 7.55067 0.288
NP_440505.1_3 Forward -376 -366 11.2881 0.0803
NP_440505.1_3 Forward -214 -204 6.07655 0.197
NP_440505.1_3 Forward -288 -278 4.79825 0.266
NP_441252.1_6 Forward -194 -187 11.6422 0.288
NP_441028.1_6 Forward -383 -373 10.9926 0.193
NP_441527.1_4 Forward -190 -171 -4.53629 0.187
NP_440429.1_9 Forward -236 -217 2.85105 0.278
NP_439903.1_6 Reverse -92 -111 0.195343 0.268
NP_442674.1_3 Forward -118 -99 3.34192 0.294
NP_440886.1_7 Forward -301 -291 5.09279 0.201
NP_440886.1_7 Reverse -189 -199 4.10949 0.253
NP_440828.1_1 Forward -301 -282 5.70185 0.204
NP_440176.1_3 Reverse -183 -197 13.9619 0.243
NP_441463.1_3 Reverse -248 -267 -6.39206 0.245
NP_441962.1_4 Forward -285 -266 -13.5702 0.275
NP_441858.1_2 Reverse -328 -347 9.93997 0.284
NP_442437.1_3 Reverse -52 -71 12.585 0.17
NP_442940.1_2 Reverse -313 -332 8.75091 0.167
NP_440798.1_1 Reverse -82 -100 10.4452 0.294
NP_440554.1_4 Forward -344 -334 1.74999 0.29
NP_440423.1_6 Reverse -292 -311 -15.5368 0.229
NP_442932.1_9 Forward -196 -177 6.19431 0.249
NP_441307.1_5 Forward -321 -302 20.7473 0.0255
NP_442354.1_8 Forward -67 -48 6.98095 0.266
NP_442275.1_1 Reverse -319 -338 7.27595 0.253
NP_441207.1_7 Reverse -378 -392 9.2554 0.282
NP_440880.1_6 Reverse -159 -178 12.0933 0.286
NP_441105.1_3 Forward -210 -191 -7.27704 0.25
NP_442371.1_1 Reverse -374 -384 13.4509 0.206
NP_440167.1_3 Forward -120 -101 17.404 0.101
NP_440244.1_1 Forward -193 -174 -8.16202 0.287
NP_442154.1_1 Forward -201 -183 -15.0255 0.218
NP_442564.1_10 Reverse -203 -217 8.16106 0.296
NP_440261.1_5 Reverse -337 -350 -3.12731 0.115
NP_440261.1_7 Reverse -321 -340 -5.31042 0.237
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CATCAACTTGATTCATATTTCCCCCTGGGAATCCTGCTTAGGGTTACTAACTGGGGCAGAACGCATTTTGCCGGAGGGGGGCATCCTCTATCTCTACGGCCCTTACCGCCAAAAGGGAGTACCAACGGCTCCTAGCAATGAAGCGTTTGATCAATCGTTGCAAAGTCGTAACCCAGCTTGGGGTTTGAGGCAGTTGGAAGATGTGATTGGGGAAGCGGGAAAGAGAAATTTACACAATCAAGCAATAATTCCCATGCCTGCTAACAATTTATCGGTAATTTTCCAGAAGGGGTCAGGGCAAAATTCTGGTTAATATTCATTACTCACAGTCGGGAATTGCTGGGTAATCCGTTGCTAAAAATCCAGTAGATTTGACTAGATTCCATTTCCCTACCCTGCC

CDS

ATGATCTCAGACCAAACCCATATGCGTCGTTGCCTAACCCTGGCAAAAACGGCGATCGGCAAAACAGCCCCCAATCCCCTGGTGGGGTCGGTCATTGTCCAGGGAGACGAGATTGTCGGCCAAGGTTTCCATCCCCAAGCGGGGCAGCCCCATGGGGAAATTTTTGCCCTCTGGGAAGCTGGCGATCGGGCCAAGGGAGCGACTCTATACGTCAATTTGGAGCCCTGTAACCATCAAGGTCGTACTCCCCCTTGTACAGAAGCAATTATTCAAGCGGGGATCGCCAAGGTGGTGGTGGGCATGGTGGACCCCAATCCTTTGGTGGCGGGTAAAGGTATTAGTCGATTGAGACAGGCCGGCATTGAGGTGAAGGTGGGGGTGGAAGAGGAAGCTTGTCAGCGACTGAATGAGGCTTTTTGCTTTCGCATCAAGCATCAACGACCCTTTGGCATTTTCAAATACGCCATGACTTTGGACGGCAAAATTGCCACTGCCCAGGCCCATAGCAGTTGGGTGACTAGTAGCTCGGCTCGTCATTGGGTTCATCAATTACGCAGTCAATGTCAGGCGGTGATTATTGGGGGGAATACGGTGCGGCGGGATAATCCTTTGTTAACGAATCATGGGGTGGGCGAGGTGAATCCTTTGCGCGTGGTGTTGAGTCGTAGTTTAGATTTACCCATAGAGGCTCAATTGTGGGATCAAGATGTAGCTAAAACTTTGGTTATTACGGAAAAAACCTGTGATCGAAATACGCTTAGCCATCTAGAAAAATTAGAGGTAGAAACCCTAGTGTTGGAGCAATTAACTCCCTTGGCGGTGATGGAAGAGTTATATCAACGGAACTGTTTGCAGGTGTTGTGGGAATGTGGCGGTATTCTCGCTGCTGAGGCGATCGCCATGGGGACAGTGCAAAAAGTCCATGCTTTTCTGGCCCCGAAAATTATTGGTGGGGTTGCAGCCCCGACTCCGGTGGGGGAACTGGGTTTTCAACAAATGACCCAAGCGTTGAATTTAACTGATCTCCATTGCCAGGCAATCGGGCCCGATTGGTTATTTACGGGCTACCTATGCGGGAACGACGACAACGGTCAGAGCAATATTTAA

Protein

MISDQTHMRRCLTLAKTAIGKTAPNPLVGSVIVQGDEIVGQGFHPQAGQPHGEIFALWEAGDRAKGATLYVNLEPCNHQGRTPPCTEAIIQAGIAKVVVGMVDPNPLVAGKGISRLRQAGIEVKVGVEEEACQRLNEAFCFRIKHQRPFGIFKYAMTLDGKIATAQAHSSWVTSSSARHWVHQLRSQCQAVIIGGNTVRRDNPLLTNHGVGEVNPLRVVLSRSLDLPIEAQLWDQDVAKTLVITEKTCDRNTLSHLEKLEVETLVLEQLTPLAVMEELYQRNCLQVLWECGGILAAEAIAMGTVQKVHAFLAPKIIGGVAAPTPVGELGFQQMTQALNLTDLHCQAIGPDWLFTGYLCGNDDNGQSNI