Your browser is old and dusty. Try Google Chrome!

Details for slr0064

ORF slr0064
Accession NP_442223.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Reverse -122 -141 2.16274 0.243
NP_441418.1_6 Forward -81 -62 -28.5165 0.205
NP_441818.1_1 Reverse -73 -84 10.2846 0.232
NP_441818.1_9 Forward -81 -62 0.294447 0.191
NP_442752.1_4 Forward -72 -65 7.90559 0.144
NP_442752.1_4 Forward -381 -374 7.6106 0.151
NP_441043.1_10 Forward -359 -345 11.701 0.296
NP_441781.1_7 Reverse -221 -240 -0.0988766 0.256
NP_441035.1_1 Forward -241 -222 18.4857 0.198
NP_442762.1_10 Reverse -228 -247 -12.4886 0.285
NP_439918.1_2 Forward -315 -296 -2.26216 0.242
NP_441935.1_2 Forward -246 -227 -5.40875 0.29
NP_441925.1_4 Reverse -56 -75 -7.47443 0.195
NP_440856.1_7 Forward -297 -278 -8.06369 0.264
NP_440856.1_7 Reverse -315 -334 -8.94866 0.28
NP_441083.1_5 Reverse -134 -144 0.865012 0.218
NP_441713.1_3 Forward -131 -112 3.24438 0.259
NP_440178.1_7 Reverse -284 -303 -21.3384 0.218
NP_440343.1_3 Reverse -128 -146 3.75497 0.266
NP_440343.1_3 Reverse -221 -239 2.87 0.288
NP_441014.1_8 Reverse -295 -314 -8.94866 0.288
NP_442848.1_5 Reverse -293 -311 2.87075 0.276
NP_443018.1_3 Reverse -73 -80 10.4622 0.103
NP_443018.1_3 Forward -80 -73 4.36568 0.254
NP_441182.1_3 Reverse -320 -338 19.6853 0.241
NP_442687.1_7 Forward -337 -327 4.0116 0.271
NP_441846.1_10 Forward -82 -63 -10.9153 0.19
NP_441846.1_10 Forward -75 -56 -12.8819 0.197
NP_441846.1_10 Forward -80 -61 -20.65 0.256
NP_441846.1_10 Forward -81 -62 -22.125 0.257
NP_441846.1_10 Forward -240 -221 -22.3217 0.259
NP_441846.1_10 Forward -314 -295 -22.5183 0.261
NP_440781.1_1 Reverse -317 -331 11.5043 0.289
NP_440360.1_5 Forward -222 -203 0.294447 0.297
NP_440141.1_8 Forward -81 -62 4.52268 0.288
NP_440669.1_8 Reverse -167 -186 20.6481 0.235
NP_442205.1_9 Forward -231 -215 4.68009 0.148
NP_442223.1_3 Forward -137 -118 24.7789 0.00681
NP_442223.1_9 Forward -215 -197 21.947 0.0263
NP_441414.1_6 Forward -354 -335 -4.72043 0.262
NP_441414.1_9 Reverse -104 -123 -8.26035 0.232
NP_440800.1_2 Reverse -82 -101 16.3786 0.147
NP_442937.1_5 Reverse -318 -337 5.80098 0.3
NP_442364.1_2 Forward -166 -147 9.73422 0.279
NP_441580.1_6 Forward -141 -122 -9.24366 0.29
NP_441941.1_9 Forward -296 -277 3.53937 0.236
NP_443055.1_6 Reverse -55 -73 -0.76823 0.266
NP_440138.1_6 Reverse -105 -124 5.50519 0.23
NP_442431.1_10 Forward -78 -60 0.609134 0.269
NP_441041.1_4 Forward -81 -62 -10.4236 0.232
NP_439966.1_7 Reverse -70 -80 14.5325 0.0203
NP_440202.1_8 Forward -191 -172 13.3078 0.26
NP_440983.1_5 Reverse -288 -307 -8.752 0.295
NP_442281.1_1 Reverse -67 -81 2.65393 0.26
NP_442281.1_1 Reverse -37 -51 2.16228 0.276
NP_441087.1_6 Reverse -212 -230 -1.45654 0.265
NP_441644.1_6 Reverse -72 -82 3.22451 0.293
NP_443049.1_6 Forward -82 -72 11.9337 0.24
NP_442177.1_1 Forward -74 -55 19.5673 0.138
NP_442029.1_6 Forward -314 -295 5.40766 0.25
NP_440253.1_2 Reverse -72 -90 6.11567 0.0856
NP_442933.1_1 Forward -281 -262 6.2543 0.275
NP_441762.1_7 Forward -213 -201 -6.2542 0.284
NP_442142.1_4 Reverse -69 -82 9.45847 0.095
NP_441525.1_1 Reverse -284 -297 15.1623 0.21
NP_443009.1_5 Reverse -120 -131 7.138 0.137
NP_440881.1_3 Reverse -295 -314 14.4533 0.28
NP_440279.1_2 Forward -124 -105 17.0107 0.0492
NP_441468.1_1 Forward -80 -73 4.07068 0.263
NP_441618.1_6 Forward -308 -289 8.55425 0.3
NP_441020.2_6 Forward -395 -378 11.0519 0.13
NP_441020.2_6 Forward -83 -66 7.512 0.229
NP_441015.1_10 Forward -80 -61 -7.37537 0.266
NP_441015.1_10 Forward -77 -58 -11.4069 0.296
NP_441244.1_8 Forward -78 -59 5.11266 0.143
NP_441096.1_5 Reverse -220 -238 14.2763 0.297
NP_441330.1_1 Reverse -116 -135 -5.70374 0.129
NP_442227.1_2 Reverse -65 -84 1.47442 0.245
NP_442227.1_2 Reverse -62 -81 -1.47551 0.262
NP_442808.1_1 Reverse -71 -81 7.0594 0.0892
NP_442542.1_9 Forward -241 -227 7.76712 0.183
NP_442342.1_9 Forward -251 -235 1.92682 0.296
NP_440342.1_1 Forward -238 -219 13.9625 0.203
NP_441114.1_3 Forward -10 -1 7.66954 0.231
NP_442593.1_1 Forward -64 -45 17.8957 0.193
NP_441878.1_6 Reverse -41 -51 0.668351 0.139
NP_441308.1_8 Forward -383 -373 12.7631 0.218
NP_440058.1_6 Reverse -201 -220 4.32602 0.291
NP_442645.1_2 Forward -227 -208 -21.7317 0.29
NP_442594.1_8 Forward -81 -62 6.58763 0.226
NP_442508.1_8 Forward -82 -65 9.18362 0.292
NP_442047.1_2 Reverse -127 -141 11.7993 0.297
NP_440690.1_1 Forward -306 -287 9.3409 0.249
NP_441633.1_3 Reverse -325 -338 -6.17557 0.238
NP_441633.1_3 Reverse -171 -184 -6.96221 0.283
NP_442998.1_2 Reverse -61 -80 7.96345 0.225
NP_441799.1_1 Reverse -68 -82 5.30886 0.214
NP_441007.1_10 Forward -239 -226 1.10092 0.209
NP_440256.1_1 Reverse -118 -137 0.294447 0.085
NP_440215.1_10 Reverse -320 -339 13.1758 0.276
NP_441464.1_8 Forward -251 -237 8.16106 0.2
NP_440702.1_2 Forward -83 -64 -7.17871 0.269
NP_440026.1_6 Reverse -240 -259 15.1416 0.238
NP_442386.1_9 Reverse -71 -80 12.389 0.0646
NP_442386.1_9 Forward -131 -122 9.34074 0.166
NP_442054.1_3 Reverse -346 -365 6.58763 0.064
NP_442054.1_3 Reverse -46 -65 -5.9004 0.297
NP_442054.1_4 Reverse -23 -42 10.5209 0.275
NP_441340.1_5 Forward -80 -73 4.07068 0.239
NP_442240.1_1 Reverse -125 -144 4.22689 0.273
NP_440586.1_8 Reverse -73 -80 7.61025 0.227
NP_440969.1_3 Reverse -57 -75 6.99988 0.294
NP_440027.1_3 Reverse -62 -80 2.77167 0.286
NP_442239.1_8 Reverse -323 -342 4.71934 0.296
NP_440372.1_2 Forward -80 -73 4.07068 0.262
NP_440171.1_3 Forward -199 -180 6.68596 0.259
NP_441789.1_7 Reverse -62 -81 -1.47628 0.251
NP_441803.1_2 Forward -344 -325 5.99764 0.159
NP_441572.1_1 Reverse -274 -293 -4.22878 0.234
NP_442790.1_4 Reverse -321 -340 -15.9302 0.3
NP_442262.1_10 Reverse -73 -80 10.6589 0.14
NP_441689.1_5 Forward -83 -73 5.28945 0.273
NP_440163.1_10 Forward -84 -74 9.51814 0.232
NP_440531.1_6 Reverse -64 -83 -2.0655 0.244
NP_442910.1_3 Forward -189 -173 14.8082 0.285
NP_441640.1_8 Reverse -73 -92 -0.0988766 0.197
NP_442693.1_8 Forward -342 -323 15.6332 0.173
NP_442067.1_4 Reverse -318 -337 4.42435 0.256
NP_440999.1_1 Reverse -61 -80 3.9319 0.249
NP_440999.1_9 Forward -333 -319 0.687908 0.177
NP_440999.1_9 Reverse -62 -76 -0.197071 0.201
NP_440888.1_2 Reverse -294 -308 8.16044 0.171
NP_440888.1_2 Reverse -72 -86 7.57046 0.19
NP_440888.1_2 Reverse -66 -80 7.47213 0.194
NP_440888.1_2 Reverse -121 -135 7.3738 0.198
NP_441949.1_4 Reverse -205 -224 8.84924 0.213
NP_441538.1_4 Reverse -88 -107 18.879 0.118
NP_441917.1_1 Reverse -167 -186 4.81767 0.257
NP_441543.1_3 Reverse -62 -76 12.6836 0.163
NP_442845.1_2 Forward -87 -73 4.32615 0.261
NP_441551.1_5 Reverse -68 -84 6.15437 0.281
NP_441178.1_6 Reverse -290 -309 7.66846 0.26
NP_442578.1_5 Reverse -63 -82 5.70265 0.241
NP_440071.1_1 Forward -334 -317 9.47787 0.259
NP_440516.1_8 Forward -81 -72 -0.491928 0.262
NP_442428.1_5 Forward -80 -73 4.46401 0.267
NP_440783.1_2 Reverse -289 -308 5.60432 0.0908
NP_442120.1_10 Forward -63 -44 -3.44213 0.199
NP_440673.1_3 Reverse -74 -81 13.2155 0.0426
NP_441052.1_2 Reverse -42 -52 0.57002 0.256
NP_440436.1_4 Reverse -122 -131 7.76745 0.124
NP_442864.1_2 Forward -221 -202 12.1925 0.246
NP_441004.1_1 Forward -315 -296 -11.5053 0.24
NP_441004.1_3 Reverse -327 -346 4.12936 0.24
NP_440864.1_9 Reverse -222 -241 1.67108 0.139
NP_441396.1_5 Forward -80 -71 7.76787 0.239
NP_441683.1_7 Forward -315 -296 -7.08038 0.272
NP_440432.1_1 Reverse -31 -50 14.1591 0.0891
NP_440432.1_9 Forward -293 -278 -3.36336 0.179
NP_442843.1_1 Forward -80 -61 -7.86702 0.252
NP_439950.1_1 Forward -66 -57 17.306 0.145
NP_442006.1_2 Forward -243 -226 -6.25434 0.159
NP_441570.1_1 Forward -81 -63 -16.5005 0.247
NP_440078.1_10 Forward -339 -320 2.75272 0.269
NP_442729.1_5 Forward -82 -72 13.0581 0.234
NP_441539.1_9 Reverse -76 -90 23.1409 0.0544
NP_440707.1_6 Forward -111 -92 11.995 0.237
NP_442443.1_1 Forward -80 -61 5.11266 0.157
NP_442443.1_1 Forward -200 -181 0.0977854 0.219
NP_442443.1_1 Reverse -319 -338 -5.70374 0.284
NP_442320.1_8 Forward -136 -122 -4.52363 0.171
NP_441732.1_2 Reverse -380 -396 -17.7394 0.292
NP_440713.1_4 Forward -85 -66 0.884433 0.3
NP_442489.1_2 Forward -92 -73 8.75091 0.168
NP_441452.1_1 Reverse -61 -80 12.4875 0.292
NP_440284.1_9 Reverse -158 -177 6.68596 0.298
NP_441040.1_2 Reverse -319 -338 -8.65367 0.236
NP_441040.1_2 Reverse -125 -144 -10.522 0.248
NP_441800.1_7 Forward -341 -323 -1.94747 0.256
NP_442346.1_5 Forward -337 -327 9.12481 0.118
NP_440352.1_7 Reverse -221 -234 17.6199 0.194
NP_440545.1_3 Forward -151 -134 -6.05768 0.268
NP_440025.1_4 Reverse -125 -144 11.0125 0.234
NP_441923.1_6 Forward -80 -66 9.43936 0.278
NP_441585.1_2 Forward -124 -105 13.6675 0.289
NP_440170.1_3 Forward -245 -226 5.211 0.281
NP_440671.1_5 Reverse -58 -72 17.3052 0.138
NP_441813.1_5 Reverse -70 -80 4.20827 0.163
NP_441239.1_9 Reverse -70 -82 8.20045 0.141
NP_441239.1_9 Reverse -61 -73 4.16888 0.26
NP_440665.1_1 Forward -246 -227 -6.49039 0.207
NP_442044.1_1 Forward -302 -283 -14.2585 0.284
NP_442193.1_1 Forward -396 -378 7.19731 0.295
NP_442216.1_4 Reverse -57 -65 17.6202 0.23
NP_442138.1_10 Forward -294 -275 -6.49039 0.285
NP_442809.1_6 Forward -142 -123 1.47442 0.272
NP_440546.1_4 Forward -81 -71 14.2152 0.0459
NP_440462.1_6 Reverse -70 -80 1.65166 0.294
NP_440868.1_4 Reverse -68 -80 -0.157684 0.248
NP_441474.1_1 Reverse -62 -81 12.88 0.18
NP_441848.1_9 Reverse -62 -73 13.7261 0.218
NP_442829.1_2 Reverse -12 -28 7.65792 0.297
NP_440505.1_7 Reverse -323 -342 3.34271 0.214
NP_441011.1_8 Forward -80 -71 8.25953 0.144
NP_442533.1_1 Forward -84 -65 -4.32711 0.14
NP_442533.1_1 Forward -78 -59 -8.06369 0.201
NP_442533.1_1 Forward -314 -295 -13.9635 0.239
NP_442533.1_6 Forward -336 -327 3.53964 0.21
NP_442533.1_6 Reverse -72 -81 2.65466 0.246
NP_442541.1_10 Reverse -219 -233 16.5185 0.182
NP_442322.1_4 Reverse -63 -80 2.29975 0.21
NP_442322.1_4 Reverse -64 -81 -6.05834 0.275
NP_441028.1_6 Reverse -67 -77 5.97777 0.234
NP_441439.1_8 Reverse -238 -257 14.4541 0.293
NP_441886.1_1 Forward -125 -106 33.3337 0.0000474
NP_441886.1_2 Forward -245 -226 31.8587 0.0000491
NP_441886.1_3 Forward -278 -259 20.2556 0.154
NP_441886.1_4 Forward -224 -205 23.9922 0.0194
NP_441886.1_5 Forward -305 -286 27.7288 0.00107
NP_441886.1_6 Forward -200 -181 19.469 0.11
NP_441886.1_7 Forward -392 -373 34.8086 0.00000943
NP_440886.1_7 Reverse -71 -81 6.86274 0.113
NP_440886.1_7 Reverse -62 -72 6.0761 0.147
NP_441463.1_1 Forward -305 -287 14.4738 0.273
NP_441463.1_3 Reverse -313 -332 -1.27885 0.138
NP_441463.1_7 Forward -55 -36 19.9606 0.0948
NP_441962.1_4 Forward -147 -128 -14.1602 0.284
NP_440855.1_5 Reverse -292 -311 7.27514 0.285
NP_441431.1_2 Forward -339 -325 6.48882 0.269
NP_441993.1_1 Reverse -324 -343 4.38312 0.221
NP_441993.1_1 Forward -50 -31 2.53143 0.257
NP_441174.1_4 Forward -148 -138 11.0914 0.288
NP_442805.1_5 Reverse -56 -75 -4.81951 0.269
NP_440114.1_10 Forward -130 -116 6.58777 0.263
NP_442743.1_1 Reverse -62 -81 4.12856 0.3
NP_439910.1_2 Forward -89 -72 -22.3806 0.232
NP_442867.1_8 Forward -211 -192 5.01433 0.277
NP_440457.1_1 Forward -234 -222 1.7106 0.227
NP_440054.1_4 Reverse -195 -214 9.43923 0.298
NP_441436.1_2 Forward -80 -61 -6.98204 0.296
NP_443037.1_6 Reverse -79 -98 10.9142 0.194
NP_440554.1_4 Reverse -73 -83 3.22496 0.239
NP_440423.1_6 Forward -80 -61 -12.0953 0.184
NP_440091.1_1 Forward -85 -73 -0.74767 0.286
NP_440679.1_10 Forward -79 -60 -5.01543 0.161
NP_441122.1_1 Forward -16 -1 3.22482 0.283
NP_440149.1_8 Forward -81 -62 -3.73712 0.196
NP_442373.1_2 Forward -312 -293 -9.73531 0.265
NP_441226.1_7 Reverse -73 -80 11.2485 0.0971
NP_442834.1_9 Forward -83 -64 4.916 0.272
NP_441766.1_2 Reverse -72 -81 5.3096 0.131
NP_440416.1_9 Reverse -61 -80 -18.7818 0.264
NP_440416.1_9 Reverse -127 -146 -20.65 0.287
NP_443052.1_8 Forward -304 -285 -7.17871 0.154
NP_443052.1_8 Forward -346 -327 -10.1286 0.203
NP_443052.1_9 Reverse -380 -399 -7.37537 0.297
NP_440072.1_5 Forward -81 -63 -3.81576 0.285
NP_440845.1_1 Forward -66 -47 -4.6221 0.233
NP_442154.1_1 Forward -80 -62 -12.5672 0.217
NP_440261.1_5 Reverse -328 -341 -4.40561 0.147
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTCGGGTGGGGGTCTATGAGGTGATGCGTAATTCTGAGCGTATTGCTGAATTGATTAACCAGGGGGCCACCACTGACCGCATTAAGGATTGTGCGGTGGAAGAGGGCATGATCACCCTATTGGCCTATAGTCTTAATTTAGTGCAGGAAGGCTACACCACCCTAGAGGAGGTGGAACGGGTCACTTTCACCGATACCGGACTGGAGTCAGAAATGCGGGCTAAGCGCAAGAGTGCTTTAACCTGTCGTACGTGTGCGGCGGAACTGCAACAGGAATGGCTTGATTGTCCCTATTGCATGACTTCCCGGTTTAGCTAAATAGCGATGGGGGTGAGGGGGGAATTAGCTCTGTCCATGGACCATTGATAGGTGCACTGTCTTCCATTCTTTACCATTGACCA

CDS

ATGCCAGACACTAGCGCCTTTTCCGCAACAACTCGGCCCTATTTTGCCACTGTGGCCCGGGGACTGGAGGCGATCGCCGCCCAGGAGTTAACTGAATTGGGGGCAGAACAGGTAAAGCCAGAATTTGCTGGGGTTGCCTTCATTGGCGATCGGGCCCTACTGTACCGCATTAACCTCTGGTCTCGGTTAATTTATCGGGTGCTGATGCCCATGGCCACGGTCAAAGCCTTTAACGCCCAGGACCTATACCGCAGCATCAAAAAAATAGATTGGGACGAATATTTCAGCCCCGAGCAAACTTTACAAATTAACTGCACTGGCAAAAATCCCCAGCTTAACCATAGCCATTTCACCGCTCTTCAGGTGAAAAATGCCATTGTTGATCAACAGCGTGATCGCTATCAACGTCGTTCTAGTGTTGACCTCGAGCAGCCAGATATAGTTATCAATGCCCACATTCACCAAAACCATTGTCAACTAAGTTTGGATAGTACGGGTTTTAGTCTGCACCGTCGGGGTTATCGGCCTGCCCTGGGGAATGCCCCCCTGAAGGAGACCTTAGCTTCTGCTTTGTTAACTATGGCCGGATGGACTCCGGAACTCCCCCTTTATGATCCCCTCTGTGGCTCTGGTACTTTTCTCTTGGAAGCGGGGCTACAAAGTTTAAACATTGCTCCCGGCAAATTTCAGCCTGGTTTTTGTTTTCAGCAATGGCCCGATTTCGACCAAGACCTCTGGCATTCCCTCCTGCAAACAGCCAAGGCCGGGGAAAGGGATACCCTCCAAGCTCCCCTGTGGGGCAGTGACGGCGATCGGGAGGTAATTCAGGCGGCTAAGAGCAATGCCCAACAATGTCAGTTGGGAGGAAAAATCCATTGGCAAAAATTGAATTTTGCCGACATTGAACCACCGGCCGCCGAAGGAGTGCTAATTTGTAATCCTCCCTACGGTAAGCGCATTGGCCAAGAGGAAGCATTGGGGGATTTTTATCAACAAATAGGGGATGTGCTCAAGCAAAGATTTAGGGGTTGGACAGCCTTCGTTTTCAGTGGAAACAAGGCTTTGACCAAACGCATTGGCTTAAGAACCTCTGCCCGTTTTCCCGTTAACAATGGCGGTCTACCCTGCACTCTGTTGAAGTATGAACTTTACTGA

Protein

MPDTSAFSATTRPYFATVARGLEAIAAQELTELGAEQVKPEFAGVAFIGDRALLYRINLWSRLIYRVLMPMATVKAFNAQDLYRSIKKIDWDEYFSPEQTLQINCTGKNPQLNHSHFTALQVKNAIVDQQRDRYQRRSSVDLEQPDIVINAHIHQNHCQLSLDSTGFSLHRRGYRPALGNAPLKETLASALLTMAGWTPELPLYDPLCGSGTFLLEAGLQSLNIAPGKFQPGFCFQQWPDFDQDLWHSLLQTAKAGERDTLQAPLWGSDGDREVIQAAKSNAQQCQLGGKIHWQKLNFADIEPPAAEGVLICNPPYGKRIGQEEALGDFYQQIGDVLKQRFRGWTAFVFSGNKALTKRIGLRTSARFPVNNGGLPCTLLKYELY