Your browser is old and dusty. Try Google Chrome!

Details for slr0058

ORF slr0058
Accession NP_442215.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -176 -162 9.14437 0.0795
NP_441061.1_2 Reverse -279 -293 1.57289 0.186
NP_441061.1_2 Reverse -96 -110 0.982901 0.196
NP_441061.1_2 Reverse -174 -188 -2.06536 0.281
NP_440795.1_7 Forward -103 -96 14.6904 0.0123
NP_440795.1_7 Reverse -96 -103 14.6904 0.0123
NP_441418.1_6 Reverse -95 -114 -4.32711 0.0259
NP_441418.1_6 Forward -104 -85 -20.0601 0.103
NP_441418.1_6 Reverse -162 -181 -30.3848 0.274
NP_440897.1_6 Forward -253 -234 -2.26292 0.206
NP_441453.1_1 Forward -111 -93 3.36165 0.269
NP_441453.1_4 Reverse -95 -103 16.539 0.00633
NP_441453.1_4 Forward -104 -96 16.539 0.00633
NP_441453.1_7 Reverse -54 -61 12.9205 0.23
NP_442151.1_6 Forward -104 -90 15.4376 0.0238
NP_442151.1_6 Reverse -95 -109 10.226 0.127
NP_442151.1_6 Forward -171 -157 5.30946 0.284
NP_440561.1_4 Forward -255 -236 16.5175 0.158
NP_441818.1_1 Forward -313 -302 8.80962 0.277
NP_441818.1_1 Forward -103 -92 8.51463 0.288
NP_440226.1_1 Reverse -95 -114 13.6675 0.0352
NP_440226.1_1 Forward -104 -85 1.96607 0.282
NP_441630.1_3 Reverse -87 -106 13.0775 0.0615
NP_440996.1_3 Reverse -161 -179 12.1139 0.221
NP_442173.1_1 Forward -103 -95 15.4574 0.00633
NP_442173.1_1 Reverse -96 -104 15.4574 0.00633
NP_442752.1_4 Forward -104 -97 13.8055 0.0199
NP_442752.1_4 Reverse -95 -102 13.8055 0.0199
NP_442752.1_4 Forward -290 -283 7.90559 0.144
NP_443027.1_4 Forward -106 -96 13.943 0.0452
NP_443027.1_4 Forward -55 -45 5.97822 0.294
NP_439997.1_6 Reverse -50 -69 15.0441 0.177
NP_442975.1_10 Forward -108 -94 12.3887 0.0477
NP_440784.1_7 Forward -103 -96 15.9687 0.0123
NP_440784.1_7 Reverse -96 -103 15.9687 0.0123
NP_440061.1_9 Reverse -93 -107 5.1122 0.294
NP_441054.1_4 Forward -114 -96 2.87075 0.169
NP_440878.1_9 Forward -114 -95 -2.85214 0.281
NP_442062.1_8 Reverse -95 -105 19.4496 0.000558
NP_442062.1_8 Forward -104 -94 17.6796 0.00193
NP_442062.1_8 Forward -53 -43 2.83163 0.293
NP_441995.1_5 Reverse -27 -45 17.0304 0.181
NP_441859.1_3 Forward -105 -86 6.29183 0.18
NP_441859.1_3 Reverse -94 -113 2.26028 0.263
NP_440304.1_4 Forward -106 -96 9.91146 0.051
NP_440304.1_4 Reverse -93 -103 9.91146 0.051
NP_440304.1_4 Reverse -160 -170 4.60159 0.258
NP_440304.1_4 Reverse -242 -252 4.20827 0.272
NP_442242.1_4 Forward -103 -96 14.3954 0.0124
NP_442242.1_4 Reverse -96 -103 14.3954 0.0124
NP_440044.1_8 Forward -103 -84 -3.44213 0.284
NP_441781.1_7 Forward -183 -164 2.0644 0.21
NP_441581.1_9 Forward -131 -112 12.9387 0.261
NP_442181.1_1 Forward -254 -235 8.55425 0.299
NP_441200.1_4 Reverse -207 -226 13.3725 0.156
NP_441935.1_2 Reverse -83 -102 3.93269 0.183
NP_441208.1_9 Reverse -92 -106 14.2576 0.1
NP_442110.1_7 Reverse -162 -176 6.98109 0.128
NP_442110.1_7 Reverse -168 -182 2.35953 0.222
NP_442110.1_7 Reverse -95 -109 1.08123 0.239
NP_440014.1_6 Forward -113 -94 7.47261 0.265
NP_441083.1_5 Forward -104 -94 19.3512 0.000718
NP_441083.1_5 Reverse -95 -105 11.3864 0.0159
NP_442827.1_8 Forward -112 -93 2.75194 0.155
NP_441434.1_7 Forward -102 -88 2.45787 0.284
NP_441738.1_2 Forward -102 -95 15.28 0.0102
NP_441738.1_2 Reverse -97 -104 15.28 0.0102
NP_441558.1_5 Reverse -93 -112 14.3558 0.0495
NP_440209.1_1 Reverse -95 -103 18.1123 0.00295
NP_440209.1_1 Forward -104 -96 18.1123 0.00295
NP_442180.1_10 Reverse -41 -60 16.8141 0.00751
NP_442889.1_8 Forward -107 -93 3.8339 0.273
NP_441713.1_1 Forward -110 -91 -6.58872 0.12
NP_441713.1_1 Reverse -364 -383 -14.9469 0.26
NP_441713.1_8 Forward -51 -33 10.0489 0.268
NP_442570.1_3 Reverse -166 -185 -2.55715 0.212
NP_442570.1_3 Forward -50 -31 -8.55534 0.288
NP_442445.1_2 Forward -169 -150 10.2259 0.288
NP_441716.1_1 Reverse -95 -109 13.4709 0.0689
NP_441598.1_3 Forward -389 -370 15.0073 0.161
NP_442111.1_4 Reverse -94 -108 16.8142 0.0128
NP_441163.1_4 Reverse -33 -52 12.4364 0.288
NP_440906.1_5 Forward -103 -96 15.8704 0.0124
NP_440906.1_5 Reverse -96 -103 15.8704 0.0124
NP_442442.1_5 Forward -124 -105 6.39097 0.289
NP_440747.1_10 Reverse -92 -104 5.54551 0.0128
NP_440747.1_10 Forward -107 -95 -2.02597 0.0196
NP_441130.1_10 Forward -106 -92 11.3077 0.107
NP_441130.1_10 Reverse -248 -262 10.3243 0.114
NP_441130.1_10 Reverse -93 -107 9.43936 0.125
NP_441486.1_1 Forward -107 -93 14.4542 0.00637
NP_441486.1_1 Reverse -92 -106 4.32615 0.0462
NP_442850.1_6 Forward -182 -163 17.0107 0.256
NP_442634.1_4 Reverse -93 -107 -4.91696 0.223
NP_442634.1_4 Forward -55 -41 -5.70361 0.271
NP_441265.1_3 Forward -110 -96 3.14618 0.181
NP_440470.1_5 Reverse -107 -126 9.11906 0.237
NP_440403.1_4 Forward -113 -94 -9.34199 0.274
NP_440403.1_10 Reverse -86 -105 1.86774 0.283
NP_440842.1_10 Forward -248 -234 3.53951 0.255
NP_440842.1_10 Reverse -235 -249 3.53951 0.255
NP_440842.1_10 Forward -186 -172 1.57289 0.288
NP_441695.1_4 Reverse -45 -63 9.95058 0.292
NP_441014.1_10 Reverse -304 -323 2.26028 0.216
NP_442848.1_1 Forward -110 -96 -1.96703 0.263
NP_442848.1_5 Reverse -236 -254 2.18243 0.276
NP_442848.1_9 Reverse -89 -108 5.60432 0.202
NP_441012.1_4 Forward -175 -162 13.7856 0.209
NP_441012.1_4 Reverse -40 -53 5.91914 0.286
NP_443018.1_3 Forward -103 -96 14.8871 0.0123
NP_443018.1_3 Reverse -96 -103 14.8871 0.0123
NP_443018.1_3 Reverse -169 -176 4.26735 0.267
NP_443018.1_3 Forward -176 -169 4.16902 0.278
NP_441316.1_7 Forward -106 -91 0.963207 0.177
NP_441634.1_8 Reverse -93 -107 6.19444 0.114
NP_441634.1_8 Reverse -42 -56 -1.96703 0.295
NP_440376.1_1 Forward -104 -95 19.4693 0.000692
NP_440376.1_1 Reverse -95 -104 19.4693 0.000692
NP_440376.1_1 Forward -252 -243 1.96635 0.236
NP_441857.1_5 Forward -111 -93 1.10079 0.299
NP_441588.1_4 Forward -102 -92 9.22315 0.14
NP_442687.1_7 Reverse -94 -104 18.5646 0.0028
NP_442687.1_7 Forward -105 -95 15.8113 0.0125
NP_442687.1_7 Forward -184 -174 3.71661 0.292
NP_442485.1_3 Reverse -157 -176 3.83436 0.193
NP_441846.1_10 Forward -53 -34 -21.7317 0.256
NP_440642.1_8 Reverse -97 -116 15.8516 0.138
NP_440642.1_10 Reverse -154 -168 3.73557 0.265
NP_440642.1_10 Reverse -373 -387 2.06395 0.284
NP_441013.1_2 Reverse -157 -175 -4.70074 0.299
NP_441013.1_3 Reverse -162 -181 11.3075 0.204
NP_440533.1_9 Reverse -95 -114 4.81767 0.216
NP_440360.1_10 Forward -102 -88 3.8345 0.227
NP_442658.1_1 Forward -106 -96 18.7607 0.00222
NP_442658.1_1 Reverse -93 -103 14.8275 0.0188
NP_442198.1_3 Reverse -86 -105 2.26107 0.299
NP_440141.1_4 Forward -50 -31 -11.9969 0.298
NP_442782.1_2 Reverse -162 -176 0.589577 0.288
NP_440656.1_2 Reverse -142 -161 3.6377 0.221
NP_440607.1_3 Forward -77 -58 14.6499 0.221
NP_441487.1_9 Forward -105 -86 4.03102 0.153
NP_442937.1_5 Reverse -169 -188 7.07928 0.263
NP_442321.1_4 Reverse -329 -348 -6.98204 0.284
NP_441958.1_5 Reverse -94 -104 20.5312 0.000966
NP_441958.1_5 Forward -105 -95 12.2714 0.00183
NP_441127.1_1 Forward -281 -267 10.6193 0.244
NP_441127.1_1 Forward -185 -171 8.25939 0.3
NP_440318.1_1 Reverse -150 -169 2.3594 0.271
NP_442836.1_5 Forward -110 -91 1.17943 0.287
NP_440203.1_5 Forward -180 -170 9.22267 0.268
NP_439905.1_1 Reverse -96 -109 9.95071 0.216
NP_440984.1_7 Reverse -90 -104 18.1908 0.0166
NP_442376.1_2 Reverse -78 -97 -11.1119 0.286
NP_442911.1_2 Forward -114 -95 13.2741 0.0118
NP_441580.1_6 Forward -389 -370 -7.17871 0.236
NP_440153.1_5 Reverse -96 -110 4.22782 0.199
NP_440153.1_8 Reverse -278 -291 -3.32397 0.295
NP_442571.1_10 Reverse -232 -251 19.469 0.289
NP_443055.1_3 Reverse -35 -54 11.4091 0.259
NP_440934.1_1 Reverse -183 -202 10.0292 0.202
NP_440827.1_3 Reverse -157 -176 15.7324 0.167
NP_442002.1_9 Reverse -94 -101 14.1004 0.074
NP_442002.1_9 Forward -240 -233 11.3472 0.185
NP_442002.1_9 Forward -105 -98 10.7572 0.185
NP_440809.1_9 Forward -113 -95 -7.45401 0.225
NP_442598.1_2 Reverse -111 -120 16.5193 0.252
NP_441938.1_1 Reverse -93 -112 0.884433 0.298
NP_441294.1_7 Forward -108 -94 13.2821 0.0711
NP_441646.1_1 Reverse -37 -56 -0.295539 0.26
NP_441646.1_7 Forward -255 -241 13.7659 0.27
NP_442438.1_10 Forward -109 -95 11.406 0.0463
NP_441000.1_6 Reverse -94 -108 5.1128 0.0933
NP_441000.1_6 Forward -105 -91 -4.91696 0.254
NP_442771.1_1 Reverse -93 -111 -5.88071 0.166
NP_440147.1_4 Reverse -93 -106 21.3571 0.00131
NP_440147.1_4 Forward -106 -93 3.75586 0.181
NP_441550.1_8 Reverse -93 -103 17.6791 0.00754
NP_441550.1_8 Forward -106 -96 10.501 0.066
NP_441916.1_7 Reverse -95 -105 18.4663 0.00144
NP_441916.1_7 Forward -104 -94 16.893 0.00407
NP_441916.1_7 Forward -69 -59 3.32329 0.22
NP_441041.1_4 Forward -53 -34 3.53937 0.0646
NP_441041.1_4 Reverse -162 -181 -8.55534 0.204
NP_441041.1_4 Forward -177 -158 -9.24366 0.214
NP_441041.1_4 Reverse -168 -187 -11.8003 0.252
NP_441041.1_4 Reverse -156 -175 -12.9802 0.278
NP_441041.1_7 Reverse -92 -104 21.314 0.00104
NP_441041.1_7 Forward -107 -95 10.2357 0.1
NP_440569.1_10 Reverse -97 -116 2.53011 0.293
NP_441725.1_5 Forward -103 -93 11.7798 0.0247
NP_441725.1_5 Reverse -96 -106 9.02648 0.0553
NP_441725.1_5 Forward -252 -242 0.275027 0.192
NP_439966.1_7 Forward -106 -96 17.4824 0.00636
NP_439966.1_9 Forward -106 -97 10.7178 0.0863
NP_440202.1_8 Forward -387 -368 9.61179 0.297
NP_442941.1_3 Forward -103 -93 2.53664 0.14
NP_442941.1_3 Reverse -96 -106 2.53664 0.14
NP_440289.1_2 Forward -107 -94 13.0973 0.0132
NP_440289.1_2 Reverse -92 -105 7.19745 0.0579
NP_442281.1_1 Reverse -90 -104 20.3534 0.00192
NP_442256.1_2 Forward -106 -88 1.10079 0.112
NP_440437.1_1 Reverse -89 -108 -0.197208 0.176
NP_440437.1_1 Reverse -184 -203 -2.65548 0.22
NP_440437.1_5 Reverse -239 -258 14.5516 0.246
NP_442012.1_1 Reverse -89 -108 11.1109 0.0769
NP_442012.1_1 Forward -110 -91 -0.787193 0.267
NP_441556.1_10 Forward -109 -95 14.31 0.178
NP_442982.1_5 Reverse -233 -252 0.786102 0.233
NP_443030.1_4 Forward -246 -227 -7.37537 0.294
NP_441644.1_6 Forward -104 -94 15.7125 0.0048
NP_441644.1_6 Reverse -95 -105 10.1076 0.0628
NP_442215.1_2 Forward -106 -90 22.8713 0.00266
NP_442215.1_5 Forward -388 -369 20.8456 0.0465
NP_442177.1_5 Reverse -171 -185 9.34103 0.24
NP_442029.1_6 Forward -52 -33 3.34271 0.282
NP_442247.1_8 Reverse -93 -107 9.04604 0.258
NP_440253.1_2 Reverse -95 -113 8.86894 0.0526
NP_440929.1_8 Forward -104 -95 19.2726 0.000701
NP_440929.1_8 Reverse -95 -104 19.2726 0.000701
NP_440929.1_8 Forward -177 -168 2.94966 0.246
NP_442933.1_10 Forward -104 -95 17.601 0.00325
NP_442933.1_10 Reverse -95 -104 17.601 0.00325
NP_441751.2_8 Forward -103 -89 -5.40861 0.206
NP_441751.2_8 Reverse -39 -53 -5.70361 0.231
NP_442926.1_3 Reverse -157 -176 4.52268 0.254
NP_442554.1_8 Reverse -96 -106 16.008 0.0065
NP_442554.1_8 Forward -103 -93 14.238 0.0144
NP_442554.1_8 Reverse -45 -55 7.15819 0.0975
NP_442554.1_8 Reverse -169 -179 3.02829 0.245
NP_442167.1_6 Reverse -343 -359 12.1525 0.229
NP_441762.1_7 Reverse -94 -106 20.9835 0.00342
NP_441762.1_7 Forward -105 -93 9.47875 0.0142
NP_442142.1_4 Reverse -92 -105 13.195 0.0381
NP_442142.1_4 Forward -197 -184 3.16532 0.265
NP_442292.1_1 Reverse -96 -105 9.63616 0.0183
NP_442292.1_1 Forward -103 -94 9.53783 0.0183
NP_442476.1_6 Reverse -96 -110 7.66941 0.112
NP_442476.1_6 Forward -378 -364 0.0979218 0.274
NP_443009.1_5 Reverse -94 -105 20.6093 0.001
NP_443009.1_5 Forward -105 -94 9.10461 0.0965
NP_443009.1_5 Forward -54 -43 5.07306 0.218
NP_443009.1_5 Reverse -242 -253 4.97473 0.222
NP_442301.1_2 Reverse -271 -290 9.63507 0.2
NP_441715.1_4 Reverse -96 -106 9.32148 0.097
NP_440357.1_3 Forward -106 -87 8.84924 0.203
NP_440183.1_9 Reverse -46 -65 -20.5517 0.287
NP_441198.1_8 Forward -55 -45 12.783 0.116
NP_441198.1_8 Reverse -93 -103 12.5877 0.12
NP_441468.1_1 Forward -103 -96 15.8704 0.0124
NP_441468.1_1 Reverse -96 -103 15.8704 0.0124
NP_441468.1_1 Reverse -169 -176 4.36568 0.237
NP_441020.2_6 Forward -106 -89 20.4917 0.00576
NP_441020.2_6 Forward -255 -238 10.2653 0.149
NP_441015.1_10 Forward -58 -39 -8.26035 0.272
NP_441673.1_1 Forward -104 -95 20.8459 0.000698
NP_441673.1_1 Reverse -95 -104 20.8459 0.000698
NP_441826.1_2 Forward -110 -96 2.65453 0.123
NP_441826.1_2 Forward -259 -245 -2.45868 0.271
NP_441826.1_2 Reverse -89 -103 -3.34366 0.284
NP_441637.1_9 Reverse -360 -378 4.24738 0.245
NP_442490.1_9 Forward -251 -232 -3.14714 0.227
NP_442868.1_6 Reverse -93 -103 9.12481 0.0539
NP_442868.1_6 Forward -106 -96 8.53483 0.0555
NP_442868.1_6 Reverse -242 -252 3.61828 0.195
NP_441056.1_1 Forward -177 -158 4.71934 0.117
NP_442808.1_1 Forward -105 -95 18.4657 0.00201
NP_442808.1_1 Reverse -94 -104 8.73102 0.0481
NP_441101.1_10 Reverse -24 -43 -0.885524 0.192
NP_440031.1_10 Forward -298 -279 2.3594 0.26
NP_442718.1_2 Forward -347 -328 2.26107 0.203
NP_442542.1_2 Forward -106 -93 11.7207 0.114
NP_442542.1_2 Reverse -58 -71 7.29578 0.187
NP_442050.1_1 Forward -391 -372 8.84924 0.25
NP_442050.1_5 Forward -106 -96 8.23937 0.234
NP_442050.1_5 Reverse -93 -103 6.96107 0.27
NP_440558.1_2 Forward -186 -167 11.9958 0.0808
NP_440558.1_2 Forward -197 -178 -5.80207 0.264
NP_440558.1_2 Reverse -170 -189 -7.67036 0.298
NP_442789.1_4 Forward -182 -163 -6.68705 0.287
NP_441518.1_3 Forward -63 -44 -15.8318 0.299
NP_441878.1_6 Reverse -94 -104 20.2362 0.0046
NP_441878.1_6 Forward -105 -95 10.4031 0.0176
NP_441878.1_6 Forward -348 -338 -7.49312 0.231
NP_441036.1_8 Forward -105 -95 17.7779 0.000554
NP_441036.1_8 Reverse -94 -104 8.4365 0.174
NP_441036.1_8 Forward -115 -105 7.84651 0.183
NP_441557.1_5 Forward -104 -95 19.9609 0.000699
NP_441557.1_5 Reverse -95 -104 19.9609 0.000699
NP_441445.1_1 Reverse -86 -105 8.45592 0.121
NP_441445.1_1 Forward -113 -94 0.687771 0.27
NP_442066.2_4 Forward -171 -152 -6.78538 0.254
NP_442066.2_9 Reverse -155 -168 8.47575 0.185
NP_441433.1_8 Forward -171 -152 0.687771 0.238
NP_441433.1_8 Forward -170 -151 -3.73712 0.283
NP_440084.1_8 Reverse -13 -27 16.8182 0.161
NP_441308.1_3 Forward -295 -276 9.14423 0.261
NP_441308.1_8 Forward -106 -96 9.22315 0.226
NP_440101.1_3 Forward -109 -90 1.0811 0.284
NP_442830.1_5 Reverse -32 -46 6.29216 0.216
NP_442192.1_7 Forward -227 -209 19.6853 0.0722
NP_442183.1_1 Reverse -95 -109 9.34103 0.0986
NP_442347.1_2 Reverse -96 -105 11.1111 0.056
NP_442347.1_2 Forward -103 -94 3.34298 0.284
NP_442645.1_2 Reverse -87 -106 -21.83 0.29
NP_441037.1_4 Reverse -93 -103 17.3558 0.0127
NP_441037.1_4 Forward -106 -96 16.2838 0.0168
NP_441633.1_3 Reverse -93 -106 11.1307 0.0286
NP_441633.1_3 Forward -106 -93 5.72248 0.0481
NP_440136.1_2 Forward -103 -96 15.9687 0.0123
NP_440136.1_2 Reverse -96 -103 15.9687 0.0123
NP_442998.1_10 Forward -102 -95 15.5754 0.0102
NP_442998.1_10 Reverse -97 -104 15.5754 0.0102
NP_440899.1_5 Reverse -234 -253 6.29264 0.242
NP_440299.1_1 Forward -108 -95 17.3249 0.0065
NP_441799.1_1 Reverse -91 -105 19.3701 0.00667
NP_441007.1_10 Reverse -90 -103 10.4424 0.0656
NP_442201.1_10 Reverse -84 -103 -14.8485 0.291
NP_440256.1_1 Reverse -92 -111 -9.34199 0.278
NP_442007.1_8 Forward -105 -87 8.76983 0.297
NP_441559.1_8 Forward -109 -95 11.996 0.0574
NP_441559.1_8 Forward -257 -243 -5.21195 0.254
NP_441559.1_8 Reverse -39 -53 -5.40861 0.261
NP_440915.1_6 Forward -108 -94 15.2409 0.0183
NP_440915.1_6 Forward -256 -242 9.2427 0.0445
NP_440915.1_6 Reverse -91 -105 -3.34366 0.293
NP_442158.1_4 Reverse -359 -369 13.0581 0.239
NP_441296.1_9 Reverse -34 -47 9.5568 0.277
NP_440717.1_1 Forward -103 -84 12.5858 0.199
NP_442866.1_1 Reverse -157 -176 -6.88371 0.261
NP_441464.1_8 Forward -104 -90 6.88276 0.222
NP_441464.1_10 Reverse -359 -373 8.84938 0.267
NP_440026.1_4 Forward -256 -237 8.16093 0.28
NP_440306.1_5 Forward -380 -361 -1.86883 0.298
NP_440695.1_5 Forward -104 -85 -0.983855 0.284
NP_441199.1_6 Forward -108 -89 3.04771 0.189
NP_441494.1_6 Reverse -157 -170 15.9489 0.125
NP_442993.1_1 Reverse -95 -111 -7.51295 0.146
NP_442386.1_9 Forward -105 -96 15.7322 0.0144
NP_442386.1_9 Reverse -43 -52 8.16077 0.209
NP_442386.1_9 Reverse -94 -103 6.39082 0.219
NP_440570.1_5 Reverse -158 -177 -4.03212 0.299
NP_441750.1_4 Reverse -164 -183 3.24438 0.233
NP_441340.1_5 Forward -103 -96 15.6737 0.0124
NP_441340.1_5 Reverse -96 -103 15.6737 0.0124
NP_441340.1_5 Forward -176 -169 4.07068 0.239
NP_441340.1_9 Forward -119 -109 11.7259 0.236
NP_441947.1_4 Reverse -84 -103 14.2574 0.188
NP_442484.1_2 Reverse -84 -103 0.294447 0.25
NP_440251.1_4 Reverse -361 -378 16.1651 0.137
NP_440586.1_8 Forward -103 -96 13.2151 0.026
NP_440586.1_8 Reverse -96 -103 13.2151 0.026
NP_440586.1_8 Forward -176 -169 7.70858 0.227
NP_442251.1_6 Forward -103 -96 15.2804 0.0124
NP_442251.1_6 Reverse -96 -103 15.2804 0.0124
NP_440192.1_5 Forward -54 -35 5.60432 0.234
NP_440192.1_5 Reverse -156 -175 4.32602 0.254
NP_441262.1_3 Reverse -95 -102 14.7888 0.0223
NP_441262.1_3 Forward -104 -97 14.7888 0.0223
NP_443051.1_1 Reverse -94 -103 18.0926 0.00402
NP_443051.1_1 Forward -105 -96 10.4228 0.00754
NP_439937.1_9 Reverse -94 -111 20.2942 0.00778
NP_439937.1_9 Forward -309 -292 -11.6632 0.261
NP_439937.1_9 Forward -105 -88 -16.383 0.287
NP_441657.1_5 Forward -193 -174 2.16274 0.161
NP_440439.1_1 Forward -107 -94 21.0621 0.0105
NP_439943.1_8 Reverse -14 -33 15.8307 0.188
NP_440372.1_2 Forward -103 -96 16.3621 0.0124
NP_440372.1_2 Reverse -96 -103 16.3621 0.0124
NP_440991.1_8 Forward -245 -226 17.4539 0.268
NP_440819.1_5 Forward -160 -152 17.424 0.185
NP_441803.1_2 Reverse -90 -109 5.211 0.17
NP_441803.1_2 Reverse -238 -257 5.01433 0.171
NP_439977.1_5 Forward -183 -164 -0.197208 0.22
NP_439977.1_5 Forward -110 -91 -1.57384 0.256
NP_441572.1_3 Reverse -158 -177 8.65258 0.261
NP_441572.1_7 Forward -389 -370 -6.39206 0.29
NP_442384.1_10 Reverse -95 -108 11.229 0.0372
NP_442384.1_10 Forward -104 -91 8.77074 0.0608
NP_442114.1_4 Reverse -95 -106 12.1534 0.107
NP_441604.1_4 Reverse -52 -71 2.75272 0.211
NP_441018.1_7 Reverse -170 -189 6.58763 0.285
NP_442262.1_10 Forward -103 -96 14.1988 0.0123
NP_442262.1_10 Reverse -96 -103 14.1988 0.0123
NP_440344.1_10 Reverse -88 -105 5.9387 0.0194
NP_440344.1_10 Forward -111 -94 2.00546 0.0291
NP_440282.1_10 Reverse -85 -104 -8.55534 0.263
NP_440531.1_6 Reverse -87 -106 -1.96717 0.241
NP_441965.1_10 Forward -107 -91 5.76173 0.197
NP_442529.1_4 Reverse -86 -105 8.35759 0.277
NP_440297.1_9 Forward -103 -93 9.61647 0.0917
NP_440297.1_9 Forward -176 -166 6.76487 0.17
NP_440297.1_9 Forward -52 -42 -0.118297 0.282
NP_440297.1_9 Reverse -96 -106 -0.216628 0.282
NP_440297.1_9 Reverse -169 -179 -0.314959 0.282
NP_441896.1_3 Forward -113 -94 23.7955 0.015
NP_440894.1_10 Forward -109 -90 9.14423 0.163
NP_440894.1_10 Reverse -90 -109 4.71934 0.244
NP_440999.1_9 Forward -108 -94 19.4691 0.0131
NP_440999.1_9 Reverse -346 -360 -3.147 0.287
NP_440888.1_2 Reverse -95 -109 18.9768 0.00173
NP_440888.1_2 Reverse -369 -383 9.14375 0.137
NP_440888.1_2 Reverse -243 -257 6.88214 0.217
NP_442147.1_7 Reverse -86 -105 7.86593 0.288
NP_440491.1_1 Forward -107 -88 12.8619 0.139
NP_440052.1_5 Reverse -84 -103 -1.37718 0.195
NP_439969.1_3 Forward -109 -90 9.73422 0.116
NP_442277.1_4 Forward -113 -94 7.37347 0.146
NP_442033.1_10 Reverse -93 -112 2.75272 0.0882
NP_440575.1_8 Forward -156 -137 -1.57384 0.224
NP_441543.1_2 Reverse -96 -105 18.486 0.00236
NP_441543.1_2 Forward -103 -94 9.34117 0.0818
NP_440683.1_9 Forward -95 -81 17.8958 0.132
NP_441469.1_8 Forward -105 -96 16.126 0.00797
NP_441469.1_8 Reverse -43 -52 13.8644 0.0682
NP_441469.1_8 Reverse -94 -103 13.3727 0.073
NP_441469.1_8 Reverse -167 -176 6.09625 0.236
NP_443064.1_6 Forward -104 -94 13.8273 0.0796
NP_442337.1_8 Reverse -357 -376 0.884433 0.244
NP_442578.1_7 Forward -103 -96 14.5921 0.026
NP_442578.1_7 Reverse -96 -103 14.5921 0.026
NP_441462.1_2 Forward -104 -94 20.1379 0.000967
NP_441462.1_2 Reverse -95 -105 11.5831 0.00406
NP_441621.1_7 Reverse -93 -107 4.42448 0.0934
NP_441621.1_7 Forward -196 -182 -3.34366 0.188
NP_441621.1_7 Forward -106 -92 -3.34366 0.188
NP_441621.1_7 Reverse -160 -174 -6.09693 0.275
NP_443062.1_1 Forward -104 -86 8.2534 0.157
NP_443062.1_1 Forward -177 -159 5.6207 0.224
NP_443062.1_1 Forward -53 -35 3.76806 0.285
NP_443062.1_6 Reverse -87 -106 5.11266 0.209
NP_442204.1_1 Forward -387 -376 7.23683 0.137
NP_442204.1_1 Forward -108 -97 0.648657 0.281
NP_442204.1_2 Forward -102 -83 5.99764 0.292
NP_442204.1_5 Forward -114 -95 1.0811 0.246
NP_442204.1_5 Reverse -85 -104 0.884433 0.251
NP_442487.1_5 Forward -115 -96 5.89851 0.211
NP_440516.1_6 Reverse -215 -229 6.98048 0.285
NP_440516.1_8 Forward -104 -95 16.9127 0.00442
NP_440516.1_8 Reverse -95 -104 16.9127 0.00442
NP_441033.1_2 Reverse -85 -104 -9.34199 0.293
NP_442428.1_5 Forward -103 -96 15.8704 0.0124
NP_442428.1_5 Reverse -96 -103 15.8704 0.0124
NP_442428.1_5 Reverse -169 -176 4.66067 0.244
NP_441443.1_5 Forward -66 -47 11.0125 0.269
NP_440673.1_3 Forward -102 -95 12.4288 0.0426
NP_440673.1_3 Reverse -97 -104 12.4288 0.0426
NP_441052.1_2 Reverse -95 -105 10.5014 0.0285
NP_441052.1_2 Forward -104 -94 10.4031 0.0285
NP_442219.1_9 Reverse -96 -105 8.35786 0.0681
NP_442219.1_9 Forward -103 -94 8.25953 0.0681
NP_440436.1_4 Reverse -96 -105 18.1905 0.00233
NP_440436.1_4 Forward -103 -94 15.9289 0.00508
NP_440436.1_4 Reverse -50 -59 5.11253 0.222
NP_441884.1_9 Reverse -92 -111 -13.7669 0.138
NP_441884.1_9 Forward -107 -88 -14.3569 0.138
NP_440689.1_1 Reverse -28 -46 6.41066 0.297
NP_441719.1_4 Forward -103 -96 16.3621 0.0124
NP_441719.1_4 Reverse -96 -103 16.3621 0.0124
NP_441733.1_10 Reverse -92 -105 9.55739 0.113
NP_441733.1_10 Forward -107 -94 9.16406 0.124
NP_441004.1_1 Reverse -89 -108 -12.8819 0.251
NP_441004.1_1 Reverse -238 -257 -14.9469 0.271
NP_441004.1_1 Forward -353 -334 -15.8318 0.279
NP_441004.1_2 Forward -358 -339 0.687771 0.23
NP_441004.1_2 Reverse -288 -307 -4.13045 0.288
NP_441004.1_4 Reverse -296 -306 9.32148 0.259
NP_441004.1_4 Forward -350 -340 8.82982 0.263
NP_441004.1_5 Reverse -295 -309 8.45605 0.274
NP_442813.1_5 Reverse -364 -383 4.52268 0.254
NP_442366.1_3 Forward -105 -87 -1.94747 0.219
NP_442366.1_5 Reverse -92 -102 14.8275 0.0375
NP_442695.1_3 Forward -168 -154 16.7152 0.213
NP_440296.1_10 Forward -107 -88 -14.3569 0.269
NP_441115.1_4 Reverse -94 -112 10.7364 0.168
NP_441115.1_4 Forward -105 -87 9.26148 0.221
NP_440328.1_4 Reverse -89 -108 1.86774 0.213
NP_443054.1_2 Forward -106 -92 9.34103 0.0995
NP_443054.1_2 Reverse -93 -107 4.81781 0.24
NP_441851.1_10 Reverse -94 -104 17.4829 0.0027
NP_441851.1_10 Forward -105 -95 16.008 0.00552
NP_442208.1_5 Forward -49 -30 -6.88371 0.27
NP_442011.1_1 Forward -105 -86 -1.57384 0.268
NP_441668.1_4 Forward -357 -338 -0.787193 0.262
NP_441668.1_4 Reverse -85 -104 -2.85214 0.297
NP_442515.1_1 Reverse -94 -108 4.62115 0.107
NP_442515.1_1 Forward -348 -334 3.04785 0.125
NP_442515.1_1 Forward -105 -91 -1.8687 0.266
NP_442515.1_1 Forward -380 -366 -3.44199 0.29
NP_440593.1_3 Reverse -90 -109 -5.40875 0.259
NP_441982.1_6 Forward -161 -152 12.4854 0.275
NP_440463.1_4 Reverse -287 -306 19.5664 0.0801
NP_440463.1_8 Reverse -271 -290 8.46802 0.264
NP_440389.1_5 Forward -111 -92 16.85 0.186
NP_440432.1_9 Forward -103 -88 -0.413427 0.164
NP_440432.1_9 Reverse -45 -60 -3.36336 0.179
NP_440474.1_8 Reverse -96 -110 5.70218 0.244
NP_442450.1_5 Reverse -93 -103 17.3846 0.0267
NP_440588.1_2 Forward -113 -94 -2.36049 0.164
NP_442006.1_2 Forward -62 -45 -15.3008 0.221
NP_442243.1_1 Forward -110 -92 4.54162 0.196
NP_440078.1_10 Forward -53 -34 9.14423 0.196
NP_441078.1_4 Forward -104 -95 19.6659 0.0007
NP_441078.1_4 Reverse -95 -104 19.6659 0.0007
NP_442729.1_8 Forward -108 -95 8.47575 0.125
NP_442443.1_1 Forward -355 -336 -3.44213 0.267
NP_440526.1_3 Forward -103 -92 10.9729 0.0646
NP_440526.1_3 Reverse -96 -107 2.41814 0.267
NP_441432.1_8 Reverse -94 -103 8.35786 0.0755
NP_441432.1_8 Forward -105 -96 8.25953 0.0755
NP_441432.1_8 Reverse -173 -182 5.40793 0.158
NP_442320.1_8 Forward -110 -96 8.55439 0.0184
NP_442344.1_7 Forward -103 -84 0.786102 0.0908
NP_441732.1_2 Reverse -91 -107 -6.43131 0.0495
NP_441732.1_2 Forward -108 -92 -16.0677 0.164
NP_442343.1_10 Forward -379 -360 8.75091 0.289
NP_440497.1_6 Reverse -90 -109 -5.70374 0.264
NP_440760.1_1 Forward -104 -85 -19.7651 0.219
NP_442797.1_1 Reverse -271 -290 -1.57384 0.236
NP_442797.1_7 Reverse -94 -112 4.6407 0.221
NP_441131.1_5 Forward -48 -29 6.09597 0.251
NP_441057.1_4 Reverse -146 -164 -1.25915 0.272
NP_442489.1_7 Forward -104 -95 20.1576 0.000695
NP_442489.1_7 Reverse -95 -104 20.1576 0.000695
NP_440757.1_7 Forward -176 -158 -0.7675 0.269
NP_440559.1_1 Forward -103 -94 17.306 0.00658
NP_440559.1_1 Reverse -96 -105 8.75118 0.0586
NP_441659.2_8 Forward -104 -94 19.3512 0.000966
NP_441659.2_8 Reverse -95 -105 11.9764 0.0147
NP_442913.1_10 Reverse -86 -105 13.2741 0.0321
NP_442913.1_10 Forward -261 -242 -2.85214 0.192
NP_441800.1_7 Reverse -264 -282 -3.81576 0.281
NP_442776.1_6 Forward -106 -87 13.1758 0.138
NP_440779.1_5 Forward -104 -87 -5.56602 0.149
NP_442346.1_1 Reverse -174 -193 21.0423 0.0856
NP_442346.1_5 Reverse -94 -104 17.9746 0.00128
NP_442346.1_5 Forward -105 -95 9.02648 0.118
NP_442346.1_5 Forward -348 -338 6.66654 0.195
NP_440352.1_5 Forward -219 -200 10.709 0.27
NP_440545.1_3 Forward -57 -40 7.61033 0.0489
NP_440545.1_3 Reverse -91 -108 7.512 0.0496
NP_440545.1_3 Reverse -158 -175 1.90713 0.11
NP_440545.1_3 Forward -108 -91 0.727158 0.133
NP_440831.1_3 Reverse -86 -105 11.5322 0.163
NP_441629.1_3 Reverse -31 -50 6.68515 0.182
NP_440486.1_6 Forward -190 -171 6.39097 0.283
NP_440010.1_10 Forward -95 -76 1.37609 0.3
NP_441943.1_8 Reverse -234 -253 -12.4886 0.261
NP_442551.1_4 Reverse -336 -351 -3.36336 0.287
NP_442603.1_7 Reverse -95 -109 11.897 0.109
NP_441888.1_7 Forward -109 -95 4.12949 0.225
NP_440449.1_6 Forward -112 -94 8.54762 0.2
NP_441948.1_4 Reverse -88 -106 15.8504 0.0224
NP_441833.1_4 Forward -103 -96 15.9687 0.0124
NP_441833.1_4 Reverse -96 -103 15.9687 0.0124
NP_442162.1_9 Forward -103 -96 16.2637 0.0124
NP_442162.1_9 Reverse -96 -103 16.2637 0.0124
NP_440671.1_4 Reverse -162 -176 10.4227 0.158
NP_440671.1_4 Forward -259 -245 7.9644 0.205
NP_442404.1_9 Reverse -98 -112 14.4536 0.263
NP_442140.1_3 Reverse -96 -106 17.4829 0.0159
NP_442140.1_3 Forward -103 -93 13.5497 0.0542
NP_440875.1_9 Reverse -97 -107 15.2829 0.0295
NP_440875.1_9 Reverse -46 -56 6.81464 0.297
NP_441813.1_5 Forward -106 -96 10.0098 0.0208
NP_441813.1_5 Reverse -93 -103 8.82982 0.0367
NP_440590.1_4 Reverse -96 -109 24.012 0.00216
NP_440590.1_4 Forward -113 -100 1.9859 0.105
NP_440590.1_4 Forward -103 -90 1.10092 0.133
NP_440567.1_1 Forward -103 -89 12.7826 0.0216
NP_440567.1_1 Reverse -96 -110 12.4876 0.023
NP_440719.1_9 Forward -199 -180 16.7149 0.284
NP_442497.1_10 Forward -103 -94 19.8626 0.00532
NP_442497.1_10 Reverse -96 -105 10.4228 0.0087
NP_440821.1_4 Forward -106 -96 18.7612 0.00422
NP_440821.1_4 Reverse -93 -103 10.9931 0.0146
NP_440821.1_4 Reverse -166 -176 -0.806614 0.296
NP_441239.1_9 Forward -106 -94 19.6068 0.00769
NP_441239.1_9 Reverse -93 -105 13.3137 0.037
NP_441239.1_9 Forward -55 -43 9.57708 0.102
NP_441239.1_9 Reverse -183 -195 4.46387 0.253
NP_441239.1_9 Reverse -42 -54 3.57889 0.283
NP_441727.1_3 Reverse -53 -72 5.89931 0.248
NP_441892.1_1 Forward -62 -45 7.11867 0.0915
NP_441892.1_1 Reverse -86 -103 2.10379 0.144
NP_440665.1_2 Reverse -235 -254 1.37609 0.188
NP_440796.1_3 Reverse -237 -255 14.9646 0.187
NP_442643.1_1 Forward -53 -34 -10.6203 0.231
NP_440949.1_7 Forward -346 -327 8.55343 0.28
NP_442052.1_3 Reverse -167 -186 15.8307 0.128
NP_442052.1_7 Forward -198 -184 12.9793 0.249
NP_442052.1_8 Reverse -93 -103 12.7631 0.253
NP_442809.1_3 Forward -69 -50 19.1731 0.156
NP_440546.1_4 Forward -104 -94 12.8578 0.0572
NP_440546.1_4 Reverse -95 -105 11.8882 0.0679
NP_441230.1_5 Reverse -157 -176 2.55606 0.212
NP_440462.1_6 Forward -106 -96 17.9746 0.00578
NP_440462.1_6 Reverse -93 -103 1.455 0.294
NP_440868.1_4 Forward -108 -96 12.527 0.0235
NP_440868.1_4 Reverse -91 -103 1.51394 0.181
NP_441582.1_5 Reverse -93 -112 8.25844 0.164
NP_442402.1_2 Reverse -148 -162 16.9119 0.263
NP_442402.1_6 Reverse -292 -301 13.1761 0.289
NP_442882.1_7 Reverse -88 -102 16.9119 0.24
NP_442039.1_4 Forward -103 -96 15.1821 0.0124
NP_442039.1_4 Reverse -96 -103 15.1821 0.0124
NP_442679.1_1 Forward -241 -222 -5.80207 0.298
NP_440825.1_7 Forward -103 -93 11.8361 0.2
NP_442837.1_3 Forward -103 -96 15.7721 0.0124
NP_442837.1_3 Reverse -96 -103 15.7721 0.0124
NP_440160.1_2 Reverse -243 -262 -4.13045 0.26
NP_442053.1_1 Forward -104 -95 18.3876 0.0007
NP_442053.1_1 Reverse -95 -104 18.3876 0.0007
NP_440505.1_3 Forward -106 -96 14.1397 0.0235
NP_442360.1_5 Forward -246 -236 13.1564 0.289
NP_442360.1_5 Reverse -237 -247 13.1564 0.289
NP_441959.1_9 Forward -191 -172 18.4857 0.0957
NP_441203.1_1 Reverse -231 -250 -5.50708 0.0988
NP_441203.1_1 Forward -46 -27 -14.5535 0.193
NP_442532.1_7 Reverse -95 -109 7.86607 0.171
NP_442532.1_7 Forward -290 -276 1.86788 0.261
NP_440548.1_3 Forward -284 -265 14.7491 0.227
NP_440914.1_1 Reverse -95 -105 8.6151 0.186
NP_440914.1_1 Forward -104 -94 8.51751 0.186
NP_441011.1_8 Reverse -96 -105 16.9127 0.00602
NP_441011.1_8 Forward -103 -94 14.356 0.0249
NP_442533.1_1 Forward -51 -32 -10.3253 0.231
NP_442533.1_6 Forward -104 -95 17.2076 0.00137
NP_442533.1_6 Reverse -95 -104 17.2076 0.00137
NP_442533.1_6 Reverse -44 -53 5.99792 0.121
NP_441089.1_5 Reverse -160 -179 17.699 0.251
NP_442322.1_4 Reverse -41 -58 -9.59824 0.295
NP_442229.1_1 Forward -106 -92 19.7634 0.0734
NP_439944.1_8 Forward -63 -44 13.1758 0.238
NP_439944.1_9 Reverse -169 -179 10.5014 0.0887
NP_439944.1_9 Reverse -96 -106 10.4031 0.0887
NP_439944.1_9 Forward -103 -93 8.82982 0.101
NP_441028.1_6 Reverse -152 -162 5.19112 0.265
NP_440116.1_8 Forward -103 -84 7.96426 0.0405
NP_440115.1_6 Forward -107 -97 9.61647 0.115
NP_440007.1_9 Reverse -164 -178 1.86788 0.282
NP_441602.1_3 Forward -109 -90 -3.83545 0.253
NP_441972.1_5 Forward -182 -163 5.60432 0.0917
NP_441972.1_5 Forward -264 -245 -4.32711 0.21
NP_441972.1_5 Forward -68 -49 -5.99873 0.227
NP_441972.1_5 Forward -103 -84 -7.76869 0.252
NP_441106.1_1 Forward -105 -96 18.191 0.0028
NP_441106.1_1 Reverse -94 -103 9.73449 0.0311
NP_440480.1_1 Forward -60 -42 21.1603 0.0644
NP_439903.1_6 Reverse -159 -178 2.16195 0.231
NP_441286.1_1 Forward -105 -93 5.93884 0.0258
NP_441286.1_1 Reverse -94 -106 5.34885 0.0259
NP_441286.1_1 Reverse -173 -185 -5.86088 0.229
NP_442674.1_3 Reverse -87 -106 8.16011 0.205
NP_440670.1_8 Forward -104 -95 18.3876 0.000699
NP_440670.1_8 Reverse -95 -104 18.3876 0.000699
NP_440886.1_7 Forward -105 -95 17.7774 0.0011
NP_440886.1_7 Reverse -94 -104 8.04271 0.0805
NP_440886.1_7 Reverse -346 -356 3.91283 0.26
NP_442614.1_2 Forward -104 -90 15.1426 0.0814
NP_442072.1_9 Reverse -94 -112 -3.6191 0.0368
NP_441753.1_10 Forward -113 -94 4.81767 0.193
NP_440907.2_8 Reverse -96 -106 17.4824 0.00685
NP_440907.2_8 Forward -103 -93 16.2041 0.0161
NP_442264.1_2 Forward -114 -97 5.9387 0.267
NP_441021.1_1 Reverse -157 -176 -11.5053 0.267
NP_441021.1_8 Reverse -90 -108 7.78729 0.181
NP_441626.1_2 Forward -103 -96 15.7721 0.0124
NP_441626.1_2 Reverse -96 -103 15.7721 0.0124
NP_441460.1_2 Reverse -203 -216 17.0299 0.125
NP_442615.1_1 Reverse -86 -104 15.9488 0.00913
NP_442615.1_1 Forward -113 -95 -4.99573 0.201
NP_442467.1_5 Reverse -209 -228 17.2327 0.233
NP_441962.1_4 Forward -170 -151 -0.39387 0.117
NP_441962.1_4 Forward -286 -267 -12.1936 0.253
NP_441962.1_4 Forward -352 -333 -13.2752 0.271
NP_440387.1_1 Reverse -95 -111 8.515 0.0282
NP_441431.1_2 Forward -107 -93 21.0417 0.00685
NP_441431.1_2 Reverse -92 -106 9.93039 0.172
NP_441488.1_7 Reverse -89 -108 1.57275 0.289
NP_441993.1_1 Reverse -174 -193 6.13735 0.186
NP_441993.1_1 Reverse -168 -187 4.18821 0.223
NP_441993.1_1 Reverse -156 -175 3.31109 0.237
NP_440814.1_4 Reverse -86 -105 -11.8986 0.228
NP_440114.1_10 Forward -104 -90 16.8142 0.0145
NP_442323.1_7 Reverse -157 -176 0.785326 0.299
NP_440293.1_3 Reverse -166 -185 0.196116 0.224
NP_440766.1_4 Forward -108 -94 15.1426 0.0269
NP_441237.1_9 Forward -103 -93 17.188 0.00445
NP_439910.1_2 Forward -112 -95 -12.2525 0.0788
NP_442867.1_8 Reverse -46 -65 13.8641 0.171
NP_440457.1_1 Forward -108 -96 7.21714 0.105
NP_440457.1_1 Reverse -91 -103 1.02229 0.248
NP_440798.1_6 Forward -103 -90 5.23083 0.14
NP_440798.1_6 Reverse -96 -109 3.65753 0.15
NP_440798.1_6 Reverse -89 -102 0.314277 0.274
NP_440801.1_8 Reverse -249 -268 -0.787193 0.273
NP_441332.1_6 Reverse -346 -356 13.583 0.184
NP_440473.1_9 Forward -64 -45 -7.17871 0.236
NP_442509.1_9 Forward -104 -94 17.3841 0.00128
NP_442509.1_9 Reverse -95 -105 16.2041 0.00739
NP_440554.1_4 Reverse -96 -106 13.943 0.0218
NP_440554.1_4 Forward -176 -166 3.51995 0.227
NP_441885.1_5 Reverse -95 -105 11.4848 0.00668
NP_441885.1_5 Forward -104 -94 11.3864 0.00668
NP_441885.1_5 Reverse -60 -70 -0.904945 0.241
NP_442703.1_9 Forward -133 -115 8.37728 0.244
NP_442341.1_7 Reverse -94 -108 19.3708 0.00848
NP_442341.1_7 Forward -105 -91 13.0776 0.0383
NP_442341.1_7 Forward -315 -301 4.12949 0.2
NP_442341.1_9 Forward -106 -92 9.43874 0.152
NP_442341.1_9 Forward -39 -25 6.48882 0.225
NP_442341.1_9 Forward -191 -177 6.39049 0.228
NP_441756.1_5 Forward -108 -89 2.65439 0.206
NP_441756.1_5 Forward -256 -237 2.26107 0.212
NP_443000.1_3 Forward -290 -271 11.0377 0.256
NP_443000.1_7 Forward -106 -96 2.04498 0.226
NP_443000.1_7 Reverse -93 -103 2.04498 0.226
NP_443000.1_7 Forward -12 -2 1.65166 0.235
NP_440507.2_3 Forward -113 -94 9.43841 0.221
NP_440727.1_1 Forward -54 -35 3.6377 0.249
NP_441842.1_1 Reverse -97 -110 19.0949 0.0142
NP_441842.1_10 Reverse -88 -102 17.8958 0.0203
NP_441842.1_10 Forward -111 -97 8.84938 0.208
NP_440275.1_3 Forward -106 -96 17.9746 0.0082
NP_440275.1_3 Reverse -93 -103 9.91146 0.046
NP_442932.1_3 Forward -238 -219 12.9783 0.197
NP_440091.1_1 Forward -108 -96 10.1671 0.0498
NP_440679.1_10 Forward -297 -278 -14.2585 0.226
NP_443010.1_10 Forward -107 -90 9.14862 0.146
NP_441359.1_5 Reverse -281 -300 6.88262 0.186
NP_440149.1_8 Forward -183 -164 -3.24547 0.185
NP_440149.1_10 Forward -69 -50 -10.7186 0.285
NP_441105.1_3 Forward -115 -96 0.982764 0.118
NP_441105.1_3 Reverse -151 -170 -5.70374 0.223
NP_440216.1_1 Forward -104 -90 8.35772 0.0061
NP_440216.1_1 Reverse -95 -109 -1.18038 0.0301
NP_440172.1_1 Forward -104 -94 16.303 0.00854
NP_440172.1_1 Reverse -95 -105 8.73149 0.0586
NP_442015.1_10 Forward -108 -95 12.9006 0.0365
NP_442015.1_10 Reverse -91 -104 2.37923 0.193
NP_442015.1_10 Reverse -164 -177 -0.37404 0.264
NP_442015.1_10 Reverse -40 -53 -0.570702 0.272
NP_441226.1_7 Forward -103 -96 14.4934 0.0123
NP_441226.1_7 Reverse -96 -103 14.4934 0.0123
NP_441226.1_7 Forward -176 -169 11.2485 0.0971
NP_441111.1_7 Forward -103 -95 18.7023 0.00294
NP_441111.1_7 Reverse -96 -104 18.7023 0.00294
NP_441766.1_2 Forward -104 -95 17.5026 0.00297
NP_441766.1_2 Reverse -95 -104 17.5026 0.00297
NP_442252.1_5 Reverse -170 -189 9.0459 0.299
NP_440416.1_9 Reverse -88 -107 -7.27704 0.0988
NP_440416.1_9 Reverse -42 -61 -21.1417 0.291
NP_443052.1_8 Reverse -85 -104 -8.06369 0.168
NP_443052.1_8 Forward -114 -95 -10.227 0.206
NP_443052.1_9 Reverse -280 -299 2.75272 0.168
NP_442154.1_3 Forward -141 -122 16.6629 0.241
NP_440261.1_5 Forward -103 -90 8.77074 0.0244
NP_440261.1_5 Reverse -96 -109 4.93583 0.0478
NP_440261.1_5 Forward -170 -157 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTAGCTAAGCTCCCACAGGAGAGGGAAAGCCCCAACAAAATAAAGGTGACTGGGGTAATGACCCCAATACTGAACCAAGAAGCAACGTGGAGCACCATTACTCCACAGACGGTGAGGGTGGCAACGTAGGCAGTGTTAACTGACCAGCGGGGTTGCCCTAGGGCAATTAAAACGGCGCAAATGGTGGTCCAGAGTAAAATTGACGGTACCAGGGCGGCGCAAATGCCAACGCAGTGGCCTCGGGAAAAATCAGCTAACCAGGTAATCAAATTCATACTCTCAAAAAAAAGTTCGGCGGCGATCGCCCATAGGACCGTGCCGCCCATTATATAGCAACAGCCCAAGGAGGGCATGGCAGTGGACTGGGGGCACCCAGAACTGAAAATTTAAAACGTTCACG

CDS

ATGGTTTTTGCTATGGTTGACGAGAAGGGCAAGGAGCAATGGAGTCGCCATTCTTCGCCTCAACTTTCGGCAAATTTTCAACTTTGTTCAATCCCGCAACCTTCCATGGATACAAACGACTGGCTTAAACAACTCTTGATGATCGGTGTTGGCACCACCACCCTCGTGGCGGAAAAACTCAGCGATGTGAGTGATCAATGGGTGAAGGAAGGCAAAATTAACGCCGACCAGGCCACCGCTTTTGTGGATGATTTGATGAACCAAATCAAAAACGAGCAGGGACAAATTGAAGCAAATCTGGAAAGACAACTGCGCAATATGCTCCAGGATTTGGGCCTACCCCGTCAGTCGGAAATGGACGAGTTGCGGGGACGTATAGATCGCCTAGAACGACAAATCCGTGACCTGGAAAATCAGCGTTGGCGTTAA

Protein

MVFAMVDEKGKEQWSRHSSPQLSANFQLCSIPQPSMDTNDWLKQLLMIGVGTTTLVAEKLSDVSDQWVKEGKINADQATAFVDDLMNQIKNEQGQIEANLERQLRNMLQDLGLPRQSEMDELRGRIDRLERQIRDLENQRWR