Your browser is old and dusty. Try Google Chrome!

Details for slr0050

ORF slr0050
Accession NP_442197.1
Symbol ycf56
Category hypothetical protein YCF56
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -116 -102 12.586 0.209
NP_441061.1_2 Reverse -249 -263 11.5043 0.051
NP_441061.1_2 Reverse -108 -122 6.98109 0.11
NP_441061.1_2 Forward -256 -242 0.491246 0.207
NP_440557.1_1 Forward -115 -96 2.3594 0.236
NP_440557.1_1 Reverse -108 -127 -1.18052 0.27
NP_440795.1_7 Forward -256 -249 14.6904 0.0123
NP_440795.1_7 Reverse -249 -256 14.6904 0.0123
NP_440795.1_7 Forward -115 -108 14.6904 0.0123
NP_440795.1_7 Reverse -108 -115 14.6904 0.0123
NP_441418.1_6 Reverse -248 -267 -9.63698 0.0288
NP_441418.1_6 Reverse -107 -126 -19.8634 0.0979
NP_441418.1_6 Forward -257 -238 -29.9915 0.249
NP_442291.1_5 Reverse -247 -263 -4.26803 0.269
NP_442272.1_1 Reverse -182 -200 14.0393 0.293
NP_440897.1_6 Reverse -248 -267 1.47364 0.17
NP_441453.1_1 Forward -264 -246 4.44329 0.26
NP_441453.1_4 Reverse -248 -256 16.539 0.00633
NP_441453.1_4 Reverse -107 -115 16.539 0.00633
NP_441453.1_4 Forward -257 -249 16.539 0.00633
NP_441453.1_4 Forward -116 -108 16.539 0.00633
NP_442151.1_6 Forward -257 -243 14.6509 0.0321
NP_442151.1_6 Reverse -248 -262 9.5377 0.145
NP_442151.1_6 Forward -116 -102 7.57108 0.194
NP_441818.1_1 Reverse -249 -260 9.69459 0.232
NP_441818.1_1 Reverse -108 -119 9.69459 0.232
NP_440226.1_1 Forward -116 -97 12.2908 0.0456
NP_440226.1_1 Forward -257 -238 10.6192 0.061
NP_440226.1_1 Reverse -107 -126 8.75091 0.0823
NP_441630.1_3 Reverse -99 -118 5.80098 0.136
NP_441342.1_2 Reverse -244 -258 10.226 0.209
NP_442655.1_1 Forward -121 -102 0.58944 0.24
NP_442173.1_1 Forward -256 -248 15.4574 0.00633
NP_442173.1_1 Forward -115 -107 15.4574 0.00633
NP_442173.1_1 Reverse -249 -257 15.4574 0.00633
NP_442173.1_1 Reverse -108 -116 15.4574 0.00633
NP_442752.1_4 Forward -257 -250 13.8055 0.0199
NP_442752.1_4 Reverse -248 -255 13.8055 0.0199
NP_442752.1_4 Forward -116 -109 13.8055 0.0199
NP_442752.1_4 Reverse -107 -114 13.8055 0.0199
NP_443027.1_4 Forward -259 -249 14.828 0.0437
NP_443027.1_4 Forward -118 -108 14.828 0.0437
NP_443027.1_4 Reverse -105 -115 13.2547 0.0521
NP_439997.1_4 Forward -226 -207 6.39097 0.266
NP_441812.1_3 Reverse -247 -261 9.14437 0.245
NP_441812.1_3 Reverse -106 -120 8.55439 0.251
NP_441812.1_3 Forward -117 -103 6.88276 0.287
NP_442975.1_10 Forward -261 -247 22.615 0.000219
NP_442975.1_10 Forward -120 -106 22.32 0.000414
NP_442975.1_10 Reverse -244 -258 1.47397 0.297
NP_441225.1_4 Forward -277 -258 -10.9153 0.284
NP_441675.1_4 Reverse -141 -160 5.30933 0.243
NP_441675.1_4 Reverse -291 -310 3.73603 0.263
NP_440784.1_7 Forward -256 -249 15.9687 0.0123
NP_440784.1_7 Reverse -249 -256 15.9687 0.0123
NP_440784.1_7 Forward -115 -108 15.9687 0.0123
NP_440784.1_7 Reverse -108 -115 15.9687 0.0123
NP_442909.1_7 Reverse -74 -88 5.80051 0.269
NP_440061.1_9 Forward -118 -104 10.2254 0.126
NP_440061.1_9 Forward -259 -245 8.25877 0.177
NP_440061.1_9 Reverse -76 -90 5.1122 0.294
NP_442062.1_8 Reverse -248 -258 19.4496 0.000558
NP_442062.1_8 Reverse -107 -117 19.4496 0.000558
NP_442062.1_8 Forward -257 -247 17.3846 0.00193
NP_442062.1_8 Forward -116 -106 10.3048 0.0493
NP_440304.1_4 Forward -259 -249 10.8948 0.051
NP_440304.1_4 Forward -118 -108 10.8948 0.051
NP_440304.1_4 Reverse -105 -115 10.8948 0.051
NP_440304.1_4 Reverse -246 -256 1.84832 0.299
NP_442242.1_4 Forward -256 -249 14.3954 0.0124
NP_442242.1_4 Reverse -249 -256 14.3954 0.0124
NP_442242.1_4 Forward -115 -108 14.3954 0.0124
NP_442242.1_4 Reverse -108 -115 14.3954 0.0124
NP_441781.1_7 Reverse -248 -267 3.93269 0.188
NP_441781.1_7 Reverse -336 -355 -0.39387 0.257
NP_440765.1_3 Forward -95 -76 7.07928 0.268
NP_440893.1_6 Forward -114 -95 14.1583 0.242
NP_441208.1_9 Reverse -104 -118 6.09611 0.253
NP_441208.1_9 Reverse -245 -259 5.40779 0.267
NP_441594.1_6 Reverse -84 -103 2.75272 0.244
NP_442742.1_9 Forward -287 -268 -11.6036 0.269
NP_442110.1_7 Reverse -248 -262 2.85119 0.222
NP_442110.1_7 Forward -116 -102 2.65453 0.222
NP_440856.1_4 Reverse -100 -119 -1.47551 0.201
NP_441083.1_5 Forward -257 -247 20.3345 0.00053
NP_441083.1_5 Reverse -248 -258 11.3864 0.0159
NP_441083.1_5 Reverse -107 -117 11.3864 0.0159
NP_441083.1_5 Forward -116 -106 11.2881 0.0159
NP_442827.1_8 Reverse -240 -259 -0.787962 0.235
NP_441738.1_2 Forward -255 -248 15.28 0.0102
NP_441738.1_2 Reverse -250 -257 15.28 0.0102
NP_441738.1_2 Forward -114 -107 15.28 0.0102
NP_441738.1_2 Reverse -109 -116 15.28 0.0102
NP_441738.1_2 Forward -247 -240 8.1019 0.204
NP_441558.1_5 Forward -259 -240 14.6508 0.0482
NP_441558.1_5 Reverse -351 -370 4.03102 0.293
NP_440209.1_1 Reverse -248 -256 18.1123 0.00295
NP_440209.1_1 Reverse -107 -115 18.1123 0.00295
NP_440209.1_1 Forward -257 -249 18.1123 0.00295
NP_440209.1_1 Forward -116 -108 18.1123 0.00295
NP_442889.1_8 Forward -260 -246 22.615 0.00144
NP_442889.1_8 Forward -119 -105 4.03056 0.27
NP_442889.1_10 Reverse -292 -311 12.7337 0.198
NP_441770.1_4 Reverse -122 -141 -10.522 0.272
NP_440178.1_5 Reverse -113 -122 18.6826 0.137
NP_440178.1_7 Forward -117 -98 -20.5517 0.194
NP_442570.1_3 Forward -370 -351 1.76941 0.193
NP_442570.1_3 Reverse -113 -132 -5.50708 0.244
NP_441716.1_1 Reverse -248 -262 6.09611 0.207
NP_441716.1_2 Reverse -7 -26 2.2072 0.24
NP_441598.1_8 Reverse -12 -27 19.2508 0.0843
NP_442111.1_4 Reverse -247 -261 10.7177 0.0518
NP_442111.1_4 Forward -117 -103 4.12949 0.219
NP_441163.1_1 Forward -265 -248 6.72462 0.254
NP_440906.1_5 Forward -256 -249 15.8704 0.0124
NP_440906.1_5 Reverse -249 -256 15.8704 0.0124
NP_440906.1_5 Forward -115 -108 15.8704 0.0124
NP_440906.1_5 Reverse -108 -115 15.8704 0.0124
NP_440747.1_10 Reverse -104 -116 17.1486 0.000663
NP_440747.1_10 Reverse -245 -257 14.887 0.00223
NP_440747.1_10 Forward -260 -248 -2.02597 0.0196
NP_440747.1_10 Forward -119 -107 -2.02597 0.0196
NP_441130.1_10 Forward -118 -104 10.521 0.112
NP_442973.1_5 Forward -125 -106 15.1424 0.117
NP_441486.1_1 Forward -260 -246 22.5174 0.00162
NP_441486.1_1 Reverse -245 -259 11.3077 0.0164
NP_441486.1_1 Forward -119 -105 4.91614 0.0399
NP_441486.1_1 Reverse -104 -118 -6.39192 0.294
NP_442634.1_4 Reverse -105 -119 7.07942 0.0479
NP_442634.1_4 Forward -118 -104 -1.18038 0.149
NP_442760.1_2 Reverse -123 -142 14.2574 0.28
NP_440470.1_5 Forward -301 -282 8.45061 0.253
NP_440842.1_10 Reverse -350 -364 11.111 0.251
NP_440842.1_10 Reverse -26 -40 2.45787 0.274
NP_441014.1_8 Forward -129 -110 -9.14533 0.291
NP_441014.1_10 Reverse -247 -266 4.22689 0.2
NP_442848.1_1 Forward -263 -249 -2.45868 0.263
NP_442848.1_1 Forward -122 -108 -2.95034 0.263
NP_443018.1_3 Forward -256 -249 14.8871 0.0123
NP_443018.1_3 Reverse -249 -256 14.8871 0.0123
NP_443018.1_3 Forward -115 -108 14.8871 0.0123
NP_443018.1_3 Reverse -108 -115 14.8871 0.0123
NP_441316.1_7 Forward -118 -103 15.9095 0.0486
NP_441634.1_8 Reverse -105 -119 5.30946 0.114
NP_441634.1_8 Reverse -246 -260 5.1128 0.114
NP_441634.1_8 Forward -182 -168 -1.8687 0.295
NP_441634.1_8 Reverse -125 -139 -1.96703 0.295
NP_440376.1_1 Forward -257 -248 19.4693 0.000692
NP_440376.1_1 Reverse -248 -257 19.4693 0.000692
NP_440376.1_1 Forward -116 -107 19.4693 0.000692
NP_440376.1_1 Reverse -107 -116 19.4693 0.000692
NP_440376.1_1 Forward -368 -359 1.76968 0.242
NP_441588.1_4 Forward -255 -245 15.9097 0.0369
NP_441588.1_4 Reverse -250 -260 6.96153 0.178
NP_441588.1_4 Reverse -109 -119 6.96153 0.178
NP_442687.1_7 Forward -258 -248 15.8113 0.0125
NP_442687.1_7 Forward -117 -107 15.8113 0.0125
NP_442687.1_7 Reverse -106 -116 9.02648 0.0994
NP_442687.1_7 Reverse -247 -257 8.92815 0.0994
NP_442485.1_3 Forward -268 -249 -5.31042 0.289
NP_441846.1_10 Reverse -260 -279 -22.5183 0.261
NP_440642.1_10 Forward -333 -319 2.8506 0.277
NP_440571.1_6 Forward -329 -310 11.0289 0.296
NP_441029.1_4 Reverse -332 -351 0.392778 0.279
NP_441763.1_10 Forward -268 -249 5.89851 0.28
NP_440360.1_5 Forward -164 -145 -0.000545616 0.297
NP_442658.1_1 Forward -259 -249 15.9091 0.00966
NP_442658.1_1 Forward -118 -108 15.9091 0.00966
NP_442658.1_1 Reverse -105 -115 14.2375 0.0237
NP_442658.1_1 Reverse -246 -256 6.76441 0.214
NP_442658.1_1 Reverse -357 -367 5.87944 0.246
NP_440141.1_8 Forward -266 -247 6.19431 0.268
NP_441855.2_4 Forward -265 -246 10.2943 0.257
NP_442782.1_2 Forward -373 -359 2.85119 0.271
NP_442782.1_2 Forward -116 -102 1.57289 0.281
NP_440656.1_8 Forward -127 -108 -2.85214 0.192
NP_442544.1_2 Reverse -113 -127 -1.96703 0.293
NP_441414.1_9 Forward -116 -97 6.4893 0.0396
NP_439959.1_6 Forward -384 -365 5.80098 0.274
NP_442937.1_5 Reverse -243 -262 19.764 0.019
NP_441958.1_5 Reverse -106 -116 21.2195 0.000805
NP_441958.1_5 Forward -258 -248 12.2714 0.00183
NP_441958.1_5 Reverse -247 -257 12.2714 0.00183
NP_441958.1_5 Forward -117 -107 12.2714 0.00183
NP_439905.1_1 Forward -115 -102 11.0324 0.204
NP_439905.1_1 Forward -361 -348 9.95071 0.216
NP_440984.1_7 Reverse -102 -116 19.4691 0.00745
NP_440984.1_7 Reverse -243 -257 7.57108 0.166
NP_439990.1_5 Forward -262 -249 10.049 0.128
NP_439990.1_5 Reverse -102 -115 7.29578 0.203
NP_442376.1_6 Forward -47 -28 6.4893 0.18
NP_442690.1_1 Forward -313 -294 -8.65367 0.189
NP_442911.1_2 Reverse -97 -116 4.22769 0.0392
NP_442911.1_2 Reverse -238 -257 0.786102 0.0644
NP_442911.1_2 Forward -267 -248 -2.55715 0.0995
NP_442911.1_2 Forward -126 -107 -10.9153 0.292
NP_441580.1_6 Forward -268 -249 -4.32711 0.235
NP_440153.1_5 Reverse -249 -263 0.687908 0.291
NP_443055.1_6 Reverse -240 -258 17.3246 0.0593
NP_443055.1_6 Forward -399 -381 -2.73484 0.299
NP_440993.1_3 Reverse -97 -116 6.29183 0.148
NP_440993.1_3 Forward -289 -270 1.86696 0.225
NP_440602.1_8 Reverse -107 -121 15.9292 0.115
NP_441348.1_7 Forward -373 -354 12.2908 0.144
NP_441099.1_5 Forward -267 -248 -2.16383 0.118
NP_442002.1_1 Forward -383 -365 -7.35568 0.251
NP_442002.1_9 Reverse -358 -365 12.2322 0.185
NP_442002.1_9 Forward -258 -251 10.7572 0.185
NP_442002.1_9 Forward -117 -110 10.7572 0.185
NP_440809.1_9 Reverse -299 -317 -2.93078 0.225
NP_442567.1_4 Reverse -46 -65 6.78429 0.295
NP_441294.1_7 Forward -261 -247 15.9698 0.0176
NP_441294.1_7 Forward -120 -106 12.5142 0.0944
NP_441646.1_1 Reverse -241 -260 3.83436 0.204
NP_442438.1_10 Forward -262 -248 8.25939 0.0795
NP_442438.1_10 Forward -121 -107 1.76955 0.188
NP_441000.1_6 Reverse -106 -120 5.1128 0.0933
NP_441000.1_6 Reverse -247 -261 -3.44199 0.221
NP_441000.1_6 Forward -117 -103 -4.03198 0.225
NP_441000.1_6 Forward -258 -244 -5.21195 0.266
NP_442771.1_1 Forward -259 -241 -5.88071 0.166
NP_440147.1_4 Forward -118 -105 10.4424 0.0355
NP_440147.1_4 Reverse -246 -259 10.049 0.0355
NP_440147.1_4 Reverse -105 -118 8.9674 0.0448
NP_440147.1_4 Forward -259 -246 3.46087 0.187
NP_441175.1_7 Forward -116 -97 8.16093 0.215
NP_441295.1_5 Forward -127 -108 21.7306 0.0438
NP_441550.1_8 Reverse -105 -115 15.8108 0.0132
NP_441550.1_8 Reverse -246 -256 14.6309 0.0132
NP_441550.1_8 Forward -259 -249 6.0761 0.214
NP_441550.1_8 Forward -118 -108 6.0761 0.214
NP_441916.1_7 Forward -116 -106 18.9579 0.00144
NP_441916.1_7 Reverse -248 -258 18.4663 0.00144
NP_441916.1_7 Reverse -107 -117 18.4663 0.00144
NP_441916.1_7 Forward -257 -247 10.3048 0.0261
NP_441041.1_4 Reverse -248 -267 -1.57384 0.101
NP_441041.1_7 Reverse -104 -116 13.3454 0.0485
NP_441041.1_7 Forward -260 -248 10.916 0.0864
NP_441041.1_7 Forward -119 -107 10.916 0.0864
NP_442396.1_5 Reverse -244 -257 12.2123 0.0913
NP_441725.1_4 Reverse -102 -116 3.93223 0.278
NP_441725.1_5 Reverse -249 -259 11.2881 0.0247
NP_441725.1_5 Reverse -108 -118 11.2881 0.0247
NP_441725.1_5 Forward -256 -246 2.04498 0.115
NP_441725.1_5 Forward -115 -105 1.94665 0.115
NP_441725.1_5 Forward -367 -357 0.176696 0.206
NP_439966.1_7 Forward -259 -249 18.4657 0.00473
NP_439966.1_7 Forward -118 -108 18.4657 0.00473
NP_439966.1_7 Reverse -105 -115 14.3359 0.0203
NP_439966.1_7 Reverse -246 -256 7.25606 0.15
NP_439966.1_9 Forward -259 -250 0.983037 0.253
NP_439966.1_9 Forward -118 -109 0.983037 0.253
NP_440736.1_3 Reverse -105 -124 1.47442 0.282
NP_442941.1_3 Forward -115 -105 19.2529 0.00262
NP_442941.1_3 Reverse -249 -259 11.4848 0.0116
NP_442941.1_3 Reverse -108 -118 11.4848 0.0116
NP_442941.1_3 Forward -256 -246 11.0914 0.0116
NP_440289.1_2 Forward -260 -247 21.3571 0.00262
NP_440289.1_2 Forward -119 -106 14.5723 0.0107
NP_440289.1_2 Reverse -104 -117 -3.52063 0.267
NP_440983.1_9 Reverse -98 -117 0.687771 0.292
NP_440260.1_8 Reverse -239 -257 2.47742 0.182
NP_442281.1_1 Forward -121 -107 20.7467 0.00192
NP_442281.1_1 Reverse -102 -116 15.9285 0.00992
NP_442281.1_1 Forward -262 -248 11.602 0.0447
NP_442281.1_1 Reverse -243 -257 7.96378 0.089
NP_442281.1_5 Reverse -251 -270 20.0581 0.0775
NP_440177.1_9 Reverse -240 -259 14.2574 0.213
NP_442256.1_2 Forward -118 -100 -7.55234 0.214
NP_440437.1_1 Reverse -101 -120 6.68596 0.0724
NP_440437.1_1 Forward -263 -244 6.58763 0.0726
NP_440647.1_9 Forward -118 -100 16.4404 0.112
NP_440498.1_1 Reverse -98 -116 2.0841 0.198
NP_440498.1_1 Forward -125 -107 -2.43913 0.241
NP_440498.1_1 Reverse -239 -257 -3.42244 0.261
NP_442982.1_5 Forward -126 -107 12.2908 0.101
NP_442982.1_5 Reverse -97 -116 -0.295539 0.254
NP_441644.1_6 Forward -116 -106 19.0557 0.000803
NP_441644.1_6 Forward -257 -247 17.3841 0.00127
NP_441644.1_6 Reverse -248 -258 10.1076 0.0628
NP_441644.1_6 Reverse -107 -117 10.1076 0.0628
NP_441644.1_6 Forward -279 -269 3.8145 0.261
NP_443049.1_6 Reverse -145 -155 12.4217 0.24
NP_440867.1_10 Reverse -106 -125 0.786102 0.299
NP_442215.1_2 Reverse -246 -262 7.63002 0.0678
NP_442215.1_2 Forward -118 -102 -3.18639 0.211
NP_442029.1_1 Forward -98 -79 -4.42544 0.192
NP_442029.1_6 Reverse -243 -262 16.1257 0.0999
NP_440253.1_2 Reverse -107 -125 18.112 0.00972
NP_440253.1_2 Forward -257 -239 3.06741 0.123
NP_440929.1_8 Forward -257 -248 19.2726 0.000701
NP_440929.1_8 Reverse -248 -257 19.2726 0.000701
NP_440929.1_8 Forward -116 -107 19.2726 0.000701
NP_440929.1_8 Reverse -107 -116 19.2726 0.000701
NP_442933.1_10 Forward -257 -248 17.601 0.00325
NP_442933.1_10 Reverse -248 -257 17.601 0.00325
NP_442933.1_10 Forward -116 -107 17.601 0.00325
NP_442933.1_10 Reverse -107 -116 17.601 0.00325
NP_441751.2_8 Reverse -249 -263 5.70279 0.0416
NP_441751.2_8 Forward -115 -101 5.01447 0.0448
NP_441751.2_8 Reverse -108 -122 -2.55701 0.132
NP_442554.1_4 Forward -146 -127 9.3409 0.277
NP_442554.1_8 Forward -115 -105 17.2863 0.00543
NP_442554.1_8 Forward -256 -246 15.3197 0.00882
NP_442554.1_8 Reverse -249 -259 13.8447 0.0145
NP_442554.1_8 Reverse -108 -118 13.8447 0.0145
NP_442970.1_3 Forward -22 -4 12.678 0.225
NP_441762.1_7 Forward -258 -246 9.57708 0.0142
NP_441762.1_7 Reverse -106 -118 2.98891 0.0676
NP_441762.1_7 Reverse -247 -259 2.89058 0.0676
NP_441762.1_7 Forward -117 -105 2.30059 0.0676
NP_442142.1_4 Forward -119 -106 16.4399 0.0264
NP_442142.1_4 Forward -260 -247 15.85 0.0264
NP_442142.1_4 Reverse -104 -117 15.4566 0.0264
NP_442142.1_4 Reverse -245 -258 5.52525 0.188
NP_442292.1_1 Forward -256 -247 18.486 0.00229
NP_442292.1_1 Forward -115 -106 17.5026 0.00435
NP_442292.1_1 Reverse -249 -258 9.63616 0.0183
NP_442292.1_1 Reverse -108 -117 9.63616 0.0183
NP_442292.1_5 Reverse -244 -263 -0.000545616 0.257
NP_442476.1_6 Forward -115 -101 3.73617 0.154
NP_442197.1_9 Forward -235 -216 20.4523 0.252
NP_442197.1_10 Forward -97 -78 21.7306 0.161
NP_442381.1_8 Forward -260 -241 13.5691 0.0192
NP_442381.1_8 Reverse -237 -256 -3.54046 0.126
NP_442381.1_8 Reverse -104 -123 -6.58872 0.161
NP_442381.1_8 Forward -119 -100 -11.9969 0.266
NP_441711.1_4 Reverse -239 -258 4.62101 0.207
NP_443009.1_5 Reverse -106 -117 19.626 0.00102
NP_443009.1_5 Reverse -247 -258 18.3477 0.00265
NP_443009.1_5 Forward -117 -106 7.82632 0.118
NP_443009.1_5 Reverse -358 -369 3.8931 0.274
NP_441865.1_3 Forward -22 -4 13.1955 0.255
NP_442271.1_6 Forward -124 -105 14.5524 0.294
NP_442408.2_1 Reverse -107 -126 -1.27885 0.234
NP_442408.2_1 Forward -116 -97 -2.95047 0.241
NP_441715.1_4 Forward -115 -105 16.7946 0.0106
NP_441715.1_4 Reverse -249 -259 16.303 0.0117
NP_441715.1_4 Reverse -108 -118 16.303 0.0117
NP_441715.1_4 Forward -256 -246 7.94484 0.107
NP_440357.1_1 Reverse -134 -153 6.4893 0.296
NP_441448.1_1 Forward -393 -374 5.30933 0.261
NP_440183.1_9 Forward -277 -258 -15.3402 0.273
NP_440464.1_10 Forward -256 -246 13.0082 0.169
NP_441468.1_1 Forward -256 -249 15.8704 0.0124
NP_441468.1_1 Reverse -249 -256 15.8704 0.0124
NP_441468.1_1 Forward -115 -108 15.8704 0.0124
NP_441468.1_1 Reverse -108 -115 15.8704 0.0124
NP_442099.1_1 Reverse -37 -55 13.2938 0.274
NP_441020.2_6 Forward -118 -101 15.1818 0.0434
NP_441020.2_6 Reverse -105 -122 10.7569 0.136
NP_441020.2_6 Forward -259 -242 10.5603 0.141
NP_441020.2_6 Reverse -238 -255 7.11867 0.241
NP_441673.1_1 Forward -257 -248 20.8459 0.000698
NP_441673.1_1 Reverse -248 -257 20.8459 0.000698
NP_441673.1_1 Forward -116 -107 20.8459 0.000698
NP_441673.1_1 Reverse -107 -116 20.8459 0.000698
NP_441826.1_2 Forward -263 -249 13.4709 0.0214
NP_441826.1_2 Forward -122 -108 1.27789 0.157
NP_441330.1_1 Reverse -102 -121 -12.4886 0.183
NP_442063.1_9 Forward -389 -370 1.67108 0.28
NP_442868.1_6 Reverse -105 -115 10.4031 0.038
NP_442868.1_6 Reverse -246 -256 9.81313 0.038
NP_442868.1_6 Forward -259 -249 0.963343 0.205
NP_442868.1_6 Forward -118 -108 0.963343 0.205
NP_442719.1_2 Forward -287 -269 -1.6532 0.175
NP_442719.1_2 Reverse -202 -220 -10.6996 0.28
NP_441056.1_1 Reverse -248 -267 -8.26035 0.282
NP_440051.1_5 Forward -307 -293 13.9634 0.285
NP_441612.1_2 Forward -257 -247 8.54929 0.21
NP_442227.1_2 Forward -277 -258 -0.787193 0.259
NP_442361.1_3 Forward -122 -109 7.88576 0.285
NP_442808.1_1 Forward -258 -248 18.4657 0.00201
NP_442808.1_1 Forward -117 -107 18.4657 0.00201
NP_442808.1_1 Reverse -106 -116 8.73102 0.0481
NP_442808.1_1 Reverse -247 -257 8.63269 0.0481
NP_442808.1_1 Forward -138 -128 1.74956 0.281
NP_442542.1_9 Forward -264 -250 9.53707 0.134
NP_442542.1_9 Forward -123 -109 7.76712 0.183
NP_442050.1_5 Reverse -105 -115 15.9091 0.0091
NP_442050.1_5 Forward -259 -249 9.12434 0.193
NP_442050.1_5 Forward -118 -108 9.12434 0.193
NP_442050.1_5 Reverse -246 -256 7.64939 0.243
NP_442593.1_1 Reverse -248 -267 14.1591 0.285
NP_441518.1_3 Forward -126 -107 5.50599 0.05
NP_441878.1_6 Reverse -106 -116 10.5014 0.0176
NP_441878.1_6 Forward -258 -248 10.4031 0.0176
NP_441878.1_6 Reverse -247 -257 10.4031 0.0176
NP_441878.1_6 Forward -117 -107 10.4031 0.0176
NP_441878.1_6 Reverse -335 -345 -7.59145 0.245
NP_441878.1_10 Reverse -135 -149 13.4709 0.289
NP_441036.1_8 Forward -258 -248 17.7779 0.000554
NP_441036.1_8 Forward -117 -107 17.7779 0.000554
NP_441036.1_8 Reverse -106 -116 15.713 0.00724
NP_441036.1_8 Reverse -247 -257 8.33817 0.174
NP_441557.1_5 Forward -257 -248 19.9609 0.000699
NP_441557.1_5 Reverse -248 -257 19.9609 0.000699
NP_441557.1_5 Forward -116 -107 19.9609 0.000699
NP_441557.1_5 Reverse -107 -116 19.9609 0.000699
NP_441445.1_1 Reverse -239 -258 2.0644 0.243
NP_441445.1_1 Forward -75 -56 -0.0988766 0.286
NP_441445.1_1 Forward -266 -247 -0.39387 0.291
NP_442066.2_9 Reverse -103 -116 12.6056 0.154
NP_441433.1_8 Reverse -198 -217 2.26107 0.223
NP_441308.1_8 Forward -259 -249 10.1081 0.22
NP_441308.1_8 Forward -118 -108 10.1081 0.22
NP_442183.1_1 Reverse -107 -121 19.4691 0.00583
NP_442183.1_1 Reverse -248 -262 11.996 0.0648
NP_442183.1_1 Forward -257 -243 5.99778 0.193
NP_442183.1_3 Reverse -366 -385 14.6499 0.243
NP_442166.1_3 Forward -377 -358 -10.6203 0.264
NP_442397.1_9 Forward -257 -238 5.70265 0.246
NP_440440.1_1 Forward -399 -380 10.0284 0.189
NP_442347.1_2 Forward -256 -247 12.4878 0.056
NP_442347.1_2 Reverse -249 -258 11.1111 0.056
NP_442347.1_2 Reverse -108 -117 11.1111 0.056
NP_442347.1_2 Forward -115 -106 3.34298 0.284
NP_442645.1_2 Reverse -240 -259 -12.0953 0.144
NP_442645.1_2 Reverse -246 -265 -21.6334 0.29
NP_442645.1_2 Reverse -99 -118 -22.5183 0.291
NP_441037.1_4 Reverse -246 -256 7.9999 0.237
NP_441037.1_4 Reverse -105 -115 7.22024 0.237
NP_441037.1_4 Forward -259 -249 7.02532 0.237
NP_441037.1_4 Forward -118 -108 7.02532 0.237
NP_441633.1_3 Reverse -246 -259 8.47575 0.0377
NP_441633.1_3 Reverse -105 -118 3.5592 0.0699
NP_441633.1_3 Forward -259 -246 -3.71729 0.177
NP_441633.1_3 Forward -118 -105 -3.81562 0.177
NP_440136.1_2 Forward -256 -249 15.9687 0.0123
NP_440136.1_2 Reverse -249 -256 15.9687 0.0123
NP_440136.1_2 Forward -115 -108 15.9687 0.0123
NP_440136.1_2 Reverse -108 -115 15.9687 0.0123
NP_442590.1_10 Reverse -248 -267 7.17762 0.23
NP_442998.1_10 Forward -255 -248 15.5754 0.0102
NP_442998.1_10 Reverse -250 -257 15.5754 0.0102
NP_442998.1_10 Forward -114 -107 15.5754 0.0102
NP_442998.1_10 Reverse -109 -116 15.5754 0.0102
NP_440899.1_2 Reverse -96 -115 7.96345 0.209
NP_440299.1_1 Reverse -244 -257 13.0967 0.0319
NP_440299.1_1 Forward -261 -248 11.9167 0.0427
NP_440299.1_1 Forward -120 -107 2.28034 0.292
NP_441799.1_1 Reverse -103 -117 19.1735 0.00693
NP_441799.1_1 Reverse -244 -258 16.1252 0.0153
NP_441799.1_1 Forward -120 -106 9.73373 0.0857
NP_441007.1_10 Reverse -102 -115 10.8357 0.0646
NP_441007.1_10 Reverse -243 -256 1.10092 0.209
NP_440256.1_1 Reverse -104 -123 16.6174 0.00588
NP_440256.1_1 Reverse -245 -264 1.37609 0.0761
NP_440256.1_1 Forward -119 -100 -9.34199 0.278
NP_441512.1_4 Forward -261 -242 7.07928 0.286
NP_441559.1_8 Forward -262 -248 3.24451 0.143
NP_441559.1_8 Reverse -102 -116 1.37622 0.156
NP_441559.1_8 Reverse -353 -367 -6.58858 0.279
NP_440915.1_6 Forward -261 -247 6.3911 0.0826
NP_440915.1_6 Forward -120 -106 5.89945 0.0879
NP_440915.1_6 Reverse -103 -117 0.982901 0.148
NP_441704.1_8 Reverse -237 -256 8.55343 0.208
NP_442866.1_1 Reverse -102 -121 -8.45701 0.279
NP_441464.1_8 Forward -257 -243 6.48943 0.232
NP_441464.1_8 Reverse -77 -91 4.91614 0.26
NP_440306.1_8 Forward -294 -275 0.883656 0.204
NP_441939.1_3 Forward -115 -96 22.4189 0.00346
NP_441939.1_3 Forward -256 -237 7.27595 0.206
NP_441494.1_6 Reverse -102 -115 5.72248 0.294
NP_442993.1_1 Reverse -248 -264 11.5633 0.0141
NP_442993.1_1 Reverse -107 -123 11.4649 0.0141
NP_442993.1_1 Forward -257 -241 -8.88958 0.176
NP_442993.1_1 Forward -345 -329 -10.6595 0.224
NP_442386.1_9 Forward -258 -249 15.7322 0.0144
NP_442386.1_9 Forward -117 -108 15.7322 0.0144
NP_442386.1_9 Reverse -247 -256 13.8639 0.0289
NP_442386.1_9 Forward -137 -128 7.57079 0.219
NP_442386.1_9 Reverse -106 -115 6.39082 0.219
NP_441340.1_5 Forward -256 -249 15.6737 0.0124
NP_441340.1_5 Reverse -249 -256 15.6737 0.0124
NP_441340.1_5 Forward -115 -108 15.6737 0.0124
NP_441340.1_5 Reverse -108 -115 15.6737 0.0124
NP_442327.1_3 Forward -304 -285 8.35512 0.227
NP_440327.1_6 Reverse -110 -129 13.9625 0.149
NP_441248.1_10 Reverse -18 -28 14.6181 0.282
NP_439976.1_4 Reverse -361 -380 4.71854 0.278
NP_442240.1_2 Forward -115 -96 -10.7186 0.137
NP_440161.1_3 Reverse -105 -124 14.9458 0.118
NP_440161.1_3 Forward -118 -99 7.86593 0.285
NP_441160.1_3 Forward -152 -133 -2.36049 0.225
NP_440586.1_1 Forward -90 -71 -4.81876 0.278
NP_440586.1_8 Forward -256 -249 13.2151 0.026
NP_440586.1_8 Forward -115 -108 13.2151 0.026
NP_440586.1_8 Reverse -249 -256 13.2151 0.026
NP_440586.1_8 Reverse -108 -115 13.2151 0.026
NP_442251.1_6 Forward -256 -249 15.2804 0.0124
NP_442251.1_6 Reverse -249 -256 15.2804 0.0124
NP_442251.1_6 Forward -115 -108 15.2804 0.0124
NP_442251.1_6 Reverse -108 -115 15.2804 0.0124
NP_442959.1_5 Forward -230 -211 5.50599 0.28
NP_440684.1_9 Forward -122 -108 8.94771 0.221
NP_440684.1_9 Reverse -242 -256 8.84938 0.223
NP_440684.1_9 Forward -263 -249 8.65272 0.225
NP_441262.1_3 Reverse -248 -255 14.7888 0.0223
NP_441262.1_3 Reverse -107 -114 14.7888 0.0223
NP_441262.1_3 Forward -257 -250 14.7888 0.0223
NP_441262.1_3 Forward -116 -109 14.7888 0.0223
NP_443051.1_1 Reverse -106 -115 19.5676 0.00335
NP_443051.1_1 Reverse -247 -256 10.4228 0.00754
NP_443051.1_1 Forward -258 -249 10.4228 0.00754
NP_443051.1_1 Forward -117 -108 10.4228 0.00754
NP_439937.1_9 Forward -149 -132 -15.1047 0.287
NP_441595.1_5 Reverse -241 -259 7.00065 0.222
NP_440439.1_1 Reverse -104 -117 18.1122 0.0105
NP_440439.1_1 Forward -119 -106 8.08242 0.0559
NP_440439.1_1 Forward -260 -247 1.19926 0.159
NP_440439.1_1 Reverse -387 -400 -1.65234 0.275
NP_440372.1_2 Forward -256 -249 16.3621 0.0124
NP_440372.1_2 Reverse -249 -256 16.3621 0.0124
NP_440372.1_2 Forward -115 -108 16.3621 0.0124
NP_440372.1_2 Reverse -108 -115 16.3621 0.0124
NP_441181.1_6 Reverse -249 -267 6.41066 0.219
NP_441293.1_6 Forward -304 -285 19.0502 0.1
NP_440316.1_10 Reverse -269 -279 7.15819 0.251
NP_441803.1_2 Reverse -243 -262 5.01433 0.171
NP_440139.1_1 Reverse -242 -261 7.37347 0.133
NP_440139.1_1 Forward -122 -103 0.392004 0.292
NP_441572.1_7 Forward -263 -244 -5.01543 0.248
NP_441572.1_7 Reverse -101 -120 -5.50708 0.263
NP_440267.1_2 Reverse -102 -116 11.5037 0.125
NP_440267.1_2 Forward -121 -107 9.43874 0.156
NP_442384.1_10 Forward -116 -103 17.0305 0.0065
NP_442384.1_10 Forward -257 -244 8.77074 0.0608
NP_442384.1_10 Reverse -248 -261 8.37742 0.0656
NP_441018.1_7 Reverse -41 -60 8.55425 0.242
NP_442790.1_4 Forward -125 -106 -13.2752 0.26
NP_442790.1_4 Forward -266 -247 -13.7669 0.268
NP_442262.1_10 Forward -256 -249 14.1988 0.0123
NP_442262.1_10 Reverse -249 -256 14.1988 0.0123
NP_442262.1_10 Forward -115 -108 14.1988 0.0123
NP_442262.1_10 Reverse -108 -115 14.1988 0.0123
NP_441689.1_5 Forward -259 -249 8.53436 0.132
NP_441689.1_5 Forward -118 -108 8.53436 0.132
NP_441689.1_5 Reverse -105 -115 8.3377 0.132
NP_441689.1_5 Reverse -246 -256 5.78111 0.197
NP_441689.1_5 Reverse -388 -398 3.61784 0.3
NP_440163.1_10 Forward -260 -250 15.2213 0.0762
NP_440163.1_10 Forward -119 -109 15.2213 0.0762
NP_440344.1_10 Forward -264 -247 20.295 0.00187
NP_440344.1_10 Forward -123 -106 0.333834 0.0363
NP_440344.1_10 Reverse -241 -258 -11.5642 0.219
NP_440531.1_6 Forward -265 -246 2.16274 0.161
NP_440531.1_6 Reverse -99 -118 -1.67217 0.237
NP_440531.1_8 Reverse -34 -53 5.80098 0.249
NP_441965.1_10 Forward -119 -103 18.1514 0.031
NP_441965.1_10 Forward -260 -244 2.41848 0.288
NP_442750.1_1 Reverse -12 -31 8.25844 0.261
NP_440297.1_9 Reverse -249 -259 9.32148 0.0917
NP_440297.1_9 Reverse -108 -118 9.32148 0.0917
NP_440297.1_9 Forward -361 -351 0.373358 0.282
NP_440297.1_9 Forward -256 -246 -0.118297 0.282
NP_440297.1_9 Forward -115 -105 -0.216628 0.282
NP_441896.1_3 Reverse -239 -258 -2.95047 0.294
NP_440894.1_10 Reverse -160 -179 8.16093 0.182
NP_440937.1_5 Forward -102 -83 8.75091 0.278
NP_442129.1_6 Forward -218 -199 14.5282 0.246
NP_440999.1_9 Forward -261 -247 14.1593 0.0277
NP_440999.1_9 Forward -120 -106 2.06454 0.154
NP_440999.1_9 Reverse -103 -117 -1.8687 0.252
NP_440888.1_2 Reverse -248 -262 18.1901 0.00261
NP_440888.1_2 Reverse -107 -121 14.5519 0.0168
NP_440888.1_2 Forward -116 -102 12.2903 0.0476
NP_440888.1_2 Forward -257 -243 8.94708 0.142
NP_440888.1_2 Forward -338 -324 7.3738 0.198
NP_442892.1_9 Forward -339 -325 13.077 0.296
NP_440491.1_1 Forward -119 -100 13.6416 0.118
NP_440491.1_1 Forward -260 -241 7.01447 0.28
NP_442948.1_2 Reverse -106 -125 5.80098 0.25
NP_442077.1_9 Forward -33 -14 -5.60541 0.275
NP_441543.1_2 Reverse -249 -258 18.486 0.00236
NP_441543.1_2 Reverse -108 -117 18.486 0.00236
NP_441543.1_2 Forward -256 -247 16.9127 0.00359
NP_441543.1_2 Forward -115 -106 15.9293 0.00518
NP_442845.1_2 Reverse -242 -256 6.58777 0.207
NP_442845.1_2 Forward -263 -249 4.91614 0.249
NP_442845.1_2 Forward -368 -354 3.44117 0.29
NP_442845.1_4 Reverse -105 -124 11.1109 0.178
NP_441551.1_5 Forward -120 -104 7.92432 0.241
NP_441469.1_8 Forward -258 -249 16.126 0.00797
NP_441469.1_8 Forward -117 -108 16.126 0.00797
NP_441469.1_8 Reverse -106 -115 6.5879 0.227
NP_441469.1_8 Reverse -247 -256 6.48957 0.227
NP_443064.1_6 Forward -257 -247 12.5669 0.0796
NP_443064.1_6 Forward -116 -106 10.8217 0.13
NP_442578.1_7 Forward -256 -249 14.5921 0.026
NP_442578.1_7 Forward -115 -108 14.5921 0.026
NP_442578.1_7 Reverse -249 -256 14.5921 0.026
NP_442578.1_7 Reverse -108 -115 14.5921 0.026
NP_440710.1_1 Reverse -99 -117 -8.33898 0.262
NP_440148.1_1 Reverse -19 -38 5.60432 0.186
NP_441462.1_2 Forward -116 -106 20.2362 0.000805
NP_441462.1_2 Forward -257 -247 11.5831 0.00406
NP_441462.1_2 Reverse -248 -258 11.5831 0.00406
NP_441462.1_2 Reverse -107 -117 11.5831 0.00406
NP_441621.1_7 Forward -118 -104 4.32615 0.0934
NP_443062.1_1 Forward -116 -98 15.3714 0.0385
NP_443062.1_1 Reverse -248 -266 8.83844 0.145
NP_443062.1_6 Forward -265 -246 0.294447 0.299
NP_441410.1_3 Forward -125 -106 8.55425 0.21
NP_442204.1_1 Reverse -103 -114 11.2684 0.0565
NP_442204.1_1 Forward -261 -250 0.353664 0.281
NP_441560.1_8 Reverse -243 -262 16.4795 0.0715
NP_441351.1_8 Forward -259 -240 3.34271 0.232
NP_440516.1_2 Forward -263 -245 4.34571 0.138
NP_440516.1_6 Reverse -365 -379 12.192 0.196
NP_440516.1_8 Forward -257 -248 16.9127 0.00442
NP_440516.1_8 Reverse -248 -257 16.9127 0.00442
NP_440516.1_8 Forward -116 -107 16.9127 0.00442
NP_440516.1_8 Reverse -107 -116 16.9127 0.00442
NP_441785.1_1 Reverse -248 -262 14.9684 0.148
NP_441785.1_1 Reverse -107 -121 14.3866 0.161
NP_442428.1_5 Forward -256 -249 15.8704 0.0124
NP_442428.1_5 Reverse -249 -256 15.8704 0.0124
NP_442428.1_5 Forward -115 -108 15.8704 0.0124
NP_442428.1_5 Reverse -108 -115 15.8704 0.0124
NP_442428.1_7 Reverse -361 -380 5.60432 0.296
NP_441867.1_2 Forward -383 -364 -12.8819 0.27
NP_440673.1_3 Forward -255 -248 12.4288 0.0426
NP_440673.1_3 Forward -114 -107 12.4288 0.0426
NP_440673.1_3 Reverse -250 -257 12.4288 0.0426
NP_440673.1_3 Reverse -109 -116 12.4288 0.0426
NP_440673.1_7 Forward -268 -249 11.6025 0.111
NP_443048.1_4 Forward -152 -133 21.1861 0.0641
NP_441052.1_2 Forward -257 -247 19.9412 0.00106
NP_441052.1_2 Reverse -248 -258 10.5014 0.0285
NP_441052.1_2 Reverse -107 -117 10.5014 0.0285
NP_441052.1_2 Forward -116 -106 10.4031 0.0285
NP_441052.1_2 Forward -155 -145 4.3066 0.161
NP_442219.1_8 Forward -261 -242 10.4863 0.203
NP_442219.1_8 Reverse -238 -257 6.62097 0.292
NP_442219.1_9 Forward -256 -247 17.7976 0.00718
NP_442219.1_9 Reverse -249 -258 8.35786 0.0681
NP_442219.1_9 Reverse -108 -117 8.35786 0.0681
NP_442219.1_9 Forward -115 -106 8.25953 0.0681
NP_440592.1_9 Reverse -88 -107 17.5024 0.155
NP_440436.1_4 Reverse -249 -258 18.1905 0.00233
NP_440436.1_4 Reverse -108 -117 18.1905 0.00233
NP_440436.1_4 Forward -256 -247 17.2072 0.00233
NP_440436.1_4 Forward -115 -106 9.24241 0.0871
NP_441884.1_9 Forward -119 -100 -14.6519 0.138
NP_441884.1_9 Forward -260 -241 -22.3217 0.277
NP_440648.1_1 Forward -116 -97 18.1907 0.058
NP_441719.1_2 Reverse -245 -259 13.2523 0.286
NP_441719.1_4 Forward -256 -249 16.3621 0.0124
NP_441719.1_4 Reverse -249 -256 16.3621 0.0124
NP_441719.1_4 Forward -115 -108 16.3621 0.0124
NP_441719.1_4 Reverse -108 -115 16.3621 0.0124
NP_441733.1_10 Reverse -245 -258 7.09911 0.156
NP_441733.1_10 Reverse -104 -117 5.82081 0.203
NP_441733.1_10 Reverse -237 -250 3.75586 0.288
NP_441004.1_1 Reverse -242 -261 -15.8318 0.279
NP_441577.1_10 Reverse -244 -263 7.57094 0.198
NP_442366.1_3 Reverse -106 -124 12.9988 0.0272
NP_442366.1_3 Reverse -247 -265 9.75391 0.054
NP_442366.1_3 Forward -117 -99 3.75572 0.105
NP_442366.1_3 Forward -258 -240 0.412472 0.172
NP_442366.1_5 Reverse -245 -255 15.4175 0.0374
NP_440129.1_10 Forward -123 -109 3.8345 0.189
NP_440296.1_10 Forward -119 -100 -14.2585 0.269
NP_441115.1_4 Forward -117 -99 11.4247 0.14
NP_442206.1_1 Forward -339 -320 -12.7836 0.235
NP_442206.1_10 Forward -116 -101 6.86307 0.178
NP_442854.1_6 Forward -373 -354 2.3594 0.272
NP_440328.1_4 Forward -122 -103 4.32602 0.167
NP_443054.1_2 Reverse -105 -119 10.521 0.0761
NP_443054.1_2 Reverse -246 -260 3.24451 0.24
NP_443054.1_2 Forward -259 -245 1.86788 0.245
NP_442430.1_10 Reverse -97 -116 11.6017 0.245
NP_441851.1_10 Forward -258 -248 16.008 0.00552
NP_441851.1_10 Forward -117 -107 16.008 0.00552
NP_441851.1_10 Reverse -247 -257 15.8113 0.00552
NP_441851.1_10 Reverse -106 -116 8.53483 0.114
NP_442856.1_7 Forward -266 -247 5.40766 0.131
NP_442515.1_1 Forward -258 -244 3.34284 0.12
NP_442515.1_1 Forward -117 -103 -4.4253 0.298
NP_442515.1_1 Reverse -247 -261 -4.91696 0.298
NP_440463.1_8 Forward -340 -321 6.14452 0.271
NP_440940.1_7 Forward -267 -249 3.16499 0.277
NP_441349.1_10 Forward -126 -107 -2.55715 0.121
NP_441349.1_10 Reverse -238 -257 -8.06369 0.266
NP_441409.1_6 Reverse -101 -120 -6.58872 0.13
NP_441409.1_6 Forward -263 -244 -15.0452 0.275
NP_440432.1_9 Forward -115 -100 4.89645 0.0622
NP_440432.1_9 Reverse -108 -123 0.373221 0.159
NP_440474.1_8 Reverse -108 -122 14.7486 0.0595
NP_440474.1_8 Reverse -249 -263 9.04542 0.168
NP_440431.1_3 Reverse -6 -25 -9.14533 0.241
NP_440431.1_3 Reverse -141 -160 -12.3902 0.299
NP_442450.1_5 Forward -259 -249 9.32148 0.115
NP_442450.1_5 Forward -118 -108 9.32148 0.115
NP_442450.1_5 Reverse -246 -256 7.55152 0.13
NP_442168.1_5 Forward -256 -237 1.96607 0.232
NP_440588.1_2 Reverse -98 -117 8.45592 0.0455
NP_440588.1_2 Forward -266 -247 -1.08219 0.155
NP_441570.1_1 Reverse -248 -266 -6.1757 0.0773
NP_441570.1_1 Forward -116 -98 -8.83064 0.122
NP_441570.1_1 Reverse -107 -125 -9.32229 0.134
NP_440078.1_4 Reverse -237 -256 21.8289 0.0343
NP_441078.1_4 Forward -257 -248 19.6659 0.0007
NP_441078.1_4 Reverse -248 -257 19.6659 0.0007
NP_441078.1_4 Forward -116 -107 19.6659 0.0007
NP_441078.1_4 Reverse -107 -116 19.6659 0.0007
NP_442729.1_8 Forward -261 -248 8.18076 0.125
NP_441663.1_8 Reverse -101 -120 -2.65548 0.271
NP_440707.1_6 Reverse -99 -118 21.2381 0.0318
NP_440526.1_3 Reverse -88 -99 2.41814 0.267
NP_440526.1_3 Reverse -249 -260 1.92649 0.267
NP_440526.1_3 Reverse -108 -119 1.92649 0.267
NP_440526.1_3 Forward -256 -245 1.04151 0.267
NP_441432.1_8 Reverse -247 -256 16.8143 0.00595
NP_441432.1_8 Reverse -106 -115 16.8143 0.00595
NP_441432.1_8 Forward -258 -249 8.25953 0.0755
NP_441432.1_8 Forward -117 -108 8.25953 0.0755
NP_441432.1_9 Forward -305 -292 15.6762 0.133
NP_441432.1_10 Reverse -190 -209 17.6212 0.297
NP_442320.1_8 Forward -122 -108 12.8809 0.016
NP_442320.1_8 Forward -263 -249 6.29277 0.029
NP_442320.1_8 Reverse -242 -256 5.89945 0.0309
NP_442344.1_7 Forward -256 -237 -5.9004 0.168
NP_441732.1_2 Forward -261 -245 -6.7263 0.0495
NP_441732.1_2 Reverse -103 -119 -16.4611 0.167
NP_441732.1_2 Reverse -148 -164 -16.7561 0.195
NP_440760.1_1 Forward -116 -97 -2.75381 0.0332
NP_440760.1_1 Reverse -248 -267 -14.3569 0.129
NP_440760.1_1 Forward -257 -238 -21.3384 0.234
NP_440199.1_10 Forward -260 -250 14.533 0.0861
NP_440199.1_10 Forward -119 -109 14.533 0.0861
NP_441805.1_2 Reverse -96 -115 3.44104 0.154
NP_442353.1_4 Forward -263 -244 7.57013 0.165
NP_442510.1_5 Reverse -239 -258 14.9458 0.215
NP_442400.1_1 Reverse -104 -123 3.6377 0.159
NP_440713.1_4 Forward -267 -248 7.66927 0.176
NP_442489.1_2 Forward -268 -249 8.84924 0.168
NP_442489.1_7 Forward -257 -248 20.1576 0.000695
NP_442489.1_7 Reverse -248 -257 20.1576 0.000695
NP_442489.1_7 Forward -116 -107 20.1576 0.000695
NP_442489.1_7 Reverse -107 -116 20.1576 0.000695
NP_441706.1_10 Reverse -245 -264 8.35759 0.259
NP_440559.1_1 Forward -256 -247 17.4043 0.00658
NP_440559.1_1 Reverse -249 -258 8.75118 0.0586
NP_440559.1_1 Reverse -108 -117 8.75118 0.0586
NP_440559.1_1 Forward -115 -106 8.65285 0.0586
NP_441659.2_8 Forward -116 -106 20.9245 0.000805
NP_441659.2_8 Forward -257 -247 18.1713 0.00133
NP_441659.2_8 Reverse -248 -258 11.9764 0.0147
NP_441659.2_8 Reverse -107 -117 11.9764 0.0147
NP_440860.1_6 Forward -101 -82 13.1758 0.293
NP_441022.1_1 Reverse -18 -27 11.0666 0.284
NP_442913.1_10 Reverse -98 -117 7.17762 0.056
NP_441040.1_2 Reverse -246 -265 -12.2919 0.255
NP_441040.1_5 Reverse -348 -367 2.55606 0.28
NP_439956.1_7 Forward -379 -360 21.4356 0.0325
NP_440779.1_5 Reverse -107 -124 -5.27103 0.14
NP_442346.1_5 Reverse -247 -257 16.6963 0.00248
NP_442346.1_5 Reverse -106 -116 16.303 0.00248
NP_442346.1_5 Forward -258 -248 9.02648 0.118
NP_442346.1_5 Forward -117 -107 9.02648 0.118
NP_440545.1_3 Reverse -244 -261 0.727158 0.133
NP_440545.1_3 Reverse -47 -64 -0.551145 0.155
NP_440545.1_3 Forward -120 -103 -3.69774 0.21
NP_440545.1_3 Forward -366 -349 -5.1727 0.242
NP_441856.1_1 Forward -98 -79 30.2854 0.000397
NP_441856.1_2 Forward -182 -163 21.2389 0.049
NP_441856.1_3 Forward -119 -100 26.7455 0.00437
NP_440459.1_2 Forward -266 -249 11.5436 0.173
NP_440459.1_2 Forward -371 -354 8.00365 0.272
NP_440459.1_2 Reverse -372 -389 7.90532 0.276
NP_440459.1_8 Reverse -251 -269 12.9005 0.195
NP_440010.1_10 Reverse -258 -277 9.53756 0.209
NP_442603.1_7 Forward -116 -102 7.66879 0.198
NP_442828.1_7 Forward -377 -358 -5.70374 0.277
NP_441585.1_6 Forward -399 -380 13.0766 0.263
NP_441888.1_7 Forward -262 -248 2.5562 0.225
NP_441888.1_7 Forward -121 -107 2.35953 0.225
NP_440449.1_6 Reverse -183 -201 6.60236 0.244
NP_441948.1_4 Forward -123 -105 -2.93078 0.179
NP_441833.1_4 Forward -256 -249 15.9687 0.0124
NP_441833.1_4 Reverse -249 -256 15.9687 0.0124
NP_441833.1_4 Forward -115 -108 15.9687 0.0124
NP_441833.1_4 Reverse -108 -115 15.9687 0.0124
NP_441329.1_6 Reverse -289 -308 -2.81744 0.294
NP_441895.1_10 Forward -380 -361 -18.1918 0.282
NP_441112.1_8 Forward -218 -199 11.7008 0.148
NP_442162.1_9 Forward -256 -249 16.2637 0.0124
NP_442162.1_9 Reverse -249 -256 16.2637 0.0124
NP_442162.1_9 Forward -115 -108 16.2637 0.0124
NP_442162.1_9 Reverse -108 -115 16.2637 0.0124
NP_440671.1_4 Forward -263 -249 19.0758 0.00997
NP_440671.1_4 Forward -122 -108 8.55439 0.195
NP_442199.1_5 Reverse -240 -259 -6.1954 0.268
NP_442140.1_3 Forward -256 -246 12.2714 0.0632
NP_442140.1_3 Reverse -249 -259 8.33817 0.119
NP_442140.1_3 Reverse -108 -118 8.33817 0.119
NP_442140.1_3 Forward -115 -105 4.69992 0.238
NP_442021.1_3 Reverse -242 -261 -6.58872 0.257
NP_441609.1_1 Forward -218 -199 -0.4922 0.242
NP_441671.1_10 Reverse -379 -398 2.0644 0.257
NP_440875.1_9 Forward -114 -104 16.5483 0.0145
NP_440875.1_9 Reverse -250 -260 8.37203 0.233
NP_440875.1_9 Reverse -109 -119 8.37203 0.233
NP_441813.1_5 Reverse -105 -115 18.1713 0.00743
NP_441813.1_5 Forward -259 -249 17.188 0.00979
NP_441813.1_5 Forward -118 -108 17.188 0.00979
NP_441813.1_5 Reverse -246 -256 8.63316 0.0367
NP_440590.1_4 Reverse -249 -262 15.0639 0.0106
NP_440590.1_4 Forward -256 -243 7.78743 0.0494
NP_440590.1_4 Reverse -108 -121 -3.81562 0.255
NP_440590.1_4 Forward -115 -102 -5.29059 0.277
NP_440567.1_1 Forward -115 -101 6.58777 0.0816
NP_440567.1_1 Forward -256 -242 6.3911 0.0837
NP_440567.1_1 Reverse -108 -122 5.80112 0.0959
NP_440567.1_1 Reverse -249 -263 5.1128 0.107
NP_442497.1_3 Forward -97 -78 19.0673 0.228
NP_442497.1_10 Forward -115 -106 17.601 0.00813
NP_442497.1_10 Forward -256 -247 10.4228 0.0087
NP_442497.1_10 Reverse -249 -258 10.4228 0.0087
NP_442497.1_10 Reverse -108 -117 10.4228 0.0087
NP_440821.1_4 Forward -259 -249 19.0562 0.00399
NP_440821.1_4 Forward -118 -108 19.0562 0.00399
NP_440821.1_4 Reverse -246 -256 9.41981 0.0286
NP_440821.1_4 Reverse -105 -115 2.24165 0.131
NP_441239.1_9 Reverse -105 -117 15.5753 0.0186
NP_441239.1_9 Forward -259 -247 13.3137 0.037
NP_441239.1_9 Forward -118 -106 13.3137 0.037
NP_441239.1_9 Reverse -246 -258 5.93884 0.202
NP_441951.1_4 Reverse -242 -261 1.96607 0.283
NP_441892.1_1 Forward -266 -249 1.8088 0.147
NP_441892.1_1 Reverse -137 -154 -0.747806 0.191
NP_440604.1_6 Forward -116 -97 7.47261 0.0962
NP_442270.1_9 Forward -268 -249 -8.26035 0.217
NP_441508.1_1 Reverse -291 -310 11.3264 0.247
NP_441508.1_4 Reverse -208 -222 15.7678 0.227
NP_441017.1_6 Forward -261 -247 16.4202 0.0651
NP_440354.1_7 Reverse -101 -119 9.16393 0.229
NP_440354.1_7 Reverse -242 -260 9.0656 0.231
NP_442138.1_10 Reverse -107 -126 9.3409 0.0455
NP_440391.1_7 Reverse -50 -69 14.2566 0.108
NP_440546.1_4 Forward -116 -106 13.5365 0.0459
NP_440546.1_4 Reverse -248 -258 11.8882 0.0679
NP_440546.1_4 Reverse -107 -117 11.8882 0.0679
NP_440546.1_4 Forward -257 -247 10.046 0.109
NP_440546.1_4 Reverse -390 -400 8.88251 0.166
NP_441509.1_1 Forward -27 -8 17.7974 0.105
NP_441230.1_6 Forward -392 -373 11.1109 0.263
NP_440675.1_1 Reverse -245 -264 12.0942 0.177
NP_440462.1_6 Reverse -105 -115 18.7612 0.00454
NP_440462.1_6 Forward -259 -249 15.418 0.0142
NP_440462.1_6 Forward -118 -108 15.418 0.0142
NP_440462.1_6 Reverse -388 -398 4.50326 0.197
NP_440462.1_6 Reverse -246 -256 1.35667 0.294
NP_442611.1_1 Forward -116 -97 4.62101 0.194
NP_440868.1_4 Reverse -103 -115 17.0502 0.0124
NP_440868.1_4 Forward -120 -108 8.49544 0.0602
NP_440868.1_4 Reverse -244 -256 5.84051 0.0879
NP_440868.1_4 Forward -261 -249 1.7106 0.174
NP_441474.1_1 Forward -280 -261 1.76863 0.247
NP_442402.1_4 Reverse -159 -178 9.24175 0.111
NP_442402.1_4 Forward -224 -205 -1.96793 0.195
NP_442402.1_10 Reverse -368 -378 14.0409 0.182
NP_441084.1_6 Reverse -105 -119 10.2167 0.25
NP_440653.1_8 Forward -135 -116 15.2408 0.194
NP_440696.1_3 Forward -372 -354 -4.20908 0.298
NP_441843.2_9 Forward -397 -379 17.2031 0.0976
NP_442882.1_6 Reverse -362 -379 27.1774 0.000691
NP_442039.1_4 Forward -256 -249 15.1821 0.0124
NP_442039.1_4 Reverse -249 -256 15.1821 0.0124
NP_442039.1_4 Forward -115 -108 15.1821 0.0124
NP_442039.1_4 Reverse -108 -115 15.1821 0.0124
NP_442039.1_7 Forward -380 -370 7.94484 0.269
NP_442380.1_5 Forward -119 -100 17.2842 0.153
NP_441926.1_3 Reverse -107 -123 6.84337 0.17
NP_440825.1_7 Forward -256 -246 12.9096 0.152
NP_442837.1_3 Forward -256 -249 15.7721 0.0124
NP_442837.1_3 Reverse -249 -256 15.7721 0.0124
NP_442837.1_3 Forward -115 -108 15.7721 0.0124
NP_442837.1_3 Reverse -108 -115 15.7721 0.0124
NP_440160.1_2 Reverse -50 -69 -4.42544 0.263
NP_442053.1_1 Forward -257 -248 18.3876 0.0007
NP_442053.1_1 Reverse -248 -257 18.3876 0.0007
NP_442053.1_1 Forward -116 -107 18.3876 0.0007
NP_442053.1_1 Reverse -107 -116 18.3876 0.0007
NP_440505.1_3 Reverse -105 -115 17.188 0.00332
NP_440505.1_3 Forward -259 -249 13.8447 0.0247
NP_440505.1_3 Forward -118 -108 13.8447 0.0247
NP_440505.1_3 Reverse -246 -256 9.22315 0.122
NP_440013.1_1 Reverse -191 -210 12.7816 0.179
NP_440914.1_1 Forward -257 -247 17.5935 0.000537
NP_440914.1_1 Forward -116 -106 16.3248 0.00196
NP_440914.1_1 Reverse -248 -258 8.6151 0.186
NP_440914.1_1 Reverse -107 -117 8.6151 0.186
NP_440914.1_1 Reverse -359 -369 8.41992 0.191
NP_440914.1_7 Forward -309 -290 4.72643 0.29
NP_441011.1_8 Reverse -249 -258 16.9127 0.00602
NP_441011.1_8 Reverse -108 -117 16.9127 0.00602
NP_441011.1_8 Forward -115 -106 16.6177 0.00602
NP_441011.1_8 Forward -256 -247 8.25953 0.144
NP_442101.1_10 Reverse -99 -118 -6.39206 0.189
NP_442101.1_10 Reverse -240 -259 -6.68705 0.196
NP_442101.1_10 Reverse -321 -340 -12.3902 0.268
NP_442533.1_6 Forward -257 -248 17.2076 0.00137
NP_442533.1_6 Reverse -248 -257 17.2076 0.00137
NP_442533.1_6 Forward -116 -107 17.2076 0.00137
NP_442533.1_6 Reverse -107 -116 17.2076 0.00137
NP_442541.1_10 Reverse -353 -367 4.42388 0.252
NP_442229.1_1 Reverse -246 -260 8.25877 0.184
NP_441482.1_7 Reverse -101 -115 -2.95034 0.103
NP_441482.1_7 Forward -263 -249 -8.65353 0.193
NP_441482.1_7 Reverse -353 -367 -9.53851 0.206
NP_441482.1_7 Reverse -242 -256 -10.7185 0.213
NP_441482.1_7 Forward -122 -108 -10.9151 0.222
NP_439944.1_9 Forward -256 -246 10.5014 0.0887
NP_439944.1_9 Reverse -249 -259 10.3048 0.0887
NP_439944.1_9 Reverse -108 -118 10.3048 0.0887
NP_439944.1_9 Forward -115 -105 9.12481 0.1
NP_442269.1_10 Forward -373 -354 1.47442 0.291
NP_441028.1_6 Reverse -369 -379 8.04271 0.217
NP_441527.1_4 Reverse -2 -21 0.811258 0.134
NP_441527.1_4 Reverse -4 -23 -10.5523 0.272
NP_441527.1_4 Reverse -3 -22 -11.9847 0.285
NP_441527.1_4 Reverse -292 -311 -12.0802 0.285
NP_440115.1_6 Reverse -104 -114 14.0414 0.0615
NP_440007.1_9 Forward -261 -247 4.03116 0.267
NP_440007.1_9 Reverse -355 -369 3.8345 0.267
NP_441602.1_3 Reverse -380 -399 -5.40875 0.285
NP_441170.1_4 Reverse -239 -257 1.78911 0.297
NP_441106.1_1 Reverse -106 -115 18.486 0.0028
NP_441106.1_1 Forward -258 -249 18.191 0.0028
NP_441106.1_1 Forward -117 -108 18.191 0.0028
NP_441106.1_1 Reverse -247 -256 9.63616 0.0311
NP_439903.1_6 Forward -260 -241 -0.39464 0.282
NP_439903.1_6 Reverse -104 -123 -0.886293 0.287
NP_442588.1_8 Reverse -372 -391 7.27595 0.238
NP_442306.1_10 Reverse -102 -121 -10.7186 0.111
NP_442306.1_10 Forward -262 -243 -18.9784 0.197
NP_441286.1_1 Reverse -247 -259 14.4936 0.00418
NP_441286.1_1 Reverse -106 -118 5.05386 0.0259
NP_441286.1_1 Forward -258 -246 3.38223 0.0467
NP_441286.1_1 Forward -117 -105 -3.59927 0.145
NP_442674.1_3 Reverse -138 -157 8.84842 0.192
NP_440670.1_8 Forward -257 -248 18.3876 0.000699
NP_440670.1_8 Reverse -248 -257 18.3876 0.000699
NP_440670.1_8 Forward -116 -107 18.3876 0.000699
NP_440670.1_8 Reverse -107 -116 18.3876 0.000699
NP_440886.1_7 Forward -258 -248 17.7774 0.0011
NP_440886.1_7 Forward -117 -107 17.7774 0.0011
NP_440886.1_7 Reverse -106 -116 8.04271 0.0805
NP_440886.1_7 Reverse -247 -257 7.94438 0.0805
NP_442614.1_2 Forward -116 -102 10.1277 0.234
NP_439995.1_5 Forward -126 -107 5.89931 0.276
NP_442072.1_9 Reverse -247 -265 -13.9439 0.126
NP_442072.1_9 Forward -117 -99 -20.7287 0.204
NP_442401.1_2 Forward -400 -381 11.3067 0.163
NP_440907.2_8 Forward -115 -105 9.616 0.103
NP_440907.2_8 Reverse -249 -259 7.84605 0.117
NP_440907.2_8 Reverse -108 -118 7.84605 0.117
NP_440907.2_8 Forward -256 -246 7.64939 0.117
NP_440907.2_8 Forward -398 -388 4.01116 0.283
NP_442264.1_5 Forward -368 -354 14.6509 0.222
NP_441021.1_1 Forward -256 -237 -9.047 0.206
NP_440841.1_4 Forward -259 -240 0.294447 0.123
NP_441463.1_2 Forward -21 -3 5.17615 0.173
NP_441463.1_3 Forward -126 -107 -7.67036 0.259
NP_441463.1_3 Reverse -238 -257 -7.96535 0.262
NP_442893.1_4 Forward -313 -294 8.84842 0.125
NP_441626.1_2 Forward -256 -249 15.7721 0.0124
NP_441626.1_2 Reverse -249 -256 15.7721 0.0124
NP_441626.1_2 Forward -115 -108 15.7721 0.0124
NP_441626.1_2 Reverse -108 -115 15.7721 0.0124
NP_442365.1_7 Reverse -103 -122 -3.04881 0.21
NP_442794.1_1 Reverse -244 -256 9.38042 0.0795
NP_442615.1_1 Reverse -239 -257 15.6538 0.00922
NP_442615.1_1 Forward -125 -107 3.55906 0.0536
NP_442615.1_1 Reverse -98 -116 -0.374176 0.115
NP_441962.1_4 Reverse -243 -262 -10.7186 0.232
NP_440387.1_1 Forward -257 -241 14.3165 0.00649
NP_440387.1_1 Reverse -107 -123 7.82668 0.0282
NP_440387.1_1 Forward -116 -100 5.07341 0.0353
NP_440387.1_1 Reverse -248 -264 -0.43312 0.138
NP_441431.1_2 Forward -260 -246 9.24208 0.19
NP_441431.1_2 Reverse -104 -118 7.27547 0.244
NP_441993.1_1 Reverse -242 -261 0.484826 0.298
NP_440114.1_10 Reverse -107 -121 15.7325 0.0234
NP_440114.1_10 Forward -116 -102 9.73436 0.164
NP_440114.1_10 Forward -257 -243 7.9644 0.219
NP_440114.1_10 Reverse -248 -262 5.70279 0.296
NP_441510.2_7 Forward -122 -108 12.3887 0.28
NP_440287.1_5 Reverse -367 -386 13.175 0.206
NP_440293.1_9 Forward -367 -353 10.9577 0.261
NP_440766.1_4 Forward -261 -247 8.55439 0.0871
NP_441237.1_9 Forward -256 -246 14.828 0.0242
NP_441237.1_9 Forward -154 -144 9.7148 0.272
NP_442743.1_5 Reverse -249 -268 10.5209 0.144
NP_441311.1_2 Reverse -101 -115 13.8636 0.229
NP_439910.1_2 Forward -124 -107 -11.7609 0.0788
NP_439910.1_2 Forward -265 -248 -11.8592 0.0788
NP_439910.1_2 Reverse -307 -324 -22.6756 0.285
NP_442867.1_8 Forward -389 -370 11.1109 0.206
NP_440457.1_1 Forward -261 -249 7.02048 0.105
NP_440457.1_1 Reverse -266 -278 1.61227 0.232
NP_440457.1_1 Reverse -103 -115 0.628964 0.25
NP_440457.1_1 Forward -120 -108 0.0389777 0.25
NP_440798.1_6 Forward -115 -102 2.08423 0.186
NP_440801.1_8 Forward -258 -239 5.50599 0.192
NP_441984.1_6 Reverse -376 -388 14.9853 0.219
NP_440473.1_1 Reverse -104 -123 13.6676 0.187
NP_440473.1_9 Forward -127 -108 -9.24366 0.26
NP_442509.1_9 Reverse -248 -258 16.2041 0.00739
NP_442509.1_9 Reverse -107 -117 16.2041 0.00739
NP_442509.1_9 Forward -257 -247 8.14104 0.192
NP_442509.1_9 Forward -116 -106 8.04271 0.192
NP_441489.1_3 Reverse -296 -310 16.0543 0.172
NP_441253.1_1 Reverse -98 -117 4.22769 0.29
NP_440524.1_2 Reverse -250 -269 7.37428 0.158
NP_440524.1_2 Reverse -173 -192 -4.52377 0.276
NP_442936.1_10 Forward -29 -15 7.15838 0.291
NP_440734.1_9 Forward -140 -121 9.73422 0.282
NP_441159.1_8 Forward -24 -5 2.06362 0.236
NP_440554.1_4 Forward -115 -105 17.9746 0.0131
NP_440554.1_4 Reverse -249 -259 14.6313 0.02
NP_440554.1_4 Reverse -108 -118 14.6313 0.02
NP_440554.1_4 Forward -248 -238 1.74999 0.29
NP_441845.1_6 Forward -269 -251 6.60732 0.167
NP_441885.1_5 Forward -257 -247 20.9245 0.000538
NP_441885.1_5 Reverse -248 -258 11.4848 0.00668
NP_441885.1_5 Reverse -107 -117 11.4848 0.00668
NP_441885.1_5 Forward -116 -106 11.3864 0.00668
NP_440478.1_10 Forward -118 -104 6.3911 0.291
NP_442341.1_7 Reverse -247 -261 19.7641 0.00702
NP_442341.1_7 Forward -258 -244 7.66941 0.0994
NP_442341.1_7 Reverse -106 -120 1.57289 0.286
NP_442341.1_9 Reverse -105 -119 11.7987 0.118
NP_442341.1_9 Forward -259 -245 7.07881 0.204
NP_442341.1_9 Forward -118 -104 5.50552 0.267
NP_441173.1_9 Reverse -370 -378 11.3271 0.226
NP_441173.1_9 Reverse -369 -377 11.3271 0.226
NP_441173.1_9 Forward -214 -206 11.0321 0.228
NP_441173.1_9 Reverse -205 -213 11.0321 0.228
NP_443000.1_7 Reverse -105 -115 20.3345 0.00223
NP_443000.1_7 Reverse -246 -256 10.3048 0.0345
NP_443000.1_7 Forward -259 -249 8.73149 0.0437
NP_443000.1_7 Forward -118 -108 8.73149 0.0437
NP_440507.2_3 Reverse -239 -258 10.7167 0.202
NP_441842.1_10 Forward -123 -109 12.1926 0.107
NP_441842.1_10 Reverse -241 -255 10.9143 0.148
NP_442122.1_9 Reverse -240 -259 17.3057 0.207
NP_440275.1_3 Reverse -105 -115 16.1063 0.0155
NP_440275.1_3 Forward -259 -249 8.4365 0.0602
NP_440275.1_3 Forward -118 -108 8.4365 0.0602
NP_440275.1_3 Reverse -246 -256 8.04317 0.0602
NP_440091.1_1 Forward -120 -108 18.3285 0.0114
NP_440091.1_1 Forward -261 -249 10.7571 0.0429
NP_440091.1_1 Reverse -244 -256 -0.452677 0.273
NP_440679.1_10 Reverse -263 -282 -14.7502 0.245
NP_442451.1_2 Forward -265 -246 -4.72043 0.213
NP_442234.1_7 Reverse -356 -375 10.9142 0.246
NP_442495.1_4 Forward -112 -102 12.3697 0.229
NP_440149.1_8 Forward -257 -238 4.42435 0.0825
NP_440149.1_8 Reverse -248 -267 0.294447 0.14
NP_441105.1_3 Reverse -237 -256 -3.54046 0.181
NP_442373.1_6 Forward -95 -76 17.3057 0.146
NP_440216.1_1 Forward -116 -102 17.1092 0.00188
NP_440216.1_1 Reverse -107 -121 6.29277 0.0156
NP_440216.1_1 Reverse -248 -262 -1.47537 0.0328
NP_440216.1_1 Forward -257 -243 -2.75368 0.0574
NP_440216.1_9 Reverse -355 -364 8.25953 0.286
NP_440216.1_9 Forward -128 -119 5.3096 0.298
NP_440172.1_1 Forward -116 -106 17.5813 0.00421
NP_440172.1_1 Forward -257 -247 15.0247 0.00945
NP_440172.1_1 Reverse -248 -258 8.73149 0.0586
NP_440172.1_1 Reverse -107 -117 8.73149 0.0586
NP_442015.1_10 Forward -261 -248 10.639 0.0391
NP_442015.1_10 Reverse -103 -116 3.65753 0.178
NP_442015.1_10 Reverse -244 -257 1.49425 0.204
NP_442015.1_10 Forward -120 -107 0.904263 0.216
NP_441226.1_7 Forward -256 -249 14.4934 0.0123
NP_441226.1_7 Reverse -249 -256 14.4934 0.0123
NP_441226.1_7 Forward -115 -108 14.4934 0.0123
NP_441226.1_7 Reverse -108 -115 14.4934 0.0123
NP_441226.1_7 Forward -398 -391 6.82361 0.246
NP_441757.1_3 Forward -258 -239 -1.18052 0.245
NP_441111.1_7 Forward -256 -248 18.7023 0.00294
NP_441111.1_7 Forward -115 -107 18.7023 0.00294
NP_441111.1_7 Reverse -249 -257 18.7023 0.00294
NP_441111.1_7 Reverse -108 -116 18.7023 0.00294
NP_442379.1_10 Reverse -100 -117 -0.157821 0.223
NP_442379.1_10 Reverse -357 -374 -3.30441 0.256
NP_441766.1_2 Forward -257 -248 17.5026 0.00297
NP_441766.1_2 Reverse -248 -257 17.5026 0.00297
NP_441766.1_2 Forward -116 -107 17.5026 0.00297
NP_441766.1_2 Reverse -107 -116 17.5026 0.00297
NP_442417.1_5 Forward -116 -102 4.62115 0.292
NP_442252.1_3 Forward -123 -105 9.0656 0.244
NP_440416.1_9 Forward -123 -104 -13.6686 0.169
NP_440416.1_9 Reverse -100 -119 -16.1268 0.208
NP_440416.1_9 Reverse -241 -260 -17.1101 0.231
NP_440416.1_9 Forward -280 -261 -19.6667 0.276
NP_443052.1_8 Forward -126 -107 5.80098 0.0348
NP_443052.1_8 Reverse -238 -257 -11.4069 0.229
NP_440591.1_9 Forward -123 -105 8.47561 0.18
NP_440261.1_5 Forward -115 -102 16.1456 0.0132
NP_440261.1_5 Reverse -249 -262 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCCGATCCGTTCCTCGCCAAATTGGGGGAAATGGGTTTGCCCTGGCACGAAGTAGTCAACGGCCCTTTTCCTTTTGACGATTAGTGATTAGTTTTTAACTCAATTTTTAATGACTTCTGACCCCATTACCCTCCTCGTCAACGGCGATCGCCAAATCGCTTCTAGTCCAGTTACATTGCCGGATTTTTTGCAAAATCAAGGGTTTAACCTCCGCTTAATTGCGGTGGAATACAACGGTGAAATTCTCCATCGACAATTTTGGCCGGAAACCCAATTGCAAAACGGCGATCGCCTGGAGGTAGTTACCATTGTGGGAGGCGGCTAGCTTTTAATGGGGAGTGGTATAGCACCGCCTAGAATGGTTCTTAGCCCCAAATTTTTTTTGTAAGCACTTTTTCT

CDS

GTGGAAATTACTTTTCTTGGTACCAGCTCCGGCGTTCCCACCCGTAACCGCAATGTTTCCAGCATTGCCCTCCGTTTACCCCAAAGGGCGGAATTGTGGTTATTTGATTGCGGAGAAGGCACCCAACACCAGTTTTTGCGCAGTGAAGTCAAAATTTCCCAATTGACCCGCATTTTCATTACCCATCTCCACGGCGACCACATTTTTGGGCTGATGGGTTTATTGGCTAGCTCCGGTTTAGCTGGCTCCGGTCAAGGTATTGAAATTTATGGCCCAGAGGGCTTGGGGGATTATTTAGAAGCCTGTTGCCGTTTTTCTAGTACCCACCTGGGCAAACGCCTCAAAGTTCACACTGTCCGAGAAAATGGGCTAATTTACGAAGATAAGGATTTTCAAGTCCACTGCGGTTTACTAAAACATCGCATTCCGGCCTATGGGTATCGAGTGGAGGAAAAGCAACGGCCAGGGCGTTTCAATGTGGAGCAAGCGGAAGCTTTGGGCATTCCCTTTGGTCCTATTTACGGCCAGTTAAAACAGGGAAAAACCGTCACCCTGGAAGATGGTCGCCGAATTCGAGGTCAGGACCTCTGTGAACCACCGGAACCGGGCCGGAAATTTGTTTACTGTACTGATACGGTCTTTTGTGAAGAGGCGATCGCCTTGGCCCAGGAAGCAGATTTGCTGGTACATGAAGCCACTTTTGCCCATCAGGATGCCCAGCTAGCCTTTGACCGGCTCCATTCCACTTCCACCATGGCAGCCCAGGTAGCTTTGTTGGCCAATGTCAAGCAGTTAATCATGACCCATTTCAGCCCCCGCTATGCCCCCGGCAATCCCCTGCAACTGGAAAATCTACTGGCGGAAGCCCAAGCTATTTTTCCCAATACCCGTTTGGCTAGGGATTTTTTAACGGTGGAAATTCCTCGCCGCACAGCCGATCCTGCCATCGCAATGTCAACCCCTCAGGCATCCCCTGCATAG

Protein

MEITFLGTSSGVPTRNRNVSSIALRLPQRAELWLFDCGEGTQHQFLRSEVKISQLTRIFITHLHGDHIFGLMGLLASSGLAGSGQGIEIYGPEGLGDYLEACCRFSSTHLGKRLKVHTVRENGLIYEDKDFQVHCGLLKHRIPAYGYRVEEKQRPGRFNVEQAEALGIPFGPIYGQLKQGKTVTLEDGRRIRGQDLCEPPEPGRKFVYCTDTVFCEEAIALAQEADLLVHEATFAHQDAQLAFDRLHSTSTMAAQVALLANVKQLIMTHFSPRYAPGNPLQLENLLAEAQAIFPNTRLARDFLTVEIPRRTADPAIAMSTPQASPA