Your browser is old and dusty. Try Google Chrome!

Details for slr0033

ORF slr0033
Accession NP_442722.1
Symbol
Category Aminoacyl tRNA synthetases and tRNA modification
Definition glutamyl-tRNA(Gln) amidotransferase subunit C
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -156 -170 -1.8687 0.274
NP_440795.1_7 Forward -163 -156 14.6904 0.0123
NP_440795.1_7 Reverse -156 -163 14.6904 0.0123
NP_440795.1_7 Forward -122 -115 9.77388 0.169
NP_441418.1_6 Reverse -155 -174 -3.93378 0.0254
NP_441418.1_6 Forward -246 -227 -30.1882 0.262
NP_442291.1_5 Forward -165 -149 -0.138127 0.179
NP_440897.1_6 Forward -164 -145 0.392004 0.18
NP_440897.1_6 Reverse -155 -174 -3.34455 0.241
NP_441453.1_1 Forward -171 -153 13.6864 0.0938
NP_441453.1_1 Reverse -113 -131 4.14829 0.263
NP_441453.1_4 Reverse -155 -163 16.539 0.00633
NP_441453.1_4 Forward -164 -156 16.539 0.00633
NP_441623.1_1 Reverse -165 -183 -1.94747 0.241
NP_441960.1_2 Reverse -193 -212 14.3558 0.298
NP_442838.1_7 Forward -169 -150 -10.6203 0.232
NP_441818.1_1 Forward -163 -152 13.8245 0.0623
NP_440226.1_1 Reverse -155 -174 10.1275 0.0654
NP_441630.1_3 Reverse -147 -166 -1.08219 0.291
NP_442623.1_3 Forward -131 -112 -18.1918 0.263
NP_440150.1_6 Reverse -152 -171 4.81767 0.232
NP_440150.1_6 Forward -167 -148 2.3594 0.273
NP_440996.1_2 Reverse -50 -59 15.241 0.248
NP_442655.1_10 Reverse -195 -214 -11.4069 0.249
NP_442173.1_1 Forward -163 -155 15.4574 0.00633
NP_442173.1_1 Reverse -156 -164 15.4574 0.00633
NP_442752.1_4 Forward -164 -157 13.8055 0.0199
NP_442752.1_4 Reverse -155 -162 13.8055 0.0199
NP_443027.1_4 Forward -166 -156 13.943 0.0452
NP_441812.1_3 Forward -400 -386 8.16106 0.254
NP_442975.1_10 Forward -168 -154 3.63724 0.252
NP_440784.1_7 Forward -163 -156 15.9687 0.0123
NP_440784.1_7 Reverse -156 -163 15.9687 0.0123
NP_440061.1_9 Forward -166 -152 10.717 0.123
NP_440061.1_9 Forward -290 -276 9.73373 0.14
NP_440061.1_9 Forward -277 -263 9.73373 0.14
NP_440061.1_9 Reverse -153 -167 5.99717 0.264
NP_440110.1_8 Reverse -153 -172 9.43923 0.0906
NP_441476.1_5 Forward -212 -193 -7.57203 0.29
NP_439979.1_9 Forward -131 -113 7.39397 0.288
NP_442062.1_8 Reverse -155 -165 19.4496 0.000558
NP_442062.1_8 Forward -164 -154 17.6796 0.00193
NP_442062.1_8 Reverse -266 -276 6.17489 0.136
NP_441802.1_1 Reverse -353 -372 4.62101 0.291
NP_440304.1_4 Forward -166 -156 9.91146 0.051
NP_440304.1_4 Reverse -153 -163 9.91146 0.051
NP_440304.1_4 Reverse -264 -274 6.8632 0.144
NP_442242.1_4 Forward -163 -156 14.3954 0.0124
NP_442242.1_4 Reverse -156 -163 14.3954 0.0124
NP_442981.1_7 Reverse -327 -346 6.09597 0.263
NP_441581.1_6 Forward -173 -154 10.2621 0.284
NP_441581.1_6 Forward -284 -265 9.77726 0.291
NP_441935.1_1 Reverse -156 -175 10.2259 0.211
NP_441208.1_9 Reverse -198 -212 13.6676 0.103
NP_441594.1_6 Forward -213 -194 -0.295539 0.298
NP_442276.1_2 Reverse -339 -358 3.14605 0.299
NP_442726.1_4 Reverse -350 -369 5.01433 0.269
NP_441925.1_4 Forward -282 -263 -16.3242 0.282
NP_440856.1_7 Forward -132 -113 -8.752 0.278
NP_441083.1_5 Forward -164 -154 19.3512 0.000718
NP_441083.1_5 Reverse -155 -165 11.3864 0.0159
NP_442827.1_8 Forward -172 -153 7.37347 0.0965
NP_441434.1_7 Forward -162 -148 1.67122 0.299
NP_441738.1_2 Forward -162 -155 15.28 0.0102
NP_441738.1_2 Reverse -157 -164 15.28 0.0102
NP_441558.1_5 Reverse -153 -172 11.2092 0.0852
NP_440209.1_1 Reverse -155 -163 18.1123 0.00295
NP_440209.1_1 Forward -164 -156 18.1123 0.00295
NP_442889.1_1 Reverse -338 -357 -10.4236 0.217
NP_442889.1_8 Forward -270 -256 4.91554 0.247
NP_441713.1_1 Reverse -350 -369 -12.4886 0.245
NP_441713.1_1 Forward -170 -151 -16.8151 0.286
NP_440178.1_7 Reverse -154 -173 -20.65 0.196
NP_442570.1_3 Forward -172 -153 -9.53865 0.299
NP_441716.1_1 Reverse -155 -169 13.8643 0.0689
NP_441716.1_1 Forward -164 -150 6.09611 0.207
NP_442111.1_4 Reverse -154 -168 15.0442 0.0251
NP_442111.1_4 Forward -165 -151 2.94952 0.259
NP_441163.1_1 Forward -172 -155 6.0363 0.267
NP_441163.1_1 Reverse -271 -288 5.24966 0.277
NP_440906.1_5 Forward -163 -156 15.8704 0.0124
NP_440906.1_5 Reverse -156 -163 15.8704 0.0124
NP_440747.1_10 Reverse -152 -164 7.31547 0.00577
NP_440747.1_10 Forward -167 -155 -2.02597 0.0196
NP_441130.1_7 Reverse -106 -120 17.1085 0.287
NP_441130.1_10 Reverse -153 -167 16.1259 0.0261
NP_441130.1_10 Reverse -264 -278 13.1759 0.0742
NP_441130.1_10 Forward -166 -152 11.8976 0.104
NP_441486.1_1 Forward -167 -153 5.21113 0.0384
NP_441486.1_1 Reverse -234 -248 -6.29359 0.288
NP_442634.1_2 Forward -170 -151 8.25926 0.159
NP_442634.1_4 Reverse -153 -167 4.52282 0.0764
NP_441265.1_3 Forward -170 -156 5.99778 0.181
NP_440403.1_4 Forward -173 -154 -6.29373 0.23
NP_441014.1_8 Forward -280 -261 8.06259 0.158
NP_441014.1_8 Forward -281 -262 -1.96717 0.228
NP_442848.1_1 Forward -189 -175 -3.147 0.263
NP_442848.1_1 Forward -170 -156 -3.73699 0.27
NP_442848.1_5 Forward -282 -264 -2.83245 0.286
NP_442848.1_9 Reverse -149 -168 -1.57384 0.293
NP_443018.1_3 Forward -163 -156 14.8871 0.0123
NP_443018.1_3 Reverse -156 -163 14.8871 0.0123
NP_443018.1_3 Forward -266 -259 8.20058 0.153
NP_443018.1_3 Reverse -267 -274 4.26735 0.267
NP_443018.1_3 Forward -274 -267 4.16902 0.278
NP_441634.1_8 Reverse -153 -167 15.8309 0.0248
NP_440376.1_1 Forward -164 -155 19.4693 0.000692
NP_440376.1_1 Reverse -155 -164 19.4693 0.000692
NP_440376.1_1 Reverse -266 -275 4.62128 0.154
NP_441857.1_6 Forward -295 -285 15.0247 0.215
NP_440794.1_7 Reverse -154 -171 10.6586 0.249
NP_442687.1_7 Reverse -154 -164 18.5646 0.0028
NP_442687.1_7 Forward -165 -155 15.8113 0.0125
NP_442687.1_7 Reverse -113 -123 7.25653 0.136
NP_442687.1_7 Reverse -236 -246 4.60159 0.243
NP_442191.1_4 Reverse -156 -170 13.7079 0.132
NP_441077.1_2 Reverse -63 -82 3.29405 0.251
NP_442485.1_3 Reverse -153 -172 -3.14714 0.272
NP_440042.1_2 Reverse -145 -164 7.57094 0.184
NP_441422.1_7 Reverse -153 -170 -4.68105 0.247
NP_441950.1_7 Reverse -261 -280 -6.88371 0.274
NP_440360.1_1 Reverse -346 -364 15.063 0.295
NP_440360.1_10 Forward -273 -259 3.44117 0.232
NP_442658.1_1 Forward -166 -156 18.7607 0.00222
NP_442658.1_1 Reverse -153 -163 16.0075 0.00966
NP_442658.1_1 Reverse -264 -274 7.45273 0.214
NP_440141.1_8 Reverse -257 -276 4.22769 0.292
NP_442496.1_5 Forward -376 -358 6.214 0.284
NP_440656.1_2 Forward -66 -47 -0.295539 0.258
NP_441414.1_9 Forward -164 -145 -1.86883 0.106
NP_441414.1_9 Reverse -155 -174 -5.21209 0.171
NP_440607.1_8 Forward -134 -115 8.94757 0.153
NP_441487.1_9 Forward -165 -146 -2.0655 0.292
NP_442937.1_5 Reverse -267 -286 7.37428 0.254
NP_442937.1_5 Forward -251 -232 6.4893 0.278
NP_441958.1_5 Reverse -154 -164 20.5312 0.000966
NP_441958.1_5 Forward -165 -155 12.2714 0.00183
NP_442836.1_10 Forward -295 -285 9.81313 0.269
NP_439905.1_1 Reverse -156 -169 9.85238 0.216
NP_440995.1_8 Forward -174 -155 1.0811 0.264
NP_440984.1_7 Reverse -150 -164 7.57108 0.166
NP_442911.1_2 Forward -174 -155 1.27776 0.0601
NP_440153.1_5 Reverse -156 -170 4.22782 0.199
NP_441591.1_10 Reverse -153 -172 19.5673 0.0411
NP_442119.1_9 Forward -165 -146 13.2741 0.245
NP_443055.1_6 Reverse -147 -165 6.99988 0.164
NP_443055.1_6 Reverse -258 -276 4.83661 0.181
NP_443055.1_6 Reverse -360 -378 -2.43985 0.295
NP_443055.1_6 Forward -164 -146 -2.63651 0.298
NP_440993.1_2 Reverse -150 -166 2.22182 0.269
NP_441099.1_5 Reverse -145 -164 -10.0303 0.24
NP_442002.1_9 Reverse -154 -161 14.1004 0.074
NP_442002.1_9 Forward -371 -364 11.1505 0.185
NP_442002.1_9 Forward -165 -158 10.7572 0.185
NP_442002.1_9 Reverse -236 -243 9.08556 0.289
NP_441294.1_7 Forward -168 -154 16.0658 0.0176
NP_441646.1_1 Reverse -148 -167 -1.37718 0.284
NP_442438.1_10 Forward -169 -155 14.3559 0.0311
NP_442431.1_10 Reverse -34 -52 -0.177514 0.286
NP_441000.1_6 Reverse -154 -168 13.8643 0.0396
NP_441000.1_6 Forward -165 -151 4.42448 0.0953
NP_441000.1_6 Reverse -265 -279 -3.93365 0.225
NP_442771.1_1 Reverse -153 -171 -4.70074 0.166
NP_440147.1_4 Reverse -153 -166 18.7022 0.00398
NP_440147.1_4 Forward -166 -153 11.3273 0.0326
NP_440147.1_4 Forward -355 -342 0.510939 0.252
NP_441550.1_8 Reverse -153 -163 18.1707 0.00754
NP_441550.1_8 Forward -166 -156 10.501 0.066
NP_441550.1_8 Reverse -264 -274 5.38779 0.252
NP_441916.1_7 Reverse -155 -165 18.4663 0.00144
NP_441916.1_7 Forward -164 -154 16.893 0.00407
NP_441916.1_10 Reverse -271 -290 1.37609 0.264
NP_441041.1_7 Reverse -152 -164 10.8188 0.0864
NP_441041.1_7 Forward -167 -155 10.2357 0.1
NP_441725.1_4 Reverse -150 -164 9.04542 0.178
NP_441725.1_5 Forward -163 -153 11.7798 0.0247
NP_441725.1_5 Reverse -156 -166 9.02648 0.0553
NP_441725.1_5 Forward -274 -264 6.76487 0.11
NP_439966.1_7 Forward -166 -156 17.4824 0.00636
NP_439966.1_7 Reverse -153 -163 8.63269 0.132
NP_439966.1_9 Forward -166 -157 10.7178 0.0863
NP_442941.1_3 Forward -163 -153 10.6981 0.0116
NP_442941.1_3 Reverse -156 -166 2.53664 0.14
NP_442941.1_3 Forward -329 -319 2.04498 0.146
NP_440289.1_2 Forward -167 -154 13.0973 0.0132
NP_440289.1_2 Reverse -152 -165 5.72248 0.0616
NP_440289.1_2 Forward -278 -265 -4.79893 0.294
NP_442281.1_1 Reverse -150 -164 12.2903 0.0385
NP_441334.1_7 Reverse -153 -172 -11.4069 0.122
NP_440437.1_1 Forward -281 -262 -3.14714 0.232
NP_442012.1_1 Forward -170 -151 -0.295539 0.255
NP_441556.1_7 Forward -175 -156 4.71854 0.24
NP_441644.1_6 Forward -164 -154 15.7125 0.0048
NP_441644.1_6 Reverse -155 -165 10.1076 0.0628
NP_442215.1_2 Reverse -156 -172 2.41848 0.116
NP_442215.1_2 Reverse -121 -137 -6.62797 0.277
NP_442029.1_6 Forward -293 -274 6.68596 0.234
NP_442029.1_6 Forward -132 -113 3.93269 0.274
NP_442247.1_8 Reverse -153 -167 10.0294 0.247
NP_440253.1_2 Reverse -155 -173 -3.02911 0.284
NP_440253.1_2 Forward -164 -146 -3.52077 0.294
NP_440929.1_8 Forward -164 -155 19.2726 0.000701
NP_440929.1_8 Reverse -155 -164 19.2726 0.000701
NP_440929.1_8 Forward -275 -266 4.81794 0.176
NP_442933.1_10 Forward -164 -155 17.601 0.00325
NP_442933.1_10 Reverse -155 -164 17.601 0.00325
NP_441751.2_8 Reverse -156 -170 -3.24533 0.137
NP_441751.2_8 Forward -163 -149 -3.73699 0.154
NP_442554.1_8 Reverse -156 -166 16.008 0.0065
NP_442554.1_8 Forward -163 -153 15.123 0.00944
NP_442554.1_8 Forward -274 -264 6.46988 0.117
NP_441762.1_7 Reverse -154 -166 20.9835 0.00342
NP_441762.1_7 Forward -165 -153 2.30059 0.0676
NP_441762.1_7 Forward -124 -112 -5.76255 0.238
NP_442142.1_4 Reverse -152 -165 6.50855 0.163
NP_442292.1_1 Reverse -156 -165 9.63616 0.0183
NP_442292.1_1 Forward -163 -154 9.53783 0.0183
NP_442476.1_6 Forward -163 -149 8.65272 0.0982
NP_442476.1_6 Reverse -156 -170 5.21113 0.139
NP_442381.1_8 Forward -167 -148 14.4541 0.0192
NP_442381.1_8 Forward -278 -259 -14.9469 0.29
NP_443009.1_5 Reverse -154 -165 20.6093 0.001
NP_443009.1_5 Forward -165 -154 9.10461 0.0965
NP_443009.1_5 Forward -247 -236 7.72798 0.122
NP_443009.1_5 Forward -288 -277 5.07306 0.218
NP_443009.1_5 Reverse -320 -331 3.40144 0.296
NP_441715.1_4 Forward -163 -153 9.81313 0.097
NP_441715.1_4 Reverse -156 -166 9.32148 0.097
NP_441715.1_4 Forward -329 -319 4.40493 0.281
NP_440015.1_9 Reverse -155 -173 -2.0458 0.299
NP_440730.1_4 Reverse -265 -284 -0.4922 0.269
NP_440183.1_9 Reverse -346 -365 -16.1268 0.276
NP_441198.1_1 Forward -281 -262 2.3594 0.235
NP_440379.1_5 Reverse -155 -174 -10.7186 0.283
NP_441468.1_1 Forward -163 -156 15.8704 0.0124
NP_441468.1_1 Reverse -156 -163 15.8704 0.0124
NP_441468.1_1 Reverse -267 -274 4.36568 0.237
NP_439939.1_5 Forward -280 -261 21.6323 0.116
NP_441020.2_6 Forward -166 -149 11.1502 0.127
NP_441015.1_10 Reverse -339 -358 -2.85214 0.183
NP_441015.1_10 Forward -347 -328 -5.99873 0.239
NP_441673.1_1 Forward -164 -155 20.8459 0.000698
NP_441673.1_1 Reverse -155 -164 20.8459 0.000698
NP_442253.1_5 Reverse -276 -293 0.432165 0.203
NP_441876.1_9 Forward -361 -351 13.1559 0.267
NP_441826.1_2 Forward -170 -156 1.08123 0.164
NP_441637.1_8 Reverse -32 -49 10.5603 0.261
NP_442490.1_9 Reverse -108 -127 -6.98204 0.275
NP_442490.1_10 Reverse -154 -172 9.95058 0.234
NP_441764.1_8 Forward -149 -139 16.2873 0.284
NP_442868.1_6 Reverse -153 -163 18.5646 0.0104
NP_442868.1_6 Forward -166 -156 8.53483 0.0555
NP_442719.1_2 Forward -188 -170 -1.55487 0.175
NP_442427.1_8 Reverse -146 -165 6.78429 0.23
NP_442808.1_1 Forward -165 -155 18.4657 0.00201
NP_442808.1_1 Reverse -154 -164 8.73102 0.0481
NP_442808.1_1 Forward -276 -266 5.97777 0.134
NP_442808.1_1 Forward -108 -98 2.73286 0.256
NP_441101.1_10 Reverse -151 -170 2.3594 0.173
NP_442542.1_2 Forward -166 -153 18.8988 0.0196
NP_442542.1_9 Forward -171 -157 4.91554 0.28
NP_442050.1_5 Reverse -153 -163 13.6475 0.0295
NP_442050.1_5 Forward -166 -156 8.23937 0.234
NP_441114.1_3 Reverse -280 -289 7.37455 0.239
NP_440558.1_2 Reverse -206 -225 -5.40875 0.258
NP_441878.1_6 Reverse -154 -164 20.2362 0.0046
NP_441878.1_6 Forward -165 -155 10.4031 0.0176
NP_441878.1_6 Reverse -265 -275 2.53664 0.0363
NP_441036.1_8 Forward -165 -155 17.7779 0.000554
NP_441036.1_8 Reverse -154 -164 8.4365 0.174
NP_441557.1_5 Forward -164 -155 19.9609 0.000699
NP_441557.1_5 Reverse -155 -164 19.9609 0.000699
NP_441445.1_1 Forward -173 -154 18.0924 0.0287
NP_441445.1_1 Forward -255 -236 -0.590531 0.297
NP_442066.2_4 Reverse -155 -174 -9.047 0.296
NP_442419.1_2 Forward -280 -261 -2.36049 0.247
NP_441308.1_8 Forward -166 -156 9.22315 0.226
NP_440101.1_3 Forward -358 -339 5.99764 0.187
NP_441458.1_10 Reverse -111 -130 4.42435 0.23
NP_442183.1_1 Forward -164 -150 10.0294 0.0903
NP_441574.1_1 Reverse -254 -273 -7.27704 0.286
NP_441549.1_9 Reverse -151 -169 -8.43732 0.228
NP_442347.1_2 Reverse -156 -165 11.1111 0.056
NP_442347.1_2 Forward -163 -154 3.34298 0.284
NP_441597.1_5 Forward -361 -342 17.699 0.252
NP_442645.1_2 Reverse -336 -355 -17.1101 0.248
NP_442645.1_2 Forward -254 -235 -18.0934 0.269
NP_442965.1_1 Reverse -280 -299 20.354 0.0154
NP_442888.1_9 Reverse -285 -304 18.6823 0.166
NP_441037.1_4 Forward -166 -156 16.2838 0.0168
NP_441037.1_4 Reverse -153 -163 9.55921 0.21
NP_441037.1_4 Reverse -264 -274 8.09735 0.237
NP_441633.1_3 Reverse -153 -166 13.3923 0.018
NP_441633.1_3 Forward -277 -264 8.08242 0.0398
NP_441633.1_3 Forward -166 -153 5.72248 0.0481
NP_440136.1_2 Forward -163 -156 15.9687 0.0123
NP_440136.1_2 Reverse -156 -163 15.9687 0.0123
NP_442998.1_2 Reverse -118 -137 4.81688 0.259
NP_442998.1_5 Forward -372 -362 15.2213 0.149
NP_442998.1_10 Forward -162 -155 15.5754 0.0102
NP_442998.1_10 Reverse -157 -164 15.5754 0.0102
NP_440299.1_1 Forward -168 -155 13.5883 0.0298
NP_440299.1_1 Reverse -151 -164 7.78685 0.105
NP_441799.1_1 Reverse -151 -165 14.8469 0.0221
NP_441799.1_1 Forward -168 -154 7.47213 0.141
NP_441799.1_9 Reverse -154 -173 0.786102 0.213
NP_441007.1_10 Reverse -261 -274 1.29759 0.203
NP_441007.1_10 Reverse -150 -163 -0.865694 0.295
NP_440256.1_1 Reverse -341 -360 -3.63879 0.137
NP_440256.1_1 Reverse -152 -171 -5.80207 0.193
NP_441559.1_8 Forward -169 -155 9.73436 0.0625
NP_441559.1_8 Reverse -232 -246 -4.4253 0.223
NP_441559.1_8 Forward -358 -344 -5.60527 0.267
NP_441559.1_8 Reverse -316 -330 -5.9986 0.271
NP_440915.1_6 Forward -168 -154 12.4876 0.0208
NP_440915.1_6 Reverse -151 -165 2.65453 0.113
NP_442866.1_1 Forward -169 -150 -9.14533 0.29
NP_441464.1_8 Reverse -155 -169 8.55439 0.194
NP_441464.1_8 Forward -164 -150 7.17775 0.217
NP_440787.1_5 Reverse -52 -66 11.111 0.256
NP_440677.1_1 Reverse -228 -247 23.7955 0.0158
NP_442386.1_9 Forward -165 -156 15.7322 0.0144
NP_442386.1_9 Forward -108 -99 11.3073 0.0971
NP_442386.1_9 Forward -276 -267 10.914 0.111
NP_442386.1_9 Reverse -154 -163 6.39082 0.219
NP_442054.1_4 Forward -317 -298 6.58763 0.299
NP_441750.1_4 Forward -279 -260 4.42435 0.214
NP_441340.1_5 Forward -163 -156 15.6737 0.0124
NP_441340.1_5 Reverse -156 -163 15.6737 0.0124
NP_441340.1_5 Forward -274 -267 4.07068 0.239
NP_441340.1_9 Reverse -48 -58 9.12288 0.236
NP_442791.1_5 Forward -172 -153 1.47442 0.21
NP_442240.1_1 Forward -283 -264 5.30853 0.264
NP_440161.1_3 Forward -166 -147 17.3057 0.0726
NP_440161.1_3 Forward -94 -75 10.9142 0.221
NP_440586.1_8 Forward -163 -156 13.2151 0.026
NP_440586.1_8 Reverse -156 -163 13.2151 0.026
NP_440586.1_8 Forward -266 -259 9.08521 0.178
NP_440586.1_8 Forward -274 -267 7.70858 0.227
NP_442251.1_6 Forward -163 -156 15.2804 0.0124
NP_442251.1_6 Reverse -156 -163 15.2804 0.0124
NP_440192.1_4 Reverse -153 -172 11.241 0.217
NP_441262.1_3 Reverse -155 -162 14.7888 0.0223
NP_441262.1_3 Forward -164 -157 14.7888 0.0223
NP_440027.1_3 Reverse -155 -173 4.04996 0.262
NP_440027.1_3 Forward -174 -156 3.06666 0.28
NP_443051.1_1 Reverse -154 -163 18.0926 0.00402
NP_443051.1_1 Forward -165 -156 10.4228 0.00754
NP_443051.1_1 Reverse -265 -274 -1.18024 0.297
NP_440451.1_10 Reverse -339 -358 7.76679 0.283
NP_439984.1_4 Reverse -81 -100 15.2669 0.246
NP_439937.1_9 Reverse -154 -171 12.5261 0.0317
NP_439937.1_9 Reverse -208 -225 -12.5482 0.273
NP_439937.1_9 Forward -165 -148 -16.5797 0.287
NP_440926.1_9 Reverse -196 -215 8.55425 0.275
NP_441665.1_2 Forward -66 -47 11.7008 0.191
NP_440439.1_1 Forward -167 -154 21.0621 0.0105
NP_440439.1_1 Reverse -152 -165 1.9859 0.138
NP_439943.1_4 Reverse -258 -277 3.34271 0.298
NP_440372.1_2 Forward -163 -156 16.3621 0.0124
NP_440372.1_2 Reverse -156 -163 16.3621 0.0124
NP_440819.1_5 Reverse -48 -56 8.08256 0.185
NP_441803.1_2 Reverse -115 -134 0.392778 0.253
NP_439977.1_5 Forward -281 -262 5.40766 0.15
NP_439977.1_5 Forward -170 -151 -3.04881 0.295
NP_442368.1_1 Forward -341 -322 25.7613 0.00758
NP_442368.1_2 Forward -214 -195 21.2389 0.0242
NP_440139.1_1 Reverse -149 -168 8.94676 0.106
NP_441572.1_7 Forward -126 -107 -4.42544 0.235
NP_440267.1_2 Reverse -150 -164 10.6187 0.134
NP_442384.1_10 Forward -164 -151 12.8023 0.0249
NP_442384.1_10 Reverse -155 -168 10.2457 0.0465
NP_442384.1_10 Forward -246 -233 3.65753 0.183
NP_442114.1_4 Reverse -155 -166 12.1534 0.107
NP_441877.1_5 Forward -62 -43 2.16274 0.253
NP_441877.1_5 Reverse -171 -190 0.491109 0.276
NP_442790.1_4 Reverse -146 -165 -5.21209 0.139
NP_442262.1_10 Forward -163 -156 14.1988 0.0123
NP_442262.1_10 Reverse -156 -163 14.1988 0.0123
NP_442262.1_10 Forward -266 -259 9.38056 0.202
NP_442244.1_6 Reverse -152 -171 0.687771 0.291
NP_442244.1_6 Forward -213 -194 -0.983855 0.291
NP_440344.1_10 Forward -171 -154 -2.12444 0.0609
NP_440344.1_10 Reverse -148 -165 -10.8759 0.194
NP_440344.1_10 Reverse -230 -247 -12.3509 0.25
NP_440531.1_6 Forward -172 -153 9.73422 0.0728
NP_440189.1_10 Reverse -144 -163 9.53756 0.241
NP_440297.1_9 Forward -163 -153 9.61647 0.0917
NP_440297.1_9 Forward -274 -264 6.66654 0.178
NP_440297.1_9 Reverse -156 -166 -0.216628 0.282
NP_441592.1_4 Forward -164 -145 8.55425 0.124
NP_441896.1_3 Forward -173 -154 8.16093 0.0915
NP_440937.1_8 Forward -61 -42 3.6377 0.264
NP_440999.1_9 Forward -168 -154 9.93102 0.0574
NP_440999.1_9 Forward -279 -265 6.6861 0.0962
NP_440888.1_2 Reverse -155 -169 18.1901 0.00261
NP_440888.1_2 Forward -288 -274 11.7987 0.0588
NP_440888.1_2 Reverse -344 -358 9.83206 0.113
NP_440888.1_2 Forward -164 -150 6.39049 0.236
NP_440888.1_4 Forward -252 -238 15.6527 0.237
NP_439969.1_3 Forward -169 -150 7.17762 0.155
NP_442277.1_4 Forward -284 -265 19.0748 0.0222
NP_442277.1_4 Forward -173 -154 14.4533 0.0423
NP_442033.1_10 Forward -166 -147 -6.49039 0.186
NP_442033.1_10 Reverse -153 -172 -6.98204 0.186
NP_442033.1_10 Reverse -118 -137 -7.37537 0.186
NP_441543.1_2 Reverse -156 -165 18.486 0.00236
NP_441543.1_2 Forward -163 -154 9.34117 0.0818
NP_441551.1_5 Forward -168 -152 12.5458 0.15
NP_441319.1_3 Reverse -195 -214 16.6174 0.209
NP_441469.1_8 Forward -165 -156 16.126 0.00797
NP_441469.1_8 Reverse -154 -163 13.3727 0.073
NP_441469.1_8 Forward -276 -267 5.80125 0.253
NP_443064.1_6 Forward -164 -154 13.8273 0.0796
NP_442337.1_8 Forward -175 -156 -1.27885 0.28
NP_442578.1_7 Forward -163 -156 14.5921 0.026
NP_442578.1_7 Reverse -156 -163 14.5921 0.026
NP_440710.1_1 Forward -172 -154 -5.68405 0.218
NP_441462.1_2 Forward -164 -154 20.1379 0.000967
NP_441462.1_2 Reverse -155 -165 11.5831 0.00406
NP_441621.1_7 Reverse -153 -167 4.42448 0.0934
NP_441621.1_7 Forward -166 -152 -3.24533 0.188
NP_440668.1_6 Reverse -124 -143 15.2408 0.297
NP_443062.1_6 Forward -172 -153 5.01433 0.211
NP_442780.1_1 Forward -150 -131 9.73422 0.202
NP_440516.1_8 Forward -164 -155 16.9127 0.00442
NP_440516.1_8 Reverse -155 -164 16.9127 0.00442
NP_442428.1_5 Forward -163 -156 15.8704 0.0124
NP_442428.1_5 Reverse -156 -163 15.8704 0.0124
NP_442428.1_5 Reverse -267 -274 4.66067 0.244
NP_440673.1_3 Forward -162 -155 12.4288 0.0426
NP_440673.1_3 Reverse -157 -164 12.4288 0.0426
NP_440673.1_3 Forward -244 -237 7.51227 0.252
NP_440673.1_3 Reverse -346 -353 6.72562 0.277
NP_441052.1_2 Reverse -155 -165 10.5014 0.0285
NP_441052.1_2 Forward -164 -154 10.4031 0.0285
NP_441052.1_2 Reverse -120 -130 1.455 0.244
NP_442219.1_9 Reverse -156 -165 8.35786 0.0681
NP_442219.1_9 Forward -163 -154 8.25953 0.0681
NP_440436.1_4 Reverse -156 -165 18.1905 0.00233
NP_440436.1_4 Forward -163 -154 15.9289 0.00508
NP_441884.1_8 Reverse -154 -173 -7.4737 0.251
NP_441884.1_9 Reverse -152 -171 -12.9802 0.138
NP_440314.1_9 Forward -163 -144 1.96607 0.0868
NP_440314.1_9 Reverse -279 -298 -9.34199 0.264
NP_441719.1_4 Forward -163 -156 16.3621 0.0124
NP_441719.1_4 Reverse -156 -163 16.3621 0.0124
NP_441733.1_10 Forward -167 -154 9.16406 0.124
NP_441733.1_10 Reverse -152 -165 6.80412 0.171
NP_441004.1_1 Reverse -260 -279 -16.8151 0.287
NP_441004.1_4 Reverse -263 -273 12.7631 0.224
NP_442366.1_3 Reverse -236 -254 -4.79907 0.276
NP_439949.1_7 Forward -64 -50 14.0609 0.228
NP_442176.1_1 Forward -120 -101 2.0644 0.294
NP_442694.1_4 Forward -231 -222 12.0944 0.268
NP_443054.1_2 Reverse -153 -167 12.0943 0.0722
NP_443054.1_2 Forward -276 -262 4.71948 0.24
NP_443054.1_2 Reverse -283 -297 -0.295402 0.293
NP_440864.1_9 Forward -304 -285 -6.68705 0.265
NP_441851.1_10 Reverse -154 -164 17.4829 0.0027
NP_441851.1_10 Forward -165 -155 16.008 0.00552
NP_441851.1_10 Reverse -277 -287 10.4031 0.0935
NP_441851.1_10 Reverse -265 -275 6.27322 0.178
NP_442939.1_3 Reverse -51 -65 15.0039 0.288
NP_442622.1_8 Forward -164 -146 -9.22396 0.145
NP_442515.1_1 Forward -165 -151 13.1759 0.0282
NP_442515.1_1 Reverse -154 -168 4.52282 0.107
NP_441396.1_5 Reverse -259 -268 7.37455 0.279
NP_440593.1_3 Forward -286 -267 -1.18052 0.211
NP_440940.1_7 Forward -174 -156 10.8348 0.128
NP_441349.1_10 Reverse -145 -164 -1.18052 0.0999
NP_442314.1_3 Reverse -268 -282 23.599 0.0376
NP_440432.1_9 Forward -163 -148 14.5329 0.014
NP_440432.1_9 Forward -274 -259 -1.49507 0.167
NP_442843.1_1 Reverse -280 -299 -5.31042 0.244
NP_440474.1_8 Reverse -156 -170 15.4369 0.0566
NP_440431.1_3 Forward -331 -312 -10.0303 0.267
NP_442450.1_5 Reverse -153 -163 10.0098 0.115
NP_440588.1_2 Reverse -146 -165 8.16093 0.0467
NP_442006.1_2 Reverse -164 -181 -19.1357 0.299
NP_441570.1_1 Reverse -155 -173 -5.29072 0.0754
NP_440078.1_10 Reverse -344 -363 4.52268 0.246
NP_441078.1_4 Forward -164 -155 19.6659 0.0007
NP_441078.1_4 Reverse -155 -164 19.6659 0.0007
NP_441078.1_4 Reverse -266 -275 -1.86856 0.272
NP_442443.1_1 Forward -122 -103 -6.58872 0.295
NP_440526.1_3 Forward -286 -275 7.33466 0.153
NP_440526.1_3 Reverse -156 -167 2.41814 0.267
NP_440526.1_3 Forward -274 -263 2.02482 0.267
NP_440526.1_3 Forward -163 -152 1.72983 0.267
NP_441432.1_8 Reverse -154 -163 8.35786 0.0755
NP_441432.1_8 Forward -165 -156 8.25953 0.0755
NP_441432.1_8 Reverse -265 -274 2.85133 0.281
NP_442320.1_8 Reverse -149 -163 5.30946 0.0394
NP_441732.1_2 Reverse -151 -167 -14.9861 0.145
NP_442003.1_7 Reverse -289 -307 15.7347 0.265
NP_440760.1_1 Forward -164 -145 -11.4069 0.0851
NP_442353.1_4 Forward -359 -340 2.75194 0.229
NP_443011.1_4 Reverse -191 -210 11.9958 0.212
NP_441072.1_2 Forward -175 -156 9.3409 0.219
NP_440713.1_4 Forward -174 -155 7.27595 0.182
NP_442489.1_7 Forward -164 -155 20.1576 0.000695
NP_442489.1_7 Reverse -155 -164 20.1576 0.000695
NP_442489.1_7 Reverse -266 -275 -1.37691 0.195
NP_442489.1_7 Forward -246 -237 -1.77023 0.247
NP_440559.1_1 Forward -163 -154 17.306 0.00658
NP_440559.1_1 Reverse -156 -165 8.75118 0.0586
NP_441659.2_8 Forward -164 -154 19.3512 0.000966
NP_441659.2_8 Reverse -155 -165 11.9764 0.0147
NP_440860.1_9 Reverse -342 -361 19.0757 0.167
NP_441968.1_1 Reverse -48 -56 14.1787 0.286
NP_439956.1_7 Reverse -315 -334 3.24438 0.257
NP_440779.1_5 Forward -275 -258 -14.2191 0.243
NP_440779.1_5 Forward -164 -147 -14.6125 0.254
NP_442346.1_5 Reverse -154 -164 17.9746 0.00128
NP_442346.1_5 Forward -165 -155 9.02648 0.118
NP_442346.1_5 Reverse -265 -275 6.37155 0.205
NP_440545.1_3 Reverse -151 -168 5.44704 0.0616
NP_440545.1_3 Forward -168 -151 1.02215 0.127
NP_440545.1_3 Reverse -262 -279 -6.746 0.287
NP_441786.1_10 Reverse -146 -165 7.07928 0.268
NP_442603.1_7 Forward -164 -150 6.19383 0.253
NP_441585.1_5 Reverse -191 -210 0.0970122 0.291
NP_441888.1_7 Reverse -150 -164 2.94952 0.225
NP_441888.1_7 Forward -280 -266 0.982901 0.272
NP_441948.1_4 Forward -171 -153 11.0322 0.0519
NP_441948.1_4 Reverse -148 -166 -1.94747 0.156
NP_441833.1_4 Forward -163 -156 15.9687 0.0124
NP_441833.1_4 Reverse -156 -163 15.9687 0.0124
NP_442699.1_9 Forward -362 -343 14.3558 0.233
NP_442162.1_9 Forward -163 -156 16.2637 0.0124
NP_442162.1_9 Reverse -156 -163 16.2637 0.0124
NP_440671.1_6 Forward -276 -257 16.6165 0.133
NP_440772.1_8 Forward -113 -94 8.06259 0.263
NP_442199.1_5 Reverse -258 -277 0.982764 0.165
NP_442140.1_3 Reverse -156 -166 17.4829 0.0159
NP_442140.1_3 Forward -163 -153 11.5831 0.0743
NP_442140.1_3 Reverse -267 -277 4.69992 0.238
NP_440875.1_9 Reverse -157 -167 15.2829 0.0295
NP_440875.1_9 Reverse -268 -278 11.0975 0.181
NP_441813.1_5 Reverse -153 -163 18.3679 0.00743
NP_441813.1_5 Forward -166 -156 10.0098 0.0208
NP_441813.1_5 Forward -277 -267 -0.609952 0.261
NP_440594.1_8 Reverse -156 -169 10.6384 0.159
NP_440590.1_4 Reverse -156 -169 14.1789 0.0112
NP_440590.1_4 Forward -245 -232 0.117615 0.169
NP_440590.1_4 Forward -163 -150 -5.78224 0.289
NP_440567.1_1 Reverse -156 -170 13.9626 0.0194
NP_442497.1_10 Forward -163 -154 19.8626 0.00532
NP_442497.1_10 Reverse -156 -165 10.4228 0.0087
NP_442497.1_10 Forward -274 -265 0.589713 0.153
NP_440821.1_4 Forward -166 -156 18.7612 0.00422
NP_440821.1_4 Reverse -153 -163 10.9931 0.0146
NP_440821.1_4 Reverse -264 -274 0.275027 0.19
NP_441239.1_9 Forward -166 -154 19.6068 0.00769
NP_441239.1_9 Reverse -153 -165 15.1819 0.0229
NP_441239.1_9 Forward -277 -265 8.88877 0.12
NP_441239.1_9 Reverse -264 -276 3.38223 0.285
NP_441951.1_9 Forward -53 -34 -0.000545616 0.261
NP_441892.1_1 Forward -173 -156 5.74204 0.0999
NP_441541.1_1 Reverse -15 -33 -2.38531 0.264
NP_440876.1_5 Forward -162 -143 4.52268 0.296
NP_440354.1_7 Forward -170 -152 12.1139 0.224
NP_440546.1_4 Forward -164 -154 12.8578 0.0572
NP_440546.1_4 Reverse -155 -165 11.8882 0.0679
NP_441230.1_3 Reverse -153 -172 4.12936 0.269
NP_440462.1_6 Forward -166 -156 17.9746 0.00578
NP_440462.1_6 Reverse -153 -163 9.7148 0.0429
NP_440868.1_4 Forward -168 -156 19.6068 0.00963
NP_440868.1_4 Reverse -151 -163 1.02229 0.193
NP_442499.1_3 Reverse -200 -218 8.18062 0.279
NP_441582.1_5 Forward -166 -147 6.48849 0.193
NP_441474.1_1 Reverse -217 -236 -0.591301 0.255
NP_441084.1_6 Reverse -153 -167 9.44108 0.282
NP_440696.1_3 Reverse -155 -173 -4.11075 0.296
NP_440696.1_6 Reverse -339 -358 6.29264 0.266
NP_442882.1_8 Reverse -196 -215 11.8975 0.157
NP_442039.1_4 Forward -163 -156 15.1821 0.0124
NP_442039.1_4 Reverse -156 -163 15.1821 0.0124
NP_441811.1_8 Forward -170 -156 6.3911 0.273
NP_441926.1_3 Forward -164 -148 5.36841 0.17
NP_442837.1_3 Forward -163 -156 15.7721 0.0124
NP_442837.1_3 Reverse -156 -163 15.7721 0.0124
NP_442053.1_1 Forward -164 -155 18.3876 0.0007
NP_442053.1_1 Reverse -155 -164 18.3876 0.0007
NP_440505.1_3 Forward -166 -156 14.1397 0.0235
NP_440505.1_3 Reverse -153 -163 9.61647 0.122
NP_440505.1_3 Forward -322 -312 5.09324 0.246
NP_440914.1_1 Reverse -279 -289 9.68861 0.178
NP_440914.1_1 Reverse -155 -165 8.6151 0.186
NP_440914.1_1 Forward -164 -154 8.51751 0.186
NP_440914.1_1 Forward -353 -343 8.41992 0.191
NP_440914.1_1 Reverse -333 -343 6.95605 0.257
NP_441011.1_8 Reverse -156 -165 16.9127 0.00602
NP_441011.1_8 Forward -163 -154 14.356 0.0249
NP_442533.1_1 Reverse -261 -280 -15.3402 0.254
NP_442533.1_6 Forward -164 -155 17.2076 0.00137
NP_442533.1_6 Reverse -155 -164 17.2076 0.00137
NP_442541.1_10 Forward -288 -274 0.785655 0.298
NP_442232.1_3 Forward -172 -153 -13.1769 0.282
NP_442232.1_3 Reverse -258 -277 -15.1435 0.289
NP_443016.1_1 Reverse -362 -381 -1.57384 0.223
NP_441482.1_7 Reverse -149 -163 4.71948 0.0454
NP_439944.1_9 Reverse -156 -166 10.4031 0.0887
NP_439944.1_9 Forward -163 -153 8.82982 0.101
NP_442269.1_10 Reverse -196 -215 3.83436 0.248
NP_441028.1_4 Reverse -192 -206 13.2743 0.274
NP_441028.1_6 Forward -362 -352 4.10949 0.278
NP_442202.1_1 Reverse -380 -396 17.0846 0.155
NP_440115.1_6 Forward -167 -157 9.61647 0.115
NP_440115.1_6 Reverse -152 -162 7.05986 0.161
NP_441106.1_1 Forward -165 -156 18.191 0.0028
NP_441106.1_1 Reverse -154 -163 9.73449 0.0311
NP_442306.1_10 Forward -169 -150 -2.65548 0.0878
NP_442306.1_10 Forward -301 -282 -21.24 0.254
NP_441286.1_1 Forward -165 -153 5.93884 0.0258
NP_441286.1_1 Reverse -154 -166 5.34885 0.0259
NP_441286.1_1 Forward -276 -264 -5.86088 0.229
NP_440670.1_8 Forward -164 -155 18.3876 0.000699
NP_440670.1_8 Reverse -155 -164 18.3876 0.000699
NP_440670.1_8 Forward -246 -237 3.44131 0.267
NP_441930.1_2 Forward -354 -344 12.8614 0.248
NP_440886.1_7 Forward -165 -155 17.7774 0.0011
NP_440886.1_7 Reverse -236 -246 10.6976 0.0805
NP_440886.1_7 Reverse -154 -164 8.04271 0.0805
NP_442614.1_2 Reverse -155 -169 5.89945 0.296
NP_439995.1_5 Forward -174 -155 7.27595 0.267
NP_442072.1_9 Reverse -154 -172 -11.9772 0.0799
NP_441808.1_8 Forward -129 -110 9.93088 0.242
NP_442022.1_4 Reverse -195 -214 5.11266 0.293
NP_440907.2_8 Reverse -156 -166 17.4824 0.00685
NP_440907.2_8 Forward -163 -153 9.91099 0.103
NP_441021.1_1 Forward -286 -267 -9.34199 0.215
NP_441021.1_1 Forward -163 -144 -10.4236 0.238
NP_441021.1_8 Reverse -150 -168 8.08229 0.181
NP_441463.1_3 Forward -174 -155 -2.95047 0.164
NP_441463.1_3 Reverse -145 -164 -7.08038 0.254
NP_441463.1_6 Forward -290 -276 7.67217 0.254
NP_441626.1_2 Forward -163 -156 15.7721 0.0124
NP_441626.1_2 Reverse -156 -163 15.7721 0.0124
NP_442365.1_5 Reverse -156 -175 7.47261 0.252
NP_442615.1_1 Reverse -146 -164 -4.40575 0.185
NP_442615.1_1 Reverse -257 -275 -5.29072 0.209
NP_441962.1_4 Reverse -196 -215 -10.522 0.229
NP_441962.1_4 Reverse -261 -280 -13.6686 0.277
NP_441962.1_9 Reverse -180 -199 5.40766 0.271
NP_440387.1_1 Reverse -155 -171 7.53169 0.0282
NP_441431.1_2 Forward -167 -153 11.7003 0.135
NP_441431.1_2 Reverse -161 -175 8.65209 0.209
NP_441431.1_2 Reverse -152 -166 6.19383 0.279
NP_441488.1_7 Reverse -149 -168 5.11266 0.165
NP_441836.1_2 Forward -170 -151 3.93269 0.147
NP_441193.1_6 Reverse -238 -257 9.14423 0.175
NP_441993.1_1 Reverse -260 -279 1.4594 0.276
NP_440114.1_10 Forward -164 -150 13.9626 0.0464
NP_440114.1_10 Reverse -155 -169 10.3243 0.148
NP_440287.1_5 Reverse -99 -118 7.37347 0.286
NP_440293.1_3 Forward -296 -277 -1.08219 0.239
NP_440293.1_3 Reverse -258 -277 -1.7705 0.239
NP_440293.1_10 Reverse -263 -282 -1.57384 0.271
NP_440766.1_4 Forward -168 -154 5.40779 0.112
NP_439988.1_3 Forward -299 -285 3.44117 0.299
NP_441237.1_9 Forward -274 -264 13.7464 0.0687
NP_441237.1_9 Reverse -279 -289 10.4031 0.233
NP_440457.1_1 Forward -168 -156 9.77374 0.092
NP_440457.1_1 Reverse -151 -163 9.18376 0.0949
NP_440213.1_4 Forward -244 -225 15.7394 0.217
NP_440798.1_6 Reverse -156 -169 12.409 0.0468
NP_440801.1_9 Forward -176 -162 15.5501 0.227
NP_442509.1_9 Forward -164 -154 17.3841 0.00128
NP_442509.1_9 Reverse -155 -165 16.2041 0.00739
NP_442509.1_9 Forward -246 -236 6.17443 0.286
NP_442509.1_9 Reverse -147 -157 5.97777 0.298
NP_441253.1_1 Reverse -380 -399 3.93269 0.297
NP_440554.1_4 Reverse -156 -166 13.943 0.0218
NP_440554.1_4 Forward -163 -153 8.82982 0.0646
NP_441885.1_5 Reverse -155 -165 11.4848 0.00668
NP_441885.1_5 Forward -164 -154 11.3864 0.00668
NP_440478.1_7 Reverse -281 -300 16.8141 0.26
NP_440478.1_10 Forward -166 -152 15.5359 0.107
NP_442703.1_9 Forward -92 -74 4.05072 0.262
NP_442341.1_7 Reverse -154 -168 9.63603 0.0726
NP_442341.1_7 Reverse -284 -298 6.6861 0.12
NP_442341.1_7 Reverse -110 -124 3.24451 0.23
NP_442395.2_4 Forward -165 -146 12.9783 0.0725
NP_442395.2_9 Reverse -53 -69 20.5114 0.16
NP_440750.1_4 Reverse -169 -188 10.6192 0.188
NP_443000.1_7 Reverse -153 -163 11.6814 0.0344
NP_443000.1_7 Forward -166 -156 2.04498 0.226
NP_441842.1_1 Reverse -157 -170 18.7999 0.0142
NP_441842.1_10 Forward -171 -157 9.73436 0.182
NP_441842.1_10 Reverse -259 -273 6.09611 0.299
NP_440275.1_3 Forward -166 -156 17.9746 0.0082
NP_440275.1_3 Reverse -153 -163 16.9913 0.0133
NP_440091.1_1 Forward -168 -156 19.6068 0.0114
NP_443060.1_5 Forward -254 -235 10.815 0.175
NP_443010.1_10 Forward -167 -150 8.37555 0.16
NP_442451.1_2 Forward -283 -264 -9.24366 0.259
NP_440175.1_4 Reverse -336 -355 -13.3736 0.247
NP_440216.1_1 Forward -164 -150 15.1426 0.00419
NP_440216.1_1 Reverse -155 -169 7.9644 0.00737
NP_440216.1_1 Reverse -266 -280 -10.9151 0.153
NP_440216.1_9 Reverse -46 -55 9.93116 0.286
NP_440172.1_1 Forward -164 -154 16.303 0.00854
NP_440172.1_1 Reverse -155 -165 8.73149 0.0586
NP_442371.1_1 Reverse -48 -58 14.3359 0.191
NP_442015.1_10 Reverse -233 -246 5.13249 0.15
NP_442015.1_10 Reverse -151 -164 3.65753 0.178
NP_442015.1_10 Forward -168 -155 3.16588 0.185
NP_442015.1_10 Forward -279 -266 2.77255 0.187
NP_441226.1_7 Forward -163 -156 14.4934 0.0123
NP_441226.1_7 Reverse -156 -163 14.4934 0.0123
NP_441226.1_7 Forward -274 -267 11.2485 0.0971
NP_441111.1_7 Forward -163 -155 18.7023 0.00294
NP_441111.1_7 Reverse -156 -164 18.7023 0.00294
NP_441111.1_7 Forward -274 -266 -0.570565 0.233
NP_442379.1_10 Forward -171 -154 0.0388413 0.223
NP_441766.1_2 Forward -164 -155 17.5026 0.00297
NP_441766.1_2 Reverse -155 -164 17.5026 0.00297
NP_440416.1_1 Forward -164 -145 6.78429 0.0584
NP_440416.1_9 Forward -282 -263 -5.70374 0.0814
NP_440416.1_9 Forward -171 -152 -12.8819 0.16
NP_440416.1_9 Forward -360 -341 -17.7001 0.245
NP_443052.1_8 Forward -174 -155 -5.40875 0.13
NP_443052.1_8 Reverse -145 -164 -5.50708 0.13
NP_440591.1_9 Reverse -148 -166 6.70565 0.215
NP_442154.1_1 Forward -134 -116 -17.7788 0.267
NP_440261.1_5 Reverse -156 -169 4.8375 0.0516
NP_440261.1_5 Forward -163 -150 -2.34066 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCGGCATGAATGTTTTCATGGTACGGAATGGGCAAATTGTTACCCCCGGCAATGAGCAGGACATCCTCGAAGGGATTACTAGGGATAGTATTCTCACCATTGCAGCGGATTTGGGCATTCCCACCTGCCAACGCCCCATCGATAAATCGGAATTGATGATTGCCGACGAGGTATTTTTGAGTGGTACTGCGGCCAAAATCACCCCGGTTAAAAGGATTGAGAACTTTACCCTGGGCGGCGATCGCCCGATTACAGAAAAGTTACGCTCCGTGTTGACAGCGGTGACGGAAAACCGGGAACCCAAATATCAAGATTGGGTATTTAAAATTCCTTTGAATGGCTAATTTTTCCTGGCAAGATTAGCGCCTTTAAACTGAACTTAAAGAATTAGAGTTAACCC

CDS

ATGTTGGATCAAAGCCAAGTTCAAAAAATTGCCCACCTGGCCCGTTTGGAAATTACCCCGGAGGAAGAAAGTCAATTTGCTTCCCAGTTGAGCAGCATTTTGGACTACTTTGACCAATTGAACGAACTGCCCACCGAAGGAGTGGAACCCACCACCAGGGCGATCGAGTTGAGCAACATTGTCCGGGGCGATCGCCAAATCAGTTGGGACGGAGACAATGCGGCCACCACCCGCCAAGCTCTGCTAGATAACGCCCCGGAACCGGAGGGAGACTTTTTTCGAGTCCCCCGTATTATGGGCGGTGACGAAGCTTAA

Protein

MLDQSQVQKIAHLARLEITPEEESQFASQLSSILDYFDQLNELPTEGVEPTTRAIELSNIVRGDRQISWDGDNAATTRQALLDNAPEPEGDFFRVPRIMGGDEA