Your browser is old and dusty. Try Google Chrome!

Details for slr0032

ORF slr0032
Accession NP_442721.1
Symbol
Category Branched chain family
Definition probable branched-chain amino acid aminotransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -190 -204 0.196253 0.215
NP_441418.1_6 Reverse -345 -364 -29.4015 0.224
NP_441480.1_8 Forward -205 -186 16.3224 0.26
NP_441453.1_4 Forward -159 -151 9.75419 0.0493
NP_441453.1_4 Reverse -205 -213 5.32929 0.147
NP_441453.1_4 Reverse -345 -353 4.34598 0.257
NP_441453.1_7 Reverse -34 -41 11.9372 0.298
NP_441818.1_1 Forward -30 -19 8.51463 0.288
NP_441818.1_6 Reverse -347 -361 14.5526 0.204
NP_441818.1_9 Forward -308 -289 -3.3438 0.222
NP_441630.1_3 Forward -65 -46 0.884433 0.261
NP_440150.1_6 Reverse -356 -375 1.27776 0.295
NP_443002.1_5 Forward -368 -350 12.8014 0.212
NP_441721.1_5 Reverse -378 -397 28.4171 0.000789
NP_443027.1_4 Forward -195 -185 8.53483 0.199
NP_443027.1_4 Reverse -343 -353 5.87989 0.294
NP_441225.1_4 Forward -367 -348 -10.7186 0.284
NP_442909.1_7 Reverse -151 -165 9.83206 0.14
NP_440061.1_9 Forward -154 -140 8.06211 0.183
NP_442062.1_8 Forward -318 -308 3.61828 0.26
NP_441781.1_7 Forward -159 -140 -2.45882 0.289
NP_440765.1_3 Forward -219 -200 7.37428 0.268
NP_440307.1_2 Forward -355 -336 11.3075 0.122
NP_440856.1_7 Reverse -336 -355 -9.34199 0.287
NP_441738.1_2 Reverse -207 -214 8.00357 0.235
NP_441738.1_2 Forward -365 -358 6.72528 0.236
NP_441955.1_8 Forward -360 -343 21.2783 0.0421
NP_441955.1_8 Reverse -339 -356 8.98696 0.258
NP_441942.1_7 Reverse -350 -369 10.7175 0.292
NP_442889.1_1 Reverse -339 -358 -13.9635 0.271
NP_442889.1_1 Reverse -33 -52 -14.9469 0.283
NP_442889.1_8 Forward -98 -84 2.8506 0.299
NP_441713.1_1 Forward -299 -280 -16.4218 0.283
NP_440178.1_7 Reverse -149 -168 -22.715 0.272
NP_442570.1_3 Reverse -119 -138 -6.98204 0.265
NP_440538.1_10 Forward -139 -120 15.0441 0.187
NP_440538.1_10 Reverse -148 -167 12.7825 0.235
NP_442111.1_3 Forward -391 -378 13.4306 0.261
NP_442111.1_4 Forward -160 -146 2.75286 0.266
NP_440343.1_3 Forward -367 -349 13.7847 0.104
NP_440343.1_9 Forward -208 -189 6.98095 0.292
NP_440747.1_10 Forward -347 -335 -12.1541 0.227
NP_441130.1_8 Forward -356 -337 15.3391 0.128
NP_441130.1_10 Forward -200 -186 7.47274 0.158
NP_441014.1_8 Reverse -104 -123 -5.40875 0.269
NP_441014.1_8 Forward -367 -348 -7.17871 0.276
NP_442848.1_5 Forward -370 -352 -3.6191 0.294
NP_442848.1_9 Reverse -360 -379 -1.67217 0.296
NP_441012.1_4 Forward -157 -144 8.77074 0.272
NP_441012.1_4 Forward -358 -345 7.88576 0.272
NP_441012.1_4 Forward -352 -339 7.19745 0.272
NP_441012.1_4 Reverse -197 -210 5.91914 0.286
NP_443018.1_3 Forward -353 -346 12.5271 0.0523
NP_443018.1_3 Reverse -346 -353 12.5271 0.0523
NP_441634.1_8 Reverse -343 -357 -3.34366 0.295
NP_441634.1_9 Reverse -145 -164 14.0599 0.18
NP_441634.1_9 Reverse -133 -152 10.7167 0.252
NP_440376.1_1 Forward -344 -335 5.99792 0.111
NP_440376.1_1 Reverse -150 -159 2.65466 0.216
NP_440376.1_1 Reverse -359 -368 0.196389 0.283
NP_440376.1_1 Reverse -144 -153 -0.295266 0.286
NP_442191.1_4 Reverse -346 -360 13.417 0.15
NP_440066.1_5 Forward -361 -342 9.53674 0.251
NP_442530.1_2 Forward -391 -381 12.3697 0.276
NP_441013.1_2 Forward -355 -337 2.28076 0.242
NP_441013.1_9 Reverse -300 -318 15.3588 0.202
NP_441422.1_7 Reverse -203 -220 -8.81095 0.282
NP_440360.1_10 Forward -342 -328 2.06454 0.275
NP_442658.1_1 Forward -356 -346 6.37109 0.231
NP_442658.1_1 Reverse -343 -353 5.97777 0.242
NP_440141.1_8 Reverse -351 -370 5.211 0.277
NP_440720.1_1 Forward -163 -144 6.88262 0.195
NP_439968.1_8 Reverse -341 -357 18.5448 0.0911
NP_441478.1_3 Forward -336 -317 19.9606 0.0902
NP_442937.1_3 Reverse -259 -278 11.7008 0.115
NP_442937.1_5 Forward -203 -184 10.5209 0.158
NP_442937.1_5 Forward -125 -106 7.07928 0.263
NP_440984.1_7 Forward -164 -150 5.89945 0.235
NP_441162.1_3 Forward -366 -347 10.4225 0.213
NP_442911.1_2 Reverse -325 -344 -9.34199 0.254
NP_442911.1_2 Forward -203 -184 -10.7186 0.286
NP_442536.1_8 Reverse -342 -361 11.3075 0.272
NP_443055.1_6 Reverse -284 -302 -0.178247 0.254
NP_442210.1_7 Forward -209 -190 14.4541 0.21
NP_441099.1_5 Forward -99 -80 -11.7019 0.288
NP_442002.1_1 Reverse -343 -361 -8.33898 0.264
NP_442598.1_2 Forward -18 -9 16.5193 0.252
NP_441294.1_7 Reverse -185 -199 10.4985 0.185
NP_441646.1_1 Reverse -143 -162 20.354 0.0597
NP_441646.1_1 Reverse -352 -371 -0.787193 0.272
NP_442431.1_10 Forward -204 -186 1.88744 0.246
NP_442431.1_10 Reverse -342 -360 1.69077 0.249
NP_441000.1_6 Forward -355 -341 -4.32697 0.237
NP_440147.1_4 Reverse -148 -161 8.9674 0.0448
NP_440465.1_10 Reverse -357 -376 1.86774 0.275
NP_441041.1_4 Forward -210 -191 -8.65367 0.205
NP_441041.1_9 Forward -25 -11 14.5519 0.275
NP_440569.1_8 Reverse -144 -163 6.98095 0.28
NP_439966.1_7 Forward -356 -346 4.7978 0.258
NP_440674.1_3 Forward -359 -340 8.16093 0.199
NP_440983.1_5 Reverse -189 -208 -5.99873 0.274
NP_440260.1_8 Forward -290 -272 -4.8974 0.273
NP_441514.1_6 Reverse -61 -68 12.8221 0.252
NP_441079.1_10 Reverse -143 -162 19.764 0.268
NP_442012.1_8 Reverse -78 -97 16.9124 0.252
NP_441556.1_4 Forward -266 -247 10.2943 0.284
NP_441556.1_10 Reverse -330 -344 11.8765 0.208
NP_442501.1_2 Forward -370 -351 -3.63879 0.269
NP_440867.1_10 Reverse -326 -345 2.65439 0.283
NP_442933.1_10 Reverse -309 -318 8.1612 0.0885
NP_441310.1_10 Reverse -59 -69 14.4292 0.279
NP_441751.2_8 Reverse -310 -324 -2.16369 0.132
NP_442926.1_1 Reverse -339 -358 -3.24547 0.278
NP_442554.1_8 Reverse -151 -161 5.38824 0.15
NP_442554.1_8 Reverse -346 -356 4.3066 0.189
NP_442554.1_8 Forward -353 -343 2.33998 0.274
NP_442863.1_3 Reverse -133 -151 12.0155 0.261
NP_441762.1_7 Reverse -344 -356 5.84051 0.0308
NP_442142.1_4 Forward -357 -344 17.3249 0.0264
NP_442142.1_4 Forward -321 -308 4.93527 0.206
NP_442301.1_2 Reverse -188 -207 3.24359 0.299
NP_440183.1_9 Forward -157 -138 -20.4534 0.286
NP_440379.1_5 Forward -363 -344 -0.688862 0.184
NP_440379.1_5 Forward -372 -353 -5.80207 0.227
NP_440379.1_5 Reverse -268 -287 -8.06369 0.25
NP_441468.1_1 Forward -117 -110 6.72562 0.126
NP_441468.1_1 Reverse -346 -353 3.97235 0.277
NP_441468.1_1 Forward -353 -346 3.97235 0.277
NP_441015.1_10 Reverse -346 -365 -2.45882 0.178
NP_441015.1_10 Forward -164 -145 -3.44213 0.189
NP_441015.1_10 Reverse -340 -359 -7.76869 0.271
NP_441339.1_4 Forward -351 -332 5.11266 0.166
NP_442253.1_5 Forward -162 -145 1.61214 0.159
NP_441876.1_9 Reverse -43 -53 11.3859 0.275
NP_441826.1_2 Forward -360 -346 2.75286 0.12
NP_441826.1_5 Reverse -342 -361 3.6377 0.261
NP_441330.1_1 Reverse -200 -219 -13.7669 0.202
NP_442811.1_5 Reverse -21 -40 20.4523 0.11
NP_442227.1_2 Forward -361 -342 0.58944 0.252
NP_443058.1_4 Forward -292 -273 13.4708 0.237
NP_442808.1_1 Forward -160 -150 5.09279 0.173
NP_442542.1_2 Reverse -333 -346 7.39411 0.182
NP_442542.1_2 Reverse -357 -370 6.21414 0.232
NP_440342.1_1 Reverse -350 -369 15.8307 0.174
NP_440558.1_2 Forward -372 -353 11.2092 0.0906
NP_440558.1_2 Reverse -332 -351 7.27595 0.12
NP_440558.1_2 Reverse -356 -375 0.294447 0.193
NP_440558.1_2 Forward -116 -97 -1.27885 0.213
NP_440558.1_2 Forward -348 -329 -7.4737 0.294
NP_440111.2_2 Reverse -340 -359 -0.885524 0.225
NP_442792.1_6 Reverse -349 -368 7.37428 0.251
NP_441878.1_6 Reverse -334 -344 -6.70647 0.194
NP_441878.1_6 Reverse -358 -368 -7.39479 0.222
NP_441878.1_6 Reverse -149 -159 -7.59145 0.245
NP_442721.1_1 Forward -261 -243 18.112 0.273
NP_442721.1_3 Forward -363 -344 19.469 0.112
NP_442721.1_4 Forward -128 -109 20.8456 0.0723
NP_442721.1_5 Forward -185 -166 28.7112 0.000772
NP_442721.1_6 Forward -392 -373 24.2872 0.0115
NP_441445.1_1 Reverse -342 -361 0.0977854 0.283
NP_442066.2_9 Forward -376 -363 9.36073 0.175
NP_441224.1_6 Forward -356 -342 21.2384 0.184
NP_441458.1_10 Forward -363 -344 1.67108 0.285
NP_442830.1_5 Forward -369 -355 4.62054 0.239
NP_441564.1_2 Reverse -354 -373 -2.45882 0.223
NP_442397.1_4 Forward -138 -119 20.5498 0.196
NP_441574.1_1 Forward -210 -191 7.66927 0.11
NP_441574.1_1 Forward -372 -353 -6.88371 0.281
NP_441549.1_9 Forward -163 -145 6.214 0.0925
NP_441549.1_9 Forward -372 -354 -2.53746 0.198
NP_441549.1_9 Forward -297 -279 -9.42063 0.248
NP_441549.1_9 Forward -348 -330 -10.6006 0.281
NP_442347.1_2 Reverse -310 -319 4.81794 0.257
NP_442645.1_2 Forward -167 -148 -2.75381 0.0487
NP_441037.1_4 Reverse -182 -192 11.1185 0.164
NP_441037.1_4 Forward -154 -144 6.73295 0.245
NP_441633.1_3 Forward -346 -333 2.47756 0.0954
NP_442590.1_10 Forward -159 -140 6.39097 0.245
NP_442998.1_5 Forward -391 -381 7.64985 0.287
NP_440299.1_1 Forward -197 -184 3.16532 0.256
NP_440299.1_1 Forward -218 -205 2.47701 0.288
NP_441799.1_1 Reverse -341 -355 6.39049 0.174
NP_441799.1_1 Forward -163 -149 5.50552 0.206
NP_440640.1_6 Reverse -336 -355 3.73603 0.213
NP_440256.1_1 Forward -217 -198 -4.6221 0.161
NP_440256.1_1 Forward -321 -302 -6.49039 0.213
NP_440456.1_7 Forward -298 -284 10.816 0.285
NP_441559.1_8 Forward -349 -335 3.14618 0.143
NP_441559.1_8 Forward -373 -359 -6.39192 0.277
NP_440915.1_6 Reverse -355 -369 7.07942 0.0757
NP_440915.1_6 Reverse -139 -153 -2.16369 0.26
NP_441179.1_9 Reverse -343 -353 13.6475 0.246
NP_441296.1_9 Forward -367 -354 11.6217 0.231
NP_440717.1_3 Forward -190 -176 7.57046 0.28
NP_440749.1_3 Reverse -355 -371 13.2349 0.179
NP_442866.1_9 Reverse -86 -105 16.2241 0.0522
NP_440748.1_5 Forward -156 -137 -2.75381 0.281
NP_442453.1_6 Forward -146 -132 16.755 0.176
NP_442993.1_1 Reverse -73 -89 -9.87289 0.197
NP_440677.1_4 Forward -284 -266 16.2438 0.262
NP_442386.1_9 Forward -355 -346 14.1589 0.0289
NP_442386.1_9 Reverse -344 -353 13.1756 0.0406
NP_440570.1_5 Reverse -29 -48 7.57094 0.174
NP_441750.1_4 Forward -366 -347 3.73603 0.231
NP_441750.1_7 Reverse -351 -361 13.8447 0.254
NP_441340.1_5 Reverse -346 -353 4.07068 0.239
NP_441340.1_5 Forward -353 -346 4.07068 0.239
NP_441340.1_5 Forward -213 -206 4.07068 0.239
NP_440168.1_9 Reverse -334 -353 -4.6221 0.296
NP_440146.1_1 Forward -24 -6 16.5221 0.166
NP_441160.1_1 Reverse -352 -371 -11.4069 0.292
NP_441160.1_1 Reverse -272 -291 -11.8003 0.295
NP_440211.1_3 Reverse -28 -47 15.2408 0.287
NP_440586.1_1 Forward -214 -195 -3.24547 0.265
NP_440586.1_1 Forward -208 -189 -3.63879 0.272
NP_440586.1_8 Forward -317 -310 10.7568 0.128
NP_440586.1_8 Forward -353 -346 7.61025 0.227
NP_440586.1_8 Reverse -346 -353 7.61025 0.227
NP_440586.1_8 Reverse -190 -197 5.64364 0.297
NP_440586.1_9 Reverse -353 -372 5.99764 0.288
NP_440684.1_9 Reverse -360 -374 9.34103 0.221
NP_441262.1_3 Forward -214 -207 5.44732 0.11
NP_440027.1_3 Reverse -335 -353 10.0481 0.177
NP_439937.1_9 Reverse -358 -375 -16.2847 0.287
NP_440408.1_3 Reverse -342 -361 -3.83545 0.259
NP_442239.1_8 Reverse -274 -293 7.47261 0.257
NP_439943.1_2 Reverse -271 -290 23.0089 0.029
NP_440372.1_2 Forward -213 -206 4.36568 0.205
NP_441138.1_5 Forward -18 -5 10.0884 0.238
NP_440819.1_5 Forward -392 -384 8.08256 0.185
NP_440316.1_10 Reverse -149 -159 5.38824 0.299
NP_439977.1_5 Forward -199 -180 -1.7705 0.26
NP_442384.1_10 Forward -165 -152 3.95252 0.172
NP_442114.1_8 Reverse -3 -17 7.17714 0.234
NP_441877.1_7 Reverse -340 -359 8.16011 0.218
NP_442572.1_6 Forward -152 -133 7.37428 0.295
NP_442262.1_10 Forward -353 -346 10.4622 0.145
NP_442262.1_10 Reverse -346 -353 10.4622 0.145
NP_440163.1_10 Reverse -348 -358 13.648 0.118
NP_440531.1_6 Reverse -337 -356 -1.37718 0.231
NP_441965.1_10 Forward -357 -341 6.15506 0.185
NP_441965.1_10 Forward -121 -105 6.15506 0.185
NP_440297.1_9 Forward -100 -90 1.25834 0.282
NP_441896.1_5 Reverse -254 -261 12.2322 0.273
NP_441103.1_9 Forward -69 -59 12.8802 0.278
NP_442067.1_4 Forward -365 -346 12.0942 0.116
NP_440999.1_2 Reverse -51 -70 11.5042 0.211
NP_440999.1_9 Reverse -305 -319 2.94952 0.14
NP_440999.1_9 Reverse -76 -90 -3.24533 0.289
NP_440888.1_2 Reverse -80 -94 5.30886 0.284
NP_442033.1_10 Reverse -333 -352 -1.7705 0.144
NP_440575.1_4 Reverse -336 -355 12.4324 0.284
NP_441543.1_2 Forward -317 -308 8.25953 0.104
NP_442845.1_2 Forward -308 -294 7.07942 0.199
NP_441469.1_8 Forward -355 -346 12.9794 0.087
NP_441469.1_8 Reverse -183 -192 10.1278 0.227
NP_441469.1_8 Reverse -344 -353 5.60459 0.258
NP_442578.1_5 Reverse -296 -315 2.3594 0.257
NP_440710.1_1 Forward -352 -334 -6.27403 0.224
NP_441462.1_4 Reverse -40 -59 -4.91709 0.286
NP_441621.1_7 Reverse -343 -357 -1.27871 0.175
NP_443062.1_1 Reverse -309 -327 6.59578 0.195
NP_443062.1_1 Forward -354 -336 4.93815 0.244
NP_441601.1_4 Forward -361 -342 -4.72043 0.293
NP_442204.1_5 Reverse -174 -193 1.57275 0.232
NP_441351.1_8 Reverse -352 -371 15.1424 0.105
NP_441351.1_8 Forward -397 -378 3.6377 0.232
NP_442428.1_5 Forward -353 -346 4.36568 0.271
NP_442428.1_5 Reverse -346 -353 4.36568 0.271
NP_440673.1_7 Forward -361 -342 3.34271 0.205
NP_441052.1_2 Reverse -150 -160 4.0116 0.168
NP_441052.1_2 Reverse -51 -61 -0.314959 0.273
NP_442219.1_8 Forward -224 -205 6.42771 0.298
NP_440436.1_4 Forward -353 -344 4.42421 0.265
NP_441884.1_8 Forward -355 -336 -8.65367 0.262
NP_442577.1_9 Forward -189 -175 12.5853 0.246
NP_441004.1_1 Forward -219 -200 -7.27704 0.197
NP_441004.1_1 Reverse -342 -361 -9.73531 0.211
NP_441004.1_1 Reverse -354 -373 -17.0118 0.288
NP_441004.1_2 Reverse -349 -368 -0.688862 0.259
NP_441004.1_2 Reverse -173 -192 -4.03212 0.288
NP_442813.1_4 Forward -362 -343 -7.96535 0.299
NP_442366.1_3 Reverse -142 -160 -1.06249 0.204
NP_442366.1_5 Forward -155 -145 10.0093 0.292
NP_441437.1_1 Forward -286 -267 19.6656 0.0826
NP_440328.1_4 Forward -158 -139 4.32602 0.167
NP_442308.1_8 Reverse -329 -348 9.24257 0.233
NP_441851.1_10 Reverse -183 -193 4.69992 0.254
NP_442814.1_2 Forward -122 -103 6.4893 0.252
NP_442515.1_1 Forward -345 -331 10.1277 0.0563
NP_440593.1_3 Forward -164 -145 -7.57203 0.297
NP_440463.1_8 Forward -370 -351 10.1138 0.23
NP_442843.1_1 Forward -353 -334 -1.86883 0.202
NP_442843.1_1 Reverse -352 -371 -6.88371 0.245
NP_442843.1_1 Forward -213 -194 -8.35868 0.255
NP_439960.1_3 Reverse -150 -169 1.86774 0.263
NP_439960.1_10 Forward -370 -352 -4.60241 0.293
NP_441150.1_6 Forward -196 -177 14.4533 0.251
NP_442168.1_5 Reverse -185 -204 -1.47551 0.264
NP_440588.1_2 Forward -377 -358 -4.91709 0.233
NP_442006.1_2 Reverse -345 -362 4.75873 0.0741
NP_441003.1_9 Forward -363 -344 3.44104 0.292
NP_441570.1_1 Reverse -335 -353 -16.6971 0.252
NP_441078.1_4 Reverse -150 -159 6.09625 0.0863
NP_441078.1_4 Reverse -335 -344 -0.68859 0.206
NP_441078.1_4 Forward -344 -335 -1.6719 0.266
NP_441078.1_4 Forward -159 -150 -2.06522 0.295
NP_442443.1_1 Reverse -352 -371 10.3242 0.108
NP_441091.1_5 Forward -169 -150 4.12936 0.282
NP_441432.1_8 Forward -345 -336 5.50626 0.151
NP_441732.1_2 Reverse -146 -162 -16.5594 0.174
NP_440760.1_1 Reverse -150 -169 -14.9469 0.138
NP_440199.1_10 Forward -321 -311 6.96153 0.251
NP_440913.1_3 Reverse -195 -208 14.9656 0.215
NP_440713.1_4 Reverse -341 -360 6.68596 0.187
NP_440713.1_4 Forward -354 -335 5.60432 0.205
NP_442489.1_7 Reverse -335 -344 -1.6719 0.235
NP_442489.1_7 Reverse -150 -159 -1.6719 0.235
NP_441659.2_8 Reverse -205 -215 -0.118297 0.287
NP_441092.1_6 Reverse -352 -371 11.3075 0.233
NP_442913.1_10 Reverse -326 -345 -3.54046 0.212
NP_441968.1_1 Forward -392 -384 14.1787 0.286
NP_439956.1_7 Forward -210 -191 1.76941 0.28
NP_439956.1_8 Reverse -348 -367 8.55425 0.298
NP_440708.1_6 Forward -358 -339 -10.9153 0.294
NP_441800.1_7 Forward -359 -341 -2.53746 0.264
NP_440779.1_5 Reverse -345 -362 -14.2191 0.243
NP_440352.1_5 Forward -400 -381 10.5143 0.272
NP_440352.1_7 Forward -367 -354 16.9316 0.211
NP_440545.1_3 Forward -348 -331 -4.48438 0.227
NP_440545.1_3 Reverse -355 -372 -5.95935 0.265
NP_441856.1_6 Forward -355 -341 19.6658 0.133
NP_440831.1_3 Reverse -351 -370 5.80468 0.28
NP_441629.1_3 Forward -367 -348 9.14342 0.177
NP_441923.1_6 Reverse -346 -360 21.2391 0.0727
NP_440847.1_3 Forward -367 -353 15.0436 0.185
NP_442603.1_7 Reverse -109 -123 7.66879 0.198
NP_442603.1_7 Forward -120 -106 6.78381 0.23
NP_441233.1_6 Forward -257 -238 16.1249 0.086
NP_441585.1_5 Reverse -371 -390 -0.0996487 0.291
NP_441888.1_7 Reverse -340 -354 9.73436 0.137
NP_441050.1_5 Reverse -350 -368 -1.94747 0.274
NP_441895.1_2 Forward -185 -166 -17.7001 0.234
NP_442162.1_9 Forward -213 -206 3.4807 0.246
NP_442162.1_9 Reverse -206 -213 3.38237 0.276
NP_440671.1_4 Reverse -345 -359 13.2743 0.0864
NP_440671.1_5 Forward -365 -351 15.5352 0.221
NP_442045.1_5 Forward -363 -344 3.04771 0.239
NP_442140.1_3 Reverse -346 -356 14.4347 0.0486
NP_442140.1_3 Forward -353 -343 9.12481 0.111
NP_442140.1_3 Forward -158 -148 6.76487 0.159
NP_442021.1_9 Reverse -39 -58 7.27595 0.214
NP_440875.1_9 Forward -196 -186 7.20399 0.277
NP_440875.1_9 Forward -352 -342 6.81464 0.297
NP_441813.1_5 Reverse -203 -213 5.97822 0.105
NP_441259.1_3 Forward -358 -339 9.93088 0.251
NP_440590.1_4 Reverse -144 -157 -0.275709 0.182
NP_440567.1_1 Reverse -346 -360 -0.688726 0.298
NP_441239.1_9 Forward -356 -344 14.297 0.0288
NP_441239.1_9 Reverse -343 -355 5.74217 0.21
NP_441239.1_9 Forward -120 -108 4.75886 0.243
NP_440665.1_1 Reverse -339 -358 -14.7502 0.264
NP_442044.1_1 Reverse -358 -377 -6.49039 0.206
NP_442325.1_8 Reverse -368 -387 15.4592 0.29
NP_440833.1_6 Forward -390 -376 7.07881 0.289
NP_443035.1_10 Forward -361 -344 5.54538 0.273
NP_442138.1_10 Reverse -134 -153 -7.57203 0.29
NP_440546.1_4 Reverse -345 -355 11.5973 0.0774
NP_440546.1_4 Forward -354 -344 8.59164 0.181
NP_440546.1_4 Reverse -150 -160 7.23423 0.252
NP_440546.1_6 Reverse -350 -369 7.57094 0.268
NP_440546.1_6 Reverse -267 -286 7.37428 0.273
NP_441230.1_5 Forward -365 -346 4.03102 0.188
NP_440462.1_6 Reverse -203 -213 4.10993 0.216
NP_440705.1_4 Reverse -275 -294 7.37428 0.296
NP_441497.1_3 Reverse -371 -390 -11.7019 0.294
NP_441474.1_1 Reverse -299 -318 -1.47628 0.262
NP_442402.1_2 Reverse -79 -93 12.782 0.267
NP_442402.1_4 Reverse -43 -62 -5.90115 0.249
NP_440036.1_10 Reverse -177 -189 12.7237 0.284
NP_440696.1_3 Reverse -341 -359 -2.63579 0.278
NP_440696.1_6 Forward -164 -145 7.66927 0.249
NP_442679.1_1 Reverse -1 -20 -5.50708 0.293
NP_442380.1_10 Reverse -350 -368 8.86894 0.262
NP_442829.1_2 Forward -269 -253 7.75456 0.295
NP_440008.1_9 Reverse -150 -169 6.78429 0.283
NP_440825.1_7 Reverse -206 -216 11.153 0.271
NP_440160.1_9 Reverse -354 -373 10.8159 0.231
NP_440505.1_3 Forward -39 -29 8.63316 0.138
NP_440505.1_3 Forward -346 -336 5.78156 0.211
NP_440505.1_7 Forward -348 -329 6.78429 0.162
NP_441701.1_3 Reverse -141 -158 7.512 0.259
NP_441408.2_7 Forward -167 -148 0.196116 0.228
NP_441011.1_8 Forward -213 -204 11.1111 0.0855
NP_441011.1_8 Forward -240 -231 5.60459 0.247
NP_441011.1_8 Forward -353 -344 5.01461 0.289
NP_442533.1_1 Forward -311 -292 -12.2919 0.236
NP_442533.1_6 Forward -159 -150 5.40793 0.14
NP_442533.1_6 Forward -368 -359 4.62128 0.179
NP_442533.1_6 Forward -354 -345 4.62128 0.179
NP_442533.1_6 Forward -318 -309 3.14632 0.224
NP_442533.1_6 Forward -152 -143 2.16301 0.27
NP_442541.1_10 Forward -369 -355 9.14375 0.213
NP_442541.1_10 Reverse -335 -349 4.91554 0.248
NP_442541.1_10 Reverse -103 -117 3.44058 0.254
NP_442232.1_3 Reverse -337 -356 -10.817 0.274
NP_442322.1_4 Forward -362 -345 -5.66502 0.271
NP_442229.1_3 Reverse -330 -347 16.6568 0.207
NP_442269.1_4 Forward -359 -340 22.7139 0.0643
NP_441697.1_5 Forward -24 -5 -8.06949 0.254
NP_442202.1_10 Forward -355 -341 6.78443 0.255
NP_441527.1_4 Reverse -1 -20 -4.82277 0.189
NP_441527.1_4 Reverse -4 -23 -12.5576 0.291
NP_440007.1_9 Forward -312 -298 2.16287 0.281
NP_441680.1_4 Reverse -343 -362 1.17943 0.246
NP_441680.1_4 Forward -359 -340 0.884433 0.246
NP_443045.1_5 Reverse -87 -100 14.8246 0.253
NP_441602.1_3 Forward -374 -355 -4.03212 0.258
NP_441602.1_3 Reverse -340 -359 -4.91709 0.277
NP_441106.1_1 Reverse -344 -353 4.32629 0.227
NP_440429.1_2 Forward -349 -330 8.25926 0.272
NP_442306.1_10 Forward -373 -354 -21.535 0.277
NP_441286.1_1 Forward -345 -333 -4.77924 0.175
NP_441286.1_1 Forward -194 -182 -6.45087 0.265
NP_442674.1_3 Reverse -176 -195 3.9319 0.294
NP_440886.1_7 Forward -361 -351 5.78111 0.163
NP_440828.1_4 Reverse -188 -207 0.490334 0.181
NP_442614.1_2 Reverse -358 -372 5.70279 0.298
NP_442072.1_9 Forward -294 -276 -23.0886 0.277
NP_442401.1_2 Reverse -149 -168 10.7167 0.171
NP_442022.1_4 Reverse -333 -352 5.80098 0.279
NP_442365.1_7 Forward -163 -144 3.93269 0.154
NP_440107.1_5 Reverse -338 -357 -5.80207 0.223
NP_440387.1_1 Forward -159 -143 2.61514 0.0763
NP_440855.1_5 Forward -151 -132 1.76863 0.295
NP_441431.1_2 Reverse -342 -356 13.2736 0.0947
NP_441431.1_2 Forward -357 -343 7.96378 0.23
NP_441431.1_2 Forward -151 -137 6.78381 0.261
NP_441836.1_2 Reverse -144 -163 -2.85214 0.232
NP_441836.1_2 Reverse -339 -358 -4.42544 0.255
NP_441993.1_1 Forward -204 -185 6.7221 0.178
NP_441174.1_2 Reverse -342 -356 11.6026 0.293
NP_440114.1_10 Reverse -359 -373 6.78443 0.258
NP_442090.1_10 Forward -125 -112 11.4257 0.261
NP_442698.1_10 Reverse -356 -375 -1.18052 0.297
NP_440293.1_3 Reverse -352 -371 11.3075 0.156
NP_439988.1_3 Reverse -355 -369 8.55439 0.253
NP_442743.1_4 Reverse -346 -365 -4.22878 0.249
NP_442930.1_1 Forward -388 -378 13.0576 0.239
NP_441133.1_1 Forward -308 -289 16.6174 0.163
NP_440502.1_1 Reverse -289 -305 17.0691 0.278
NP_442867.1_8 Forward -362 -343 5.01433 0.277
NP_440457.1_1 Reverse -355 -367 6.43049 0.121
NP_440457.1_1 Reverse -354 -366 1.21895 0.244
NP_441801.1_4 Forward -189 -179 2.63497 0.29
NP_441332.1_6 Forward -361 -351 13.6798 0.184
NP_441332.1_6 Forward -368 -358 11.3563 0.261
NP_442040.1_4 Reverse -339 -358 9.24257 0.147
NP_442439.1_8 Reverse -308 -327 17.404 0.134
NP_442514.1_5 Forward -289 -270 -8.16275 0.285
NP_440554.1_4 Forward -353 -343 5.87989 0.129
NP_441885.1_5 Reverse -150 -160 7.64985 0.0466
NP_441885.1_5 Reverse -335 -345 0.373358 0.164
NP_440478.1_10 Forward -356 -342 7.47274 0.262
NP_442310.1_1 Forward -352 -333 16.6174 0.135
NP_442341.1_7 Forward -160 -146 5.60446 0.151
NP_442341.1_7 Forward -194 -180 1.08123 0.299
NP_442341.1_9 Reverse -89 -103 5.30886 0.274
NP_441756.1_5 Forward -371 -352 0.58944 0.23
NP_441756.1_5 Forward -122 -103 -3.73712 0.29
NP_440679.1_3 Reverse -190 -208 5.82068 0.296
NP_440679.1_10 Forward -208 -189 -12.7836 0.213
NP_440679.1_10 Forward -309 -290 -20.3551 0.284
NP_441207.1_7 Reverse -3 -17 13.9992 0.199
NP_441207.1_7 Reverse -1 -15 9.83628 0.273
NP_439962.1_4 Forward -362 -343 14.8474 0.106
NP_439962.1_4 Forward -371 -352 -5.50708 0.28
NP_442495.1_5 Reverse -361 -380 6.58763 0.291
NP_440149.1_8 Forward -324 -305 -5.9004 0.235
NP_442373.1_2 Reverse -132 -151 -9.24366 0.258
NP_440216.1_9 Forward -93 -84 13.2744 0.197
NP_440216.1_9 Forward -394 -385 9.93116 0.286
NP_442371.1_1 Forward -392 -382 15.7125 0.142
NP_442015.1_10 Forward -64 -51 6.1158 0.124
NP_442015.1_10 Forward -147 -134 0.0192843 0.245
NP_441226.1_7 Forward -213 -206 9.77352 0.131
NP_441226.1_7 Forward -152 -145 5.64364 0.286
NP_441226.1_7 Reverse -294 -301 5.34865 0.289
NP_440416.1_9 Forward -361 -342 -6.98204 0.0951
NP_440416.1_9 Reverse -132 -151 -19.2734 0.272
NP_440416.1_9 Forward -67 -48 -19.2734 0.272
NP_440416.1_9 Forward -159 -140 -20.2567 0.283
NP_443052.1_9 Forward -361 -342 4.916 0.149
NP_443052.1_9 Forward -370 -351 -1.57384 0.23
NP_442154.1_1 Forward -209 -191 -6.4707 0.139
NP_442154.1_1 Reverse -346 -364 -15.6155 0.222
NP_442154.1_1 Forward -212 -194 -19.3521 0.298
NP_440261.1_5 Forward -343 -330 -2.63565 0.0924
NP_440261.1_5 Forward -192 -179 -11.1904 0.246
NP_440988.1_7 Reverse -347 -366 -1.86883 0.281
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGGCCGGCCAGGAAAAAATTACCTTTGTGGCGGCCCATTCCCCCGCCGCCATGGCTGGCATTAGCCCCCAGGACTTGTTACTGGCCATCAATGGTGTACGGGTTGGGGCCGAACAGCTTTCCCTGCGGCTGAAAGACTACCAAGCCAATGATATGATTCAGTTAACGGTGTTTCATCAGGATCTTTTGCGAACGGTGGATGTGGTGTTGGCATCTCCCCAAGCAAACCGTTATGAAGTGGTGCCCATAGCCGACCCCTCGGACAGCCAACTTCAAAATCTGGCGGGCTGGCTAGGTGAATCCTAATGCCCTGGAAAACACGGGTAGCACACTATTCCCCTTTGGATGACCGGGGTTAAGTCCAGGGAGTAGGGAGTACAAGTCTTTTTTTTGATTTTCTG

CDS

ATGCACAAGTTTTTGCCGATCGCCTACTTTGAAGATAAGTTTGTCCCGTTTGAGGATGCCAAAATTTCCGTTGCTACCCATGCCCTCCACTATGGGACGGCGGCCTTTGGGGGTTTGCGGGGTATTCCCGACCCGGAAGATCCGGGCACCATTCTACTATTCCGTCTGGACCGCCATGGCGATCGCCTGAGTAAGAGTGCCAAGTTTTTGCACTACGACATCAGTGCAGAAAAAATCAAGGAAGTTATTGTTGATTTTGTTAAGAAAAATCAGCCCGATAAATCCTTTTACATCCGTCCATTGGTGTACAGTTCCGGTTTGGGCATTGCCCCCCGTTTGCACAATCTGGAGAAGGATTTCCTGGTTTATGGCTTGGAAATGGGGGATTACCTCGCCGCCGACGGAGTTAGCTGCCGTATCAGTTCCTGGTATCGCCAAGAAGACCGGAGTTTTCCCCTAAGGGGCAAAATCAGCGCCGCCTACATTACCTCTGCTTTGGCTAAAACGGAAGCGGTGGAATCGGGCTTTGATGAGGCTATTTTGATGAATTCCCAAGGTAAGGTCTGTGAAGCCACCGGCATGAATGTTTTCATGGTACGGAATGGGCAAATTGTTACCCCCGGCAATGAGCAGGACATCCTCGAAGGGATTACTAGGGATAGTATTCTCACCATTGCAGCGGATTTGGGCATTCCCACCTGCCAACGCCCCATCGATAAATCGGAATTGATGATTGCCGACGAGGTATTTTTGAGTGGTACTGCGGCCAAAATCACCCCGGTTAAAAGGATTGAGAACTTTACCCTGGGCGGCGATCGCCCGATTACAGAAAAGTTACGCTCCGTGTTGACAGCGGTGACGGAAAACCGGGAACCCAAATATCAAGATTGGGTATTTAAAATTCCTTTGAATGGCTAA

Protein

MHKFLPIAYFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHGDRLSKSAKFLHYDISAEKIKEVIVDFVKKNQPDKSFYIRPLVYSSGLGIAPRLHNLEKDFLVYGLEMGDYLAADGVSCRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAILMNSQGKVCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQRPIDKSELMIADEVFLSGTAAKITPVKRIENFTLGGDRPITEKLRSVLTAVTENREPKYQDWVFKIPLNG