Your browser is old and dusty. Try Google Chrome!

Details for slr0018

ORF slr0018
Accession NP_442130.1
Symbol
Category TCA cycle
Definition fumarase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -25 -39 -0.393733 0.228
NP_440795.1_7 Forward -72 -65 14.6904 0.0123
NP_440795.1_7 Reverse -65 -72 14.6904 0.0123
NP_441418.1_6 Forward -237 -218 -29.5982 0.23
NP_441418.1_6 Reverse -64 -83 -30.0898 0.256
NP_440815.1_5 Reverse -294 -313 4.22769 0.286
NP_441480.1_5 Forward -91 -72 18.0924 0.107
NP_441453.1_4 Reverse -64 -72 16.539 0.00633
NP_441453.1_4 Forward -73 -65 16.539 0.00633
NP_442151.1_6 Reverse -64 -78 14.1593 0.0395
NP_442151.1_6 Forward -282 -268 9.5377 0.145
NP_442151.1_6 Forward -73 -59 6.6861 0.224
NP_442151.1_6 Forward -34 -20 5.99778 0.253
NP_441818.1_1 Forward -72 -61 9.20294 0.25
NP_441818.1_1 Reverse -65 -76 8.51463 0.288
NP_440226.1_1 Forward -73 -54 21.6323 0.00635
NP_442655.1_1 Forward -78 -59 5.80098 0.157
NP_442655.1_1 Reverse -59 -78 1.17943 0.238
NP_442655.1_10 Forward -240 -221 -9.73531 0.22
NP_442655.1_10 Forward -249 -230 -19.6667 0.282
NP_442173.1_1 Forward -72 -64 15.4574 0.00633
NP_442173.1_1 Reverse -65 -73 15.4574 0.00633
NP_442752.1_4 Forward -73 -66 13.8055 0.0199
NP_442752.1_4 Reverse -64 -71 13.8055 0.0199
NP_443027.1_4 Reverse -62 -72 13.2547 0.0521
NP_442975.1_10 Forward -77 -63 11.012 0.0516
NP_442975.1_10 Reverse -60 -74 3.93223 0.249
NP_440784.1_7 Forward -72 -65 15.9687 0.0123
NP_440784.1_7 Reverse -65 -72 15.9687 0.0123
NP_441934.1_5 Reverse -265 -284 16.8141 0.188
NP_440061.1_9 Reverse -224 -238 5.60385 0.279
NP_442062.1_3 Reverse -122 -141 -2.65548 0.272
NP_442062.1_8 Reverse -64 -74 17.6796 0.00193
NP_442062.1_8 Forward -73 -63 10.3048 0.0493
NP_440304.1_4 Reverse -62 -72 10.8948 0.051
NP_440304.1_4 Forward -75 -65 9.91146 0.051
NP_442242.1_4 Forward -72 -65 14.3954 0.0124
NP_442242.1_4 Reverse -65 -72 14.3954 0.0124
NP_440044.1_8 Reverse -65 -84 0.491109 0.197
NP_440044.1_9 Reverse -58 -77 6.88182 0.268
NP_439923.1_10 Forward -262 -243 12.0942 0.291
NP_441208.1_9 Forward -76 -62 14.3559 0.0974
NP_441594.1_6 Forward -255 -236 5.60432 0.209
NP_440856.1_4 Reverse -57 -76 -1.7705 0.203
NP_441083.1_5 Reverse -64 -74 19.3512 0.000718
NP_441083.1_5 Forward -73 -63 11.2881 0.0159
NP_441149.1_9 Reverse -215 -234 2.85027 0.221
NP_441738.1_2 Forward -71 -64 15.28 0.0102
NP_441738.1_2 Reverse -66 -73 15.28 0.0102
NP_441558.1_5 Reverse -62 -81 10.2259 0.102
NP_441645.1_6 Reverse -229 -243 10.9137 0.288
NP_440209.1_1 Reverse -64 -72 18.1123 0.00295
NP_440209.1_1 Forward -73 -65 18.1123 0.00295
NP_442889.1_8 Reverse -61 -75 10.8154 0.0775
NP_441770.1_5 Forward -87 -68 1.27776 0.238
NP_440178.1_7 Forward -74 -55 -2.26216 0.0355
NP_440178.1_7 Reverse -63 -82 -20.945 0.204
NP_441716.1_1 Forward -282 -268 4.91614 0.246
NP_442111.1_3 Forward -349 -336 15.3405 0.2
NP_442111.1_4 Forward -74 -60 1.76955 0.294
NP_440343.1_9 Forward -256 -237 13.1758 0.184
NP_440906.1_5 Forward -72 -65 15.8704 0.0124
NP_440906.1_5 Reverse -65 -72 15.8704 0.0124
NP_440747.1_10 Reverse -61 -73 7.4138 0.00422
NP_440747.1_10 Forward -76 -64 5.54551 0.0128
NP_440747.1_10 Forward -249 -237 -12.5474 0.297
NP_441130.1_10 Forward -75 -61 7.27608 0.164
NP_441486.1_1 Reverse -61 -75 6.48943 0.0344
NP_441486.1_1 Forward -76 -62 -2.65535 0.175
NP_442634.1_4 Reverse -62 -76 -2.06536 0.149
NP_442634.1_4 Forward -75 -61 -3.24533 0.161
NP_441265.1_3 Forward -79 -65 3.14618 0.181
NP_441014.1_8 Reverse -223 -242 -2.36049 0.232
NP_441012.1_4 Reverse -245 -258 9.45906 0.272
NP_443018.1_3 Forward -72 -65 14.8871 0.0123
NP_443018.1_3 Reverse -65 -72 14.8871 0.0123
NP_441634.1_8 Reverse -241 -255 0.786239 0.217
NP_441634.1_8 Reverse -247 -261 -2.06536 0.295
NP_441634.1_8 Reverse -62 -76 -4.4253 0.295
NP_440376.1_1 Forward -73 -64 19.4693 0.000692
NP_440376.1_1 Reverse -64 -73 19.4693 0.000692
NP_440376.1_1 Forward -237 -228 3.44131 0.203
NP_441588.1_4 Reverse -66 -76 9.22315 0.14
NP_441588.1_4 Forward -71 -61 6.76487 0.185
NP_442687.1_7 Forward -74 -64 18.5646 0.0028
NP_442687.1_7 Reverse -63 -73 9.02648 0.0994
NP_442958.1_3 Reverse -14 -33 -2.95047 0.299
NP_441422.1_7 Reverse -235 -252 -2.3211 0.21
NP_441422.1_8 Forward -172 -158 21.1407 0.239
NP_440667.1_2 Reverse -315 -334 -2.0655 0.232
NP_442658.1_1 Forward -75 -65 14.8275 0.0188
NP_442658.1_1 Reverse -62 -72 14.2375 0.0237
NP_442161.1_3 Forward -173 -154 7.66927 0.204
NP_442782.1_2 Reverse -207 -221 10.7177 0.173
NP_442782.1_2 Reverse -25 -39 0.687908 0.286
NP_442782.1_2 Forward -221 -207 0.294584 0.291
NP_442496.1_5 Forward -152 -134 5.91901 0.285
NP_440656.1_8 Reverse -53 -72 -8.94866 0.273
NP_441487.1_9 Forward -74 -55 10.0292 0.0919
NP_441487.1_9 Reverse -63 -82 9.14423 0.0988
NP_441958.1_5 Reverse -63 -73 21.2195 0.000805
NP_441958.1_5 Forward -74 -64 20.5312 0.000966
NP_440651.1_7 Reverse -31 -50 14.1591 0.265
NP_442836.1_5 Forward -79 -60 1.37609 0.287
NP_440984.1_7 Reverse -221 -235 6.29277 0.219
NP_440984.1_7 Reverse -59 -73 5.89945 0.235
NP_440984.1_7 Forward -78 -64 4.91614 0.281
NP_439990.1_5 Reverse -59 -72 9.36073 0.145
NP_442911.1_2 Forward -83 -64 -8.16202 0.228
NP_442911.1_2 Reverse -54 -73 -9.34199 0.254
NP_443055.1_3 Forward -82 -63 15.0377 0.11
NP_443055.1_6 Forward -81 -63 1.88669 0.224
NP_440993.1_4 Forward -252 -235 4.46374 0.275
NP_441099.1_5 Reverse -227 -246 -10.9153 0.266
NP_441099.1_5 Forward -83 -64 -11.7019 0.288
NP_441099.1_5 Reverse -54 -73 -11.9969 0.294
NP_442002.1_9 Forward -74 -67 14.1004 0.074
NP_441294.1_7 Forward -77 -63 15.6819 0.0213
NP_441294.1_7 Reverse -60 -74 13.2821 0.0711
NP_441646.1_1 Reverse -211 -230 -0.885524 0.273
NP_441000.1_6 Forward -74 -60 14.2576 0.0396
NP_441000.1_6 Reverse -63 -77 -4.62196 0.248
NP_440147.1_4 Forward -75 -62 20.2755 0.00228
NP_440147.1_4 Reverse -62 -75 10.639 0.0355
NP_441175.1_2 Forward -261 -242 8.16093 0.226
NP_441550.1_8 Forward -75 -65 17.6791 0.00754
NP_441550.1_8 Reverse -62 -72 15.8108 0.0132
NP_441916.1_5 Reverse -210 -229 19.174 0.174
NP_441916.1_7 Forward -73 -63 18.9579 0.00144
NP_441916.1_7 Reverse -64 -74 16.893 0.00407
NP_441916.1_10 Reverse -23 -42 0.0977854 0.292
NP_441041.1_4 Reverse -19 -38 -3.44213 0.122
NP_441041.1_4 Reverse -64 -83 -6.68705 0.172
NP_441041.1_4 Forward -73 -54 -13.4719 0.288
NP_441041.1_4 Forward -227 -208 -13.5702 0.291
NP_441041.1_7 Forward -76 -64 21.314 0.00104
NP_441041.1_7 Reverse -61 -73 16.6495 0.0131
NP_441725.1_5 Reverse -65 -75 11.7798 0.0247
NP_441725.1_5 Forward -72 -62 1.94665 0.115
NP_439966.1_7 Reverse -62 -72 14.3359 0.0203
NP_442941.1_3 Forward -72 -62 19.2529 0.00262
NP_442941.1_3 Reverse -65 -75 2.53664 0.14
NP_440289.1_2 Reverse -61 -74 15.5556 0.0107
NP_440289.1_2 Forward -76 -63 7.09911 0.0586
NP_441076.1_6 Forward -392 -382 17.1874 0.238
NP_440260.1_8 Forward -255 -237 -5.38906 0.273
NP_442281.1_1 Forward -78 -64 13.2736 0.0288
NP_442281.1_1 Reverse -59 -73 8.75042 0.0764
NP_441079.1_7 Forward -107 -88 2.6536 0.177
NP_442847.1_7 Forward -246 -227 18.879 0.0958
NP_442256.1_2 Reverse -62 -80 -5.97904 0.214
NP_442256.1_2 Forward -75 -57 -7.65067 0.214
NP_440437.1_1 Reverse -58 -77 -0.39387 0.181
NP_440647.1_9 Forward -75 -57 13.1955 0.125
NP_440647.1_9 Reverse -62 -80 4.73903 0.233
NP_441457.1_7 Forward -331 -312 0.884433 0.276
NP_441644.1_6 Forward -73 -63 19.0557 0.000803
NP_441644.1_6 Reverse -64 -74 15.7125 0.0048
NP_441644.1_6 Forward -285 -275 4.7978 0.224
NP_440253.1_2 Forward -73 -55 14.7688 0.0186
NP_440253.1_2 Reverse -64 -82 -0.374176 0.209
NP_440929.1_8 Forward -73 -64 19.2726 0.000701
NP_440929.1_8 Reverse -64 -73 19.2726 0.000701
NP_442933.1_10 Forward -73 -64 17.601 0.00325
NP_442933.1_10 Reverse -64 -73 17.601 0.00325
NP_441751.2_8 Forward -72 -58 2.65453 0.0782
NP_441751.2_8 Reverse -65 -79 -5.50694 0.214
NP_442926.1_3 Forward -293 -274 3.83436 0.279
NP_442554.1_8 Forward -72 -62 17.2863 0.00543
NP_442554.1_8 Reverse -65 -75 14.238 0.0144
NP_441762.1_7 Forward -74 -62 1.7106 0.0735
NP_441762.1_7 Reverse -63 -75 0.432302 0.0747
NP_441762.1_7 Forward -238 -226 -5.36923 0.203
NP_442142.1_4 Forward -76 -63 11.2284 0.0603
NP_442142.1_4 Reverse -240 -253 7.39353 0.141
NP_442142.1_4 Reverse -61 -74 4.93527 0.206
NP_442292.1_1 Forward -72 -63 17.5026 0.00435
NP_442292.1_1 Reverse -65 -74 9.53783 0.0183
NP_440919.1_7 Reverse -136 -154 6.02938 0.279
NP_442381.1_8 Reverse -61 -80 -14.2585 0.28
NP_443009.1_5 Reverse -63 -74 17.0694 0.00659
NP_443009.1_5 Forward -74 -63 16.7744 0.00677
NP_441715.1_4 Forward -72 -62 16.7946 0.0106
NP_441715.1_4 Reverse -238 -248 5.09324 0.233
NP_440881.1_4 Reverse -12 -31 -1.47551 0.292
NP_441198.1_8 Forward -75 -65 12.5877 0.12
NP_441468.1_1 Forward -72 -65 15.8704 0.0124
NP_441468.1_1 Reverse -65 -72 15.8704 0.0124
NP_442099.1_1 Reverse -182 -200 12.7038 0.292
NP_441015.1_10 Reverse -268 -287 -4.03212 0.197
NP_441015.1_10 Forward -239 -220 -7.76869 0.271
NP_441015.1_10 Forward -287 -268 -11.7019 0.3
NP_441673.1_1 Forward -73 -64 20.8459 0.000698
NP_441673.1_1 Reverse -64 -73 20.8459 0.000698
NP_441826.1_5 Forward -367 -348 5.80098 0.235
NP_441330.1_9 Reverse -321 -340 9.63589 0.289
NP_442868.1_6 Reverse -62 -72 10.4031 0.038
NP_442868.1_6 Forward -75 -65 9.12481 0.0539
NP_442719.1_2 Forward -19 -1 6.99988 0.125
NP_441056.1_1 Reverse -237 -256 -0.0988766 0.156
NP_441056.1_1 Forward -288 -269 -9.047 0.288
NP_442361.1_3 Forward -197 -184 12.8023 0.174
NP_442808.1_1 Reverse -63 -73 8.73102 0.0481
NP_442808.1_1 Forward -74 -64 8.73102 0.0481
NP_442808.1_1 Reverse -227 -237 5.38779 0.155
NP_442808.1_1 Reverse -347 -357 4.60114 0.195
NP_440145.1_3 Reverse -54 -73 9.14423 0.0446
NP_440145.1_3 Forward -83 -64 0.294447 0.137
NP_442718.1_2 Forward -329 -310 -5.9004 0.295
NP_442050.1_1 Reverse -283 -302 16.4207 0.171
NP_442050.1_5 Reverse -62 -72 15.9091 0.0091
NP_442050.1_5 Forward -75 -65 6.96107 0.27
NP_441114.1_3 Forward -214 -205 14.5527 0.193
NP_440558.1_2 Forward -43 -24 3.83436 0.153
NP_441878.1_6 Forward -74 -64 20.2362 0.0046
NP_441878.1_6 Reverse -63 -73 10.5014 0.0176
NP_441036.1_8 Reverse -63 -73 15.713 0.00724
NP_441036.1_8 Forward -74 -64 8.4365 0.174
NP_441557.1_5 Forward -73 -64 19.9609 0.000699
NP_441557.1_5 Reverse -64 -73 19.9609 0.000699
NP_441557.1_8 Reverse -219 -229 11.1893 0.26
NP_441445.1_1 Forward -82 -63 10.8159 0.0928
NP_441445.1_1 Reverse -55 -74 0.687771 0.27
NP_442066.2_9 Reverse -60 -73 10.2457 0.154
NP_440101.1_5 Forward -289 -270 16.9124 0.0713
NP_442166.1_7 Forward -72 -58 9.14437 0.204
NP_442135.1_5 Reverse -219 -237 14.473 0.274
NP_442170.1_5 Forward -73 -54 -1.86883 0.254
NP_442347.1_2 Forward -72 -63 3.34298 0.284
NP_442347.1_2 Reverse -65 -74 3.34298 0.284
NP_442645.1_2 Reverse -56 -75 -12.1936 0.144
NP_442645.1_2 Forward -224 -205 -18.7818 0.279
NP_442645.1_2 Forward -81 -62 -21.9284 0.29
NP_441037.1_4 Forward -75 -65 17.3558 0.0127
NP_441037.1_4 Reverse -62 -72 7.22024 0.237
NP_440151.1_2 Forward -253 -235 14.178 0.277
NP_441633.1_3 Reverse -62 -75 5.72248 0.0481
NP_441633.1_3 Forward -75 -62 -6.07724 0.236
NP_441633.1_3 Reverse -224 -237 -6.47056 0.253
NP_440136.1_2 Forward -72 -65 15.9687 0.0123
NP_440136.1_2 Reverse -65 -72 15.9687 0.0123
NP_442590.1_10 Forward -80 -61 5.60432 0.258
NP_442998.1_10 Forward -71 -64 15.5754 0.0102
NP_442998.1_10 Reverse -66 -73 15.5754 0.0102
NP_441799.1_1 Forward -77 -63 15.5352 0.0178
NP_441799.1_1 Reverse -60 -74 5.89884 0.19
NP_442802.1_2 Reverse -281 -300 14.0599 0.223
NP_442201.1_10 Forward -84 -65 3.04771 0.0961
NP_440256.1_1 Forward -76 -57 -3.63879 0.137
NP_440256.1_1 Forward -31 -12 -8.16202 0.253
NP_440256.1_1 Reverse -61 -80 -9.24366 0.275
NP_441559.1_8 Reverse -59 -73 2.2612 0.147
NP_441559.1_8 Forward -287 -273 -6.68692 0.279
NP_441270.1_5 Forward -52 -33 13.6774 0.211
NP_440915.1_6 Reverse -60 -74 9.5377 0.0406
NP_440915.1_6 Forward -77 -63 5.80112 0.0879
NP_442785.1_7 Reverse -62 -76 10.3243 0.229
NP_442069.1_6 Reverse -285 -304 6.98095 0.224
NP_441464.1_8 Reverse -64 -78 15.6342 0.102
NP_441464.1_8 Reverse -318 -332 3.73617 0.29
NP_441939.1_3 Forward -72 -53 5.89931 0.259
NP_442993.1_1 Forward -73 -57 -0.531451 0.077
NP_442993.1_1 Reverse -64 -80 -8.10294 0.153
NP_442993.1_1 Reverse -219 -235 -11.2495 0.24
NP_442386.1_9 Forward -74 -65 6.39082 0.219
NP_442386.1_9 Reverse -63 -72 6.39082 0.219
NP_442386.1_9 Reverse -24 -33 5.9975 0.23
NP_441340.1_5 Forward -72 -65 15.6737 0.0124
NP_441340.1_5 Reverse -65 -72 15.6737 0.0124
NP_441947.1_10 Reverse -235 -253 2.28076 0.276
NP_442791.1_5 Reverse -245 -264 -5.50708 0.279
NP_440059.1_3 Forward -44 -25 11.995 0.17
NP_441254.1_1 Reverse -164 -177 15.4566 0.257
NP_440586.1_8 Forward -72 -65 13.2151 0.026
NP_440586.1_8 Reverse -65 -72 13.2151 0.026
NP_442251.1_6 Forward -72 -65 15.2804 0.0124
NP_442251.1_6 Reverse -65 -72 15.2804 0.0124
NP_441262.1_3 Reverse -64 -71 14.7888 0.0223
NP_441262.1_3 Forward -73 -66 14.7888 0.0223
NP_441262.1_5 Reverse -151 -170 3.24438 0.285
NP_440027.1_3 Reverse -237 -255 6.70489 0.223
NP_443051.1_1 Reverse -63 -72 19.5676 0.00335
NP_443051.1_1 Forward -74 -65 18.0926 0.00402
NP_439937.1_8 Forward -239 -220 -2.75381 0.261
NP_439937.1_9 Reverse -70 -87 -11.4665 0.256
NP_439937.1_9 Reverse -225 -242 -17.0714 0.291
NP_439937.1_9 Reverse -71 -88 -17.1697 0.294
NP_441167.1_6 Reverse -148 -167 17.6982 0.158
NP_440439.1_1 Reverse -61 -74 12.9006 0.023
NP_440372.1_2 Forward -72 -65 16.3621 0.0124
NP_440372.1_2 Reverse -65 -72 16.3621 0.0124
NP_440171.1_3 Forward -87 -68 11.3075 0.209
NP_441789.1_7 Reverse -347 -366 -0.0996487 0.251
NP_441789.1_7 Reverse -220 -239 -4.32786 0.28
NP_440267.1_2 Reverse -59 -73 12.5853 0.125
NP_442887.1_5 Reverse -192 -211 -14.1602 0.293
NP_442384.1_10 Forward -73 -60 2.57589 0.22
NP_442384.1_10 Reverse -64 -77 1.69091 0.249
NP_441877.1_7 Reverse -232 -251 3.9319 0.218
NP_441877.1_7 Reverse -14 -33 -0.197979 0.281
NP_441018.1_7 Forward -256 -237 8.55425 0.242
NP_442262.1_10 Forward -72 -65 14.1988 0.0123
NP_442262.1_10 Reverse -65 -72 14.1988 0.0123
NP_441689.1_5 Reverse -62 -72 8.3377 0.132
NP_440344.1_10 Forward -80 -63 -2.3211 0.0643
NP_440344.1_10 Reverse -221 -238 -3.99273 0.09
NP_440531.1_6 Reverse -56 -75 -3.63879 0.269
NP_440562.1_10 Reverse -55 -73 5.52568 0.289
NP_442065.1_7 Forward -134 -116 1.98577 0.222
NP_442529.1_4 Forward -82 -63 20.1573 0.134
NP_442693.1_7 Forward -229 -210 7.57094 0.282
NP_440297.1_9 Reverse -65 -75 9.61647 0.0917
NP_440297.1_9 Forward -72 -62 -0.216628 0.282
NP_440350.1_5 Forward -67 -48 -4.72043 0.284
NP_440894.1_7 Reverse -147 -166 10.7167 0.234
NP_440999.1_9 Forward -286 -272 5.21113 0.113
NP_440999.1_9 Reverse -60 -74 -0.590395 0.212
NP_440888.1_2 Forward -73 -59 13.8636 0.0231
NP_440888.1_2 Forward -203 -189 8.65209 0.152
NP_440888.1_2 Forward -34 -20 8.45543 0.16
NP_440888.1_2 Forward -292 -278 5.21053 0.288
NP_439969.1_3 Forward -78 -59 -0.39387 0.271
NP_442277.1_4 Reverse -243 -262 11.7 0.0723
NP_442277.1_4 Reverse -55 -74 7.4718 0.146
NP_441543.1_2 Forward -72 -63 15.9293 0.00518
NP_441543.1_2 Reverse -65 -74 9.34117 0.0818
NP_441469.1_8 Forward -74 -65 13.3727 0.073
NP_441469.1_8 Reverse -63 -72 6.5879 0.227
NP_442315.1_1 Reverse -372 -390 8.37728 0.217
NP_443064.1_6 Reverse -64 -74 13.8273 0.0796
NP_443064.1_6 Forward -73 -63 10.8217 0.13
NP_442578.1_7 Forward -72 -65 14.5921 0.026
NP_442578.1_7 Reverse -65 -72 14.5921 0.026
NP_440710.1_1 Reverse -56 -74 -7.55234 0.24
NP_441462.1_2 Forward -73 -63 20.2362 0.000805
NP_441462.1_2 Reverse -64 -74 20.1379 0.000967
NP_441621.1_7 Forward -239 -225 6.09611 0.068
NP_443062.1_1 Forward -73 -55 10.4961 0.116
NP_443062.1_1 Reverse -64 -82 9.42349 0.134
NP_443062.1_1 Reverse -348 -366 8.15589 0.159
NP_442204.1_1 Reverse -60 -71 2.02529 0.266
NP_441560.1_10 Forward -81 -62 16.8141 0.0867
NP_440516.1_2 Reverse -216 -234 1.49411 0.194
NP_440516.1_8 Forward -73 -64 16.9127 0.00442
NP_440516.1_8 Reverse -64 -73 16.9127 0.00442
NP_442080.1_7 Reverse -307 -326 0.491109 0.229
NP_441033.1_2 Forward -83 -64 -7.27704 0.293
NP_442428.1_5 Forward -72 -65 15.8704 0.0124
NP_442428.1_5 Reverse -65 -72 15.8704 0.0124
NP_442120.1_10 Reverse -25 -44 -6.88371 0.217
NP_442120.1_10 Forward -221 -202 -8.65367 0.237
NP_442120.1_10 Forward -288 -269 -15.2418 0.292
NP_440603.1_9 Reverse -238 -257 0.884433 0.284
NP_440673.1_2 Forward -83 -64 10.292 0.217
NP_440673.1_3 Forward -71 -64 12.4288 0.0426
NP_440673.1_3 Reverse -66 -73 12.4288 0.0426
NP_441052.1_2 Forward -73 -63 10.4031 0.0285
NP_441052.1_2 Reverse -64 -74 10.4031 0.0285
NP_441052.1_2 Forward -282 -272 2.14332 0.216
NP_442219.1_9 Forward -72 -63 8.25953 0.0681
NP_442219.1_9 Reverse -65 -74 8.25953 0.0681
NP_440436.1_4 Reverse -65 -74 15.9289 0.00508
NP_440436.1_4 Forward -72 -63 9.24241 0.0871
NP_441884.1_9 Forward -200 -181 -22.715 0.284
NP_440314.1_9 Reverse -65 -84 8.65258 0.0362
NP_440314.1_9 Forward -72 -53 -9.93197 0.281
NP_440314.1_9 Reverse -166 -185 -10.4236 0.298
NP_440648.1_1 Forward -73 -54 5.01433 0.219
NP_441719.1_4 Forward -72 -65 16.3621 0.0124
NP_441719.1_4 Reverse -65 -72 16.3621 0.0124
NP_441733.1_10 Reverse -61 -74 6.50913 0.184
NP_441004.1_1 Forward -252 -233 -11.1119 0.234
NP_441004.1_1 Forward -240 -221 -15.2418 0.273
NP_441004.1_2 Reverse -196 -215 -4.72043 0.296
NP_442366.1_3 Forward -74 -56 -0.964162 0.203
NP_442366.1_3 Reverse -63 -81 -5.58572 0.289
NP_442366.1_5 Forward -76 -66 14.8275 0.0375
NP_440328.1_4 Forward -79 -60 -0.688862 0.286
NP_443054.1_2 Reverse -62 -76 16.2242 0.0579
NP_441851.1_10 Forward -74 -64 17.4829 0.0027
NP_441851.1_10 Reverse -63 -73 8.53483 0.114
NP_442208.1_5 Forward -363 -344 -8.45701 0.275
NP_441501.1_9 Forward -260 -241 14.2566 0.278
NP_442856.1_7 Forward -291 -272 17.8957 0.0463
NP_442515.1_1 Forward -74 -60 2.85119 0.129
NP_442515.1_1 Reverse -63 -77 -3.04867 0.285
NP_441396.1_5 Forward -91 -82 8.35786 0.224
NP_442689.1_8 Reverse -157 -174 -8.0243 0.292
NP_441349.1_10 Forward -83 -64 -9.83364 0.297
NP_441409.1_6 Forward -79 -60 -6.29373 0.124
NP_440432.1_9 Forward -72 -57 14.6312 0.014
NP_440432.1_9 Reverse -65 -80 8.73135 0.0427
NP_442843.1_1 Forward -245 -226 -2.16383 0.203
NP_439960.1_10 Forward -253 -235 7.19731 0.138
NP_440474.1_8 Forward -72 -58 5.99717 0.235
NP_441477.1_10 Reverse -266 -284 -0.865831 0.294
NP_440431.1_4 Reverse -46 -65 -2.81744 0.224
NP_442450.1_5 Forward -75 -65 17.3846 0.0267
NP_440943.1_5 Reverse -204 -218 17.9942 0.183
NP_440943.1_5 Forward -42 -28 14.5526 0.22
NP_441003.1_9 Forward -191 -172 5.99764 0.255
NP_443047.1_7 Reverse -65 -84 6.88262 0.228
NP_442243.1_1 Reverse -19 -37 -2.04653 0.286
NP_441570.1_1 Forward -252 -234 -11.5839 0.198
NP_441078.1_4 Forward -73 -64 19.6659 0.0007
NP_441078.1_4 Reverse -64 -73 19.6659 0.0007
NP_442348.1_2 Reverse -97 -106 11.9961 0.225
NP_440526.1_3 Reverse -65 -76 10.9729 0.0646
NP_440526.1_3 Forward -72 -61 1.92649 0.267
NP_441432.1_8 Reverse -63 -72 16.8143 0.00595
NP_441432.1_8 Forward -74 -65 8.35786 0.0755
NP_441432.1_8 Reverse -24 -33 5.60459 0.147
NP_441030.1_6 Forward -75 -56 13.1403 0.23
NP_442815.1_2 Forward -184 -166 3.3624 0.269
NP_440760.1_1 Forward -73 -54 -19.2734 0.219
NP_440760.1_1 Reverse -64 -83 -19.5684 0.219
NP_440760.1_7 Reverse -209 -228 2.35861 0.286
NP_442274.1_8 Reverse -166 -184 13.856 0.286
NP_440578.1_4 Forward -51 -32 10.9142 0.247
NP_442489.1_7 Forward -73 -64 20.1576 0.000695
NP_442489.1_7 Reverse -64 -73 20.1576 0.000695
NP_440559.1_1 Reverse -65 -74 17.306 0.00658
NP_440559.1_1 Forward -72 -63 8.65285 0.0586
NP_441659.2_8 Forward -73 -63 20.9245 0.000805
NP_441659.2_8 Reverse -64 -74 19.3512 0.000966
NP_442749.1_5 Reverse -89 -106 8.80213 0.225
NP_442913.1_10 Forward -82 -63 12.8808 0.0335
NP_442913.1_10 Reverse -55 -74 -0.885524 0.165
NP_442913.1_10 Forward -363 -344 -3.54046 0.212
NP_441040.1_2 Reverse -217 -236 -5.80207 0.181
NP_441968.1_1 Reverse -46 -54 15.162 0.257
NP_439956.1_7 Reverse -315 -334 1.86774 0.28
NP_440779.1_5 Reverse -64 -81 -13.4325 0.212
NP_442346.1_5 Forward -74 -64 17.9746 0.00128
NP_442346.1_5 Reverse -63 -73 16.303 0.00248
NP_440545.1_3 Reverse -269 -286 -1.43612 0.168
NP_440545.1_3 Forward -77 -60 -4.77938 0.232
NP_441856.1_3 Forward -76 -57 -1.57384 0.239
NP_440831.1_5 Forward -209 -190 16.1751 0.299
NP_441629.1_1 Forward -81 -62 13.0775 0.154
NP_440486.1_4 Forward -251 -233 1.10079 0.226
NP_441126.1_4 Reverse -339 -358 17.4032 0.29
NP_440459.1_2 Reverse -16 -33 9.38028 0.229
NP_440010.1_4 Reverse -233 -252 -1.27961 0.267
NP_442551.1_4 Reverse -271 -286 -3.16669 0.287
NP_442900.1_7 Forward -341 -322 18.9773 0.0227
NP_441233.1_6 Reverse -83 -102 8.94676 0.239
NP_441948.1_4 Forward -80 -62 7.29564 0.0623
NP_441833.1_4 Forward -72 -65 15.9687 0.0124
NP_441833.1_4 Reverse -65 -72 15.9687 0.0124
NP_442162.1_9 Forward -72 -65 16.2637 0.0124
NP_442162.1_9 Reverse -65 -72 16.2637 0.0124
NP_442199.1_5 Forward -42 -23 -6.39206 0.273
NP_442199.1_5 Forward -128 -109 -6.68705 0.28
NP_442140.1_3 Reverse -65 -75 13.5497 0.0542
NP_442140.1_3 Forward -72 -62 4.69992 0.238
NP_442723.1_1 Reverse -338 -357 1.27698 0.298
NP_441671.1_1 Forward -242 -223 -1.27885 0.287
NP_440875.1_9 Forward -71 -61 15.867 0.0233
NP_440875.1_9 Reverse -245 -255 10.1241 0.231
NP_441813.1_5 Reverse -62 -72 18.1713 0.00743
NP_441813.1_5 Forward -75 -65 8.82982 0.0367
NP_440590.1_4 Forward -72 -59 4.8375 0.0585
NP_440590.1_4 Reverse -65 -78 2.96921 0.0783
NP_440590.1_4 Reverse -247 -260 -4.79893 0.267
NP_442497.1_10 Reverse -65 -74 19.8626 0.00532
NP_442497.1_10 Forward -72 -63 17.601 0.00813
NP_440821.1_4 Forward -75 -65 10.9931 0.0146
NP_440821.1_4 Reverse -62 -72 2.24165 0.131
NP_441239.1_9 Reverse -62 -74 16.5586 0.0166
NP_441239.1_9 Forward -75 -63 10.7571 0.0723
NP_441892.1_1 Forward -82 -65 2.49712 0.14
NP_440665.1_2 Reverse -304 -323 -7.27704 0.298
NP_440354.1_7 Forward -98 -80 6.50899 0.282
NP_442138.1_10 Forward -73 -54 -5.50708 0.269
NP_442052.1_8 Forward -75 -65 12.7631 0.253
NP_440546.1_4 Forward -73 -63 13.5365 0.0459
NP_440546.1_4 Reverse -64 -74 12.8578 0.0572
NP_440546.1_4 Forward -357 -347 7.52511 0.235
NP_440462.1_6 Reverse -62 -72 18.7612 0.00454
NP_440462.1_6 Forward -75 -65 1.455 0.294
NP_442611.1_1 Forward -362 -343 -0.197208 0.266
NP_440868.1_4 Reverse -60 -72 7.80712 0.0637
NP_440868.1_4 Forward -77 -65 -0.74767 0.282
NP_442499.1_3 Reverse -212 -230 3.75572 0.289
NP_442402.1_4 Reverse -68 -87 -1.77127 0.194
NP_441848.1_4 Forward -20 -4 12.6117 0.199
NP_440696.1_3 Forward -262 -244 -3.6191 0.287
NP_442039.1_4 Forward -72 -65 15.1821 0.0124
NP_442039.1_4 Reverse -65 -72 15.1821 0.0124
NP_441926.1_3 Forward -73 -57 15.6932 0.0428
NP_440825.1_7 Reverse -65 -75 11.8361 0.2
NP_442837.1_3 Forward -72 -65 15.7721 0.0124
NP_442837.1_3 Reverse -65 -72 15.7721 0.0124
NP_442053.1_1 Forward -73 -64 18.3876 0.0007
NP_442053.1_1 Reverse -64 -73 18.3876 0.0007
NP_442053.1_1 Forward -292 -283 6.68623 0.12
NP_440505.1_3 Reverse -62 -72 17.188 0.00332
NP_440505.1_3 Forward -248 -238 4.50326 0.284
NP_440914.1_1 Forward -73 -63 16.3248 0.00196
NP_440914.1_1 Reverse -64 -74 8.51751 0.186
NP_440914.1_1 Reverse -25 -35 7.83437 0.219
NP_441011.1_8 Forward -72 -63 16.6177 0.00602
NP_441011.1_8 Reverse -65 -74 14.356 0.0249
NP_441011.1_8 Reverse -229 -238 7.07956 0.179
NP_442101.1_10 Reverse -56 -75 -8.26035 0.232
NP_442533.1_1 Forward -162 -143 -17.7001 0.293
NP_442533.1_6 Forward -73 -64 17.2076 0.00137
NP_442533.1_6 Reverse -64 -73 17.2076 0.00137
NP_442533.1_6 Forward -120 -111 7.27622 0.0928
NP_442533.1_6 Reverse -273 -282 4.22796 0.186
NP_442541.1_10 Forward -34 -20 3.73557 0.252
NP_442229.1_1 Reverse -62 -76 8.16044 0.184
NP_441482.1_7 Reverse -58 -72 -12.1934 0.29
NP_439944.1_9 Forward -72 -62 9.12481 0.1
NP_439944.1_9 Reverse -65 -75 8.82982 0.101
NP_441028.1_6 Reverse -343 -353 8.3377 0.216
NP_440116.1_8 Reverse -65 -84 -3.63879 0.157
NP_441527.1_4 Reverse -38 -57 -11.2207 0.278
NP_441527.1_4 Reverse -41 -60 -13.1306 0.298
NP_440115.1_6 Reverse -61 -71 4.89658 0.28
NP_440007.1_4 Forward -45 -26 10.2259 0.251
NP_440007.1_9 Forward -333 -319 2.06454 0.281
NP_441602.1_4 Reverse -360 -379 9.53756 0.278
NP_441106.1_1 Reverse -63 -72 18.486 0.0028
NP_441106.1_1 Forward -74 -65 9.73449 0.0311
NP_439903.1_6 Forward -219 -200 0.293673 0.267
NP_442306.1_10 Reverse -59 -78 -10.7186 0.111
NP_442306.1_10 Forward -169 -150 -21.3384 0.263
NP_442306.1_10 Reverse -160 -179 -21.83 0.291
NP_441286.1_1 Reverse -63 -75 6.03717 0.0258
NP_441286.1_1 Forward -74 -62 -3.50094 0.145
NP_440092.1_9 Forward -333 -314 15.6341 0.235
NP_440670.1_8 Forward -73 -64 18.3876 0.000699
NP_440670.1_8 Reverse -64 -73 18.3876 0.000699
NP_440886.1_7 Forward -74 -64 8.04271 0.0805
NP_440886.1_7 Reverse -63 -73 8.04271 0.0805
NP_440886.1_7 Reverse -227 -237 5.58445 0.175
NP_440886.1_7 Reverse -236 -246 4.7978 0.218
NP_440886.1_7 Reverse -347 -357 3.91283 0.26
NP_440828.1_4 Reverse -242 -261 2.6536 0.152
NP_441001.1_7 Forward -390 -372 13.2938 0.244
NP_442614.1_2 Reverse -64 -78 5.99778 0.295
NP_442382.1_7 Forward -222 -203 4.81767 0.252
NP_442072.1_9 Forward -74 -56 -11.3872 0.0789
NP_440028.1_6 Forward -263 -245 13.9821 0.218
NP_440907.2_8 Reverse -65 -75 16.2041 0.0161
NP_440907.2_8 Forward -72 -62 9.616 0.103
NP_440907.2_8 Reverse -229 -239 3.8145 0.297
NP_441463.1_3 Forward -44 -25 -5.60541 0.23
NP_441463.1_5 Forward -74 -60 11.5043 0.232
NP_441626.1_2 Forward -72 -65 15.7721 0.0124
NP_441626.1_2 Reverse -65 -72 15.7721 0.0124
NP_442794.1_1 Forward -250 -238 5.54551 0.216
NP_442615.1_1 Forward -82 -64 6.50899 0.0344
NP_441431.1_2 Reverse -61 -75 14.7486 0.0588
NP_442020.1_1 Reverse -4 -23 0.588665 0.255
NP_441488.1_8 Forward -33 -19 8.75042 0.178
NP_441836.1_1 Forward -257 -238 15.7849 0.142
NP_441836.1_2 Forward -288 -269 8.16093 0.102
NP_441836.1_2 Forward -392 -373 -4.72043 0.262
NP_441993.1_1 Forward -252 -233 2.62889 0.256
NP_441993.1_1 Forward -79 -60 1.16703 0.284
NP_440814.1_4 Forward -82 -63 -11.8003 0.228
NP_440114.1_10 Forward -73 -59 17.5025 0.0104
NP_440114.1_10 Reverse -64 -78 15.5359 0.0249
NP_440293.1_3 Forward -254 -235 3.14605 0.192
NP_440766.1_4 Forward -195 -181 9.63603 0.0871
NP_440766.1_5 Reverse -193 -205 8.7062 0.277
NP_441237.1_9 Reverse -65 -75 17.188 0.00445
NP_439910.1_2 Forward -81 -64 -12.0559 0.0788
NP_439910.1_2 Reverse -56 -73 -12.0559 0.0788
NP_440457.1_1 Forward -77 -65 1.12062 0.245
NP_440457.1_1 Reverse -60 -72 -0.551008 0.268
NP_440798.1_6 Reverse -65 -78 3.95252 0.147
NP_440942.1_3 Reverse -328 -347 8.75091 0.207
NP_442297.1_4 Forward -77 -58 12.6269 0.263
NP_441332.1_6 Reverse -347 -357 15.4224 0.121
NP_440473.1_9 Forward -359 -340 -5.9004 0.22
NP_442509.1_9 Reverse -64 -74 17.3841 0.00128
NP_442509.1_9 Forward -73 -63 8.04271 0.192
NP_440554.1_4 Forward -72 -62 17.9746 0.0131
NP_442862.1_3 Forward -20 -3 13.3135 0.177
NP_441885.1_5 Forward -73 -63 11.3864 0.00668
NP_441885.1_5 Reverse -64 -74 11.3864 0.00668
NP_440478.1_10 Reverse -220 -234 7.57108 0.261
NP_442341.1_9 Reverse -62 -76 20.8451 0.00719
NP_442395.2_4 Reverse -181 -200 -0.689632 0.299
NP_440191.1_4 Reverse -150 -160 12.8572 0.286
NP_440423.1_6 Forward -81 -62 -20.5517 0.261
NP_443000.1_3 Forward -235 -216 10.6499 0.267
NP_443000.1_7 Reverse -62 -72 20.3345 0.00223
NP_443000.1_7 Forward -75 -65 2.04498 0.226
NP_440275.1_3 Reverse -62 -72 16.1063 0.0155
NP_440275.1_3 Forward -75 -65 9.91146 0.046
NP_440091.1_1 Forward -77 -65 1.41561 0.197
NP_440091.1_1 Reverse -60 -72 1.41561 0.197
NP_441902.1_1 Reverse -221 -240 10.815 0.282
NP_439962.1_4 Forward -254 -235 -4.32711 0.269
NP_442495.1_4 Forward -358 -348 13.2547 0.194
NP_440216.1_1 Forward -73 -59 15.9292 0.00309
NP_440216.1_1 Reverse -64 -78 6.48943 0.015
NP_440172.1_1 Forward -73 -63 17.5813 0.00421
NP_440172.1_1 Reverse -64 -74 16.303 0.00854
NP_442015.1_10 Forward -77 -64 2.47756 0.191
NP_441226.1_7 Forward -72 -65 14.4934 0.0123
NP_441226.1_7 Reverse -65 -72 14.4934 0.0123
NP_441226.1_7 Reverse -349 -356 6.52862 0.253
NP_441111.1_7 Forward -72 -64 18.7023 0.00294
NP_441111.1_7 Reverse -65 -73 18.7023 0.00294
NP_442379.1_10 Reverse -57 -74 -1.63279 0.223
NP_441766.1_2 Forward -73 -64 17.5026 0.00297
NP_441766.1_2 Reverse -64 -73 17.5026 0.00297
NP_440416.1_1 Forward -73 -54 -11.6036 0.272
NP_440416.1_9 Reverse -211 -230 -11.3086 0.149
NP_440416.1_9 Forward -300 -281 -19.3717 0.274
NP_443052.1_8 Forward -83 -64 8.84924 0.023
NP_443052.1_8 Reverse -310 -329 -11.8003 0.237
NP_442154.1_1 Forward -239 -221 -13.5505 0.217
NP_440261.1_5 Reverse -65 -78 -2.63565 0.0924
NP_440261.1_5 Forward -72 -59 -4.7006 0.165
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAACCGTATTTGAAAACCGTCTCCAGCACGTAGCGGAGTTACAGCGGATGGGGGCCAACATTAAGCTCAAAGGTAATGCCGCCTTTATCCAAGGAGTGCCTTTCCTTTCCGGTGCGCCGGTCATGTCCACGGATTTACGAGCTTCGGCGGCCCTGGTAATTGCGGGGTTAGCGGCGGAAGGCAAAACCATTGTCCAAGGTCTGCGCCATTTAGACCGGGGTTATGAGGACATTGAAGGCAAACTGCGCAAACTGGGGGCTAAGTTAACCAGGATTGAACAGCCCGTCACTCTTTAAAAATTCCGTTGATTTGATTGGGGGACTAATGGGCGATCGCCTGTTAGTCTTTTTTCTTGACTGTTGATAATGCCTTTGCCACCGGAGTATTTGCAAATTTTGCC

CDS

ATGGTAAATTCCCACCGCCTTGAAACCGACAGTATGGGGTCCCTGGAAGTCCAAGCCGATCGCCTGTGGGGAGCGCAAACCCAACGTTCCCTGATGTTTTTTGACATTGGTAGCGATGTGATGCCGCCGGATTTAATTCGGGCCTTTGCCATACTCAAAAAGGCAGCCGCCATTACCAATCAGGATTTGGGTAAATTACCAGCGGACAAGGCAGAGTTAATCATTACGGCAGCGGACGAAATCATTGCCGGGCAGTGGTTAGACCATTTCCCTCTAAGGATTTGGCAAACGGGCAGTGGCACTCAAACCAACATGAACGTGAACGAAGTGATTGCCAATCGGGCGATCGCCATTTGTGGGGGAGAATTGGGCAGTAAAAATCCCATCCATCCCAATGACCACGTCAACATGTCCCAGTCGTCTAACGATACTTTTCCTACGGCGATGCACATTGCGGCGGTGGCAGGTTTACAAACCAAGTTGATTCCCAGTTTGCAAGCTCTGAGAGATAGCCTGAATGAAAAAGCGGAATGTTTTGCAGGCATCACTAAAATTGGCCGCACCCATTTGATGGACGCAGTGCCCCTAACGTTAGGGCAGGAATTTTCCGGTTACGTGGCCCAGTTAGACCAAGGGCTGACCCAAATTAATTATTGTTTACCCGGTCTTTTGGAATTGGCCCTGGGGGGAACGGCGGTGGGTACAGGGTTAAATAGTCATCCCCAATTTGCTAAAAAAGTGGCCGAAGAAATTGCCCAGTTAACTGGTTATACCTTCATTTCTGCCCCCAACAAATTCGCCGCCCTAGCTGGCCACGAGGCGATCGCCTTTGCCAGTGGCGTGCTGAAAAGTATTGCCGCTTCCCTGATGAAAATTGCCAATGATTTGCGCTGGATGGGGTCTGGGCCCCGCTGCGGCTTGGGGGAATTAGCCTTACCAGCCAATGAACCAGGTTCTTCGATCATGCCCGGGAAAGTAAACCCCACCCAATGCGAAGCCATGACCATGGTTTGTGTGCAGGTAATGGGGAACGATGCCACCATTGGTTTTGCGGCCAGCCAAGGTAATTTTGAGCTCAATGTTTTTAAGCCAGTGATTATTCATAATTTCCTCCATTCGTTACATTTACTCAGCGATGCTTGTGCTAGTTTTCGCCAACATTTAGTGGTGGGATTACAAGTAAACGAAAGCAAGGTTAAAGACTTTTTGGACACCTCTTTAATGTTAGTCACCGCCCTCAATCCCCACATTGGCTACGACAATGCGGCCCTCGTGGCTAAAACTGCCTTTGCCCAAGGCATTACCCTCAAACAAGCCGCGGTGGATTTAGGTTTACTCACCCCAGCCCAGTTCGACGCTTGGGTCGTTCCAGAGCAGATGATTGCCCCGATTGCTGACTAG

Protein

MVNSHRLETDSMGSLEVQADRLWGAQTQRSLMFFDIGSDVMPPDLIRAFAILKKAAAITNQDLGKLPADKAELIITAADEIIAGQWLDHFPLRIWQTGSGTQTNMNVNEVIANRAIAICGGELGSKNPIHPNDHVNMSQSSNDTFPTAMHIAAVAGLQTKLIPSLQALRDSLNEKAECFAGITKIGRTHLMDAVPLTLGQEFSGYVAQLDQGLTQINYCLPGLLELALGGTAVGTGLNSHPQFAKKVAEEIAQLTGYTFISAPNKFAALAGHEAIAFASGVLKSIAASLMKIANDLRWMGSGPRCGLGELALPANEPGSSIMPGKVNPTQCEAMTMVCVQVMGNDATIGFAASQGNFELNVFKPVIIHNFLHSLHLLSDACASFRQHLVVGLQVNESKVKDFLDTSLMLVTALNPHIGYDNAALVAKTAFAQGITLKQAAVDLGLLTPAQFDAWVVPEQMIAPIAD