Your browser is old and dusty. Try Google Chrome!

Details for slr0006

ORF slr0006
Accession NP_442117.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442272.1_2 Forward -247 -228 17.9043 0.15
NP_443041.1_5 Reverse -336 -355 3.24438 0.265
NP_440259.1_4 Forward -213 -199 15.3843 0.156
NP_441098.1_3 Forward -174 -155 -6.11904 0.28
NP_442752.1_4 Forward -334 -327 12.1338 0.0546
NP_439979.1_7 Reverse -328 -345 17.6401 0.215
NP_442062.1_3 Forward -151 -132 4.71934 0.194
NP_440304.1_4 Forward -24 -14 3.22496 0.299
NP_440365.1_1 Reverse -243 -262 13.4162 0.256
NP_441594.1_6 Forward -336 -317 1.0811 0.274
NP_442110.1_7 Forward -233 -219 6.3911 0.145
NP_442475.1_8 Forward -227 -208 18.3873 0.225
NP_441738.1_2 Reverse -226 -233 8.1019 0.204
NP_441716.1_1 Reverse -266 -280 3.8345 0.259
NP_441716.1_2 Forward -253 -234 0.101718 0.266
NP_441327.1_1 Forward -268 -249 13.0554 0.184
NP_441327.1_1 Reverse -139 -158 7.86553 0.227
NP_441327.1_1 Reverse -248 -267 4.79003 0.262
NP_441486.1_1 Reverse -367 -381 -6.39192 0.294
NP_440470.1_5 Forward -149 -130 7.78217 0.269
NP_440470.1_5 Reverse -127 -146 6.54077 0.279
NP_440842.1_5 Forward -315 -296 13.0628 0.283
NP_442848.1_4 Reverse -293 -307 6.09611 0.284
NP_440376.1_1 Forward -334 -325 0.196389 0.283
NP_441077.1_2 Reverse -122 -141 3.29405 0.251
NP_441077.1_6 Forward -369 -353 5.88689 0.244
NP_440066.1_5 Forward -321 -302 10.6184 0.251
NP_440642.1_10 Reverse -323 -337 1.86729 0.287
NP_442496.1_5 Forward -341 -323 6.80398 0.275
NP_442205.1_9 Forward -243 -227 -1.71142 0.264
NP_442937.1_5 Reverse -313 -332 6.68596 0.272
NP_442321.1_4 Forward -20 -1 -8.65367 0.289
NP_442486.1_4 Forward -133 -114 10.6192 0.206
NP_442690.1_1 Forward -149 -130 -11.0136 0.221
NP_442690.1_1 Reverse -235 -254 -12.7836 0.249
NP_442911.1_2 Reverse -214 -233 -9.63698 0.26
NP_442064.1_1 Forward -391 -372 -6.98204 0.228
NP_441348.1_7 Reverse -301 -320 6.29264 0.289
NP_442002.1_9 Forward -234 -227 10.5605 0.214
NP_442032.1_5 Forward -122 -112 16.2041 0.279
NP_441294.1_7 Reverse -321 -335 8.77068 0.281
NP_441646.1_1 Reverse -313 -332 1.57275 0.231
NP_441000.1_5 Forward -144 -125 3.53858 0.286
NP_441644.1_6 Forward -304 -294 4.20782 0.245
NP_442933.1_2 Reverse -247 -265 14.2303 0.227
NP_442933.1_6 Reverse -131 -150 18.9547 0.107
NP_442554.1_8 Reverse -213 -223 3.02829 0.245
NP_442554.1_8 Reverse -296 -306 2.33998 0.274
NP_442970.1_3 Forward -266 -248 16.8192 0.151
NP_442292.1_1 Reverse -213 -222 3.7363 0.192
NP_440895.1_6 Reverse -266 -279 11.9173 0.202
NP_441741.1_6 Forward -84 -65 19.6656 0.083
NP_440620.1_4 Forward -136 -122 15.5768 0.236
NP_441758.1_10 Reverse -251 -270 -1.96793 0.275
NP_441764.1_8 Forward -245 -235 13.7033 0.284
NP_442719.1_2 Forward -145 -127 -1.9482 0.181
NP_442719.1_2 Forward -144 -126 -10.208 0.271
NP_441251.1_7 Reverse -180 -193 13.4906 0.266
NP_442227.1_2 Reverse -326 -345 5.40766 0.202
NP_441911.1_10 Forward -162 -143 8.84822 0.25
NP_441878.1_6 Reverse -294 -304 -0.0199663 0.163
NP_441534.1_9 Reverse -294 -307 18.7999 0.277
NP_441445.1_1 Forward -230 -211 4.03102 0.203
NP_440084.1_8 Forward -97 -83 8.70139 0.299
NP_441739.1_2 Forward -137 -121 2.02449 0.288
NP_441458.1_8 Reverse -246 -265 2.67657 0.294
NP_441116.1_9 Forward -211 -197 13.0776 0.241
NP_441819.1_2 Forward -259 -240 21.0555 0.0526
NP_440276.1_10 Forward -238 -224 16.6434 0.238
NP_440899.1_1 Forward -316 -297 5.87005 0.293
NP_440299.1_1 Forward -302 -289 8.37683 0.0945
NP_440695.1_6 Reverse -377 -391 10.7022 0.265
NP_441939.1_3 Reverse -301 -320 8.25926 0.177
NP_442993.1_1 Reverse -312 -328 -9.08625 0.179
NP_442386.1_9 Reverse -324 -333 4.52254 0.297
NP_442327.1_3 Forward -149 -130 11.1244 0.185
NP_442327.1_3 Forward -150 -131 9.88299 0.203
NP_441254.1_1 Reverse -259 -272 15.26 0.258
NP_442506.1_2 Forward -232 -213 4.71934 0.269
NP_441027.1_1 Forward -198 -184 13.9619 0.266
NP_442959.1_7 Reverse -331 -350 -4.52377 0.282
NP_440819.1_5 Reverse -198 -206 7.59091 0.272
NP_442114.1_6 Reverse -244 -263 9.59647 0.277
NP_441877.1_9 Forward -174 -157 3.38209 0.284
NP_441877.1_9 Reverse -124 -141 2.00546 0.292
NP_441689.1_4 Forward -251 -232 12.8432 0.239
NP_440344.1_10 Reverse -325 -342 -13.1375 0.276
NP_440282.1_10 Forward -314 -295 -10.0303 0.29
NP_440600.1_9 Reverse -239 -258 15.708 0.198
NP_440600.1_9 Forward -263 -244 9.7875 0.297
NP_442077.1_4 Reverse -91 -110 9.63589 0.154
NP_442077.1_9 Reverse -228 -247 8.45592 0.0864
NP_442845.1_2 Forward -340 -326 13.4709 0.0955
NP_442710.1_7 Reverse -248 -267 5.75208 0.129
NP_440071.1_6 Forward -344 -330 14.8714 0.241
NP_443062.1_6 Forward -229 -210 4.81767 0.214
NP_440544.1_5 Reverse -238 -245 13.8024 0.28
NP_440255.1_7 Forward -278 -261 11.6419 0.264
NP_442219.1_8 Reverse -375 -394 9.80987 0.219
NP_440648.1_6 Forward -146 -127 6.39016 0.28
NP_441004.1_2 Reverse -117 -136 -2.85214 0.266
NP_442813.1_5 Reverse -314 -333 16.8141 0.0431
NP_442366.1_3 Reverse -369 -387 1.49411 0.149
NP_440129.1_9 Forward -346 -327 5.89931 0.293
NP_440296.1_6 Forward -176 -158 12.7024 0.295
NP_442694.1_9 Reverse -177 -196 8.25926 0.277
NP_441668.1_4 Reverse -286 -305 -1.67217 0.278
NP_442515.1_1 Forward -328 -314 -4.32697 0.298
NP_441982.1_6 Reverse -197 -206 11.6259 0.288
NP_441982.1_6 Reverse -243 -252 11.053 0.288
NP_442689.1_8 Forward -145 -128 -2.61609 0.235
NP_441124.1_5 Forward -141 -131 10.2389 0.289
NP_440431.1_4 Reverse -248 -267 4.43995 0.0845
NP_440040.1_8 Reverse -245 -264 13.5117 0.14
NP_442729.1_5 Reverse -311 -321 7.94484 0.254
NP_441539.1_10 Forward -350 -331 -2.65548 0.214
NP_442348.1_2 Forward -211 -202 14.7494 0.146
NP_441432.1_8 Forward -222 -213 3.14632 0.259
NP_441432.1_9 Forward -261 -248 10.4405 0.249
NP_441432.1_9 Reverse -84 -97 8.69532 0.287
NP_442540.1_10 Reverse -348 -362 19.7641 0.131
NP_442400.1_10 Reverse -249 -262 7.70113 0.282
NP_442749.1_5 Reverse -119 -136 10.2482 0.192
NP_440025.1_3 Reverse -182 -196 14.3865 0.235
NP_440010.1_3 Reverse -333 -352 -5.9004 0.25
NP_440010.1_4 Reverse -214 -233 0.785326 0.243
NP_440034.1_4 Forward -148 -136 17.9689 0.223
NP_440912.1_3 Reverse -234 -253 12.4867 0.254
NP_440671.1_1 Forward -260 -241 9.76781 0.191
NP_442943.1_1 Forward -193 -178 4.92399 0.219
NP_442943.1_1 Reverse -130 -145 3.10562 0.285
NP_442028.1_1 Reverse -87 -100 9.89744 0.251
NP_440156.1_4 Forward -136 -126 13.2542 0.176
NP_440624.1_5 Forward -145 -127 16.7296 0.138
NP_440219.1_4 Forward -244 -231 17.6735 0.157
NP_441541.1_1 Forward -259 -241 -2.76728 0.264
NP_441541.1_1 Forward -262 -244 -2.86277 0.264
NP_441541.1_2 Reverse -240 -259 19.1113 0.122
NP_441617.1_6 Reverse -119 -138 -7.67036 0.292
NP_440546.1_4 Reverse -295 -305 8.20381 0.199
NP_440341.1_1 Forward -343 -324 6.39097 0.228
NP_442402.1_10 Forward -134 -124 13.2542 0.204
NP_441848.1_4 Reverse -130 -146 12.8982 0.195
NP_442923.1_6 Reverse -247 -261 11.4707 0.245
NP_442039.1_7 Reverse -122 -132 7.05986 0.283
NP_442829.1_2 Reverse -202 -218 8.91416 0.287
NP_442696.1_6 Reverse -218 -237 -13.7669 0.291
NP_442360.1_5 Reverse -296 -306 12.6647 0.298
NP_441102.1_2 Forward -241 -222 8.84924 0.287
NP_441252.1_6 Reverse -124 -131 11.6422 0.288
NP_442532.1_1 Forward -249 -235 11.96 0.215
NP_442532.1_2 Reverse -247 -266 15.135 0.121
NP_442532.1_4 Reverse -119 -137 10.9706 0.25
NP_442532.1_4 Reverse -223 -241 7.48014 0.297
NP_440914.1_7 Forward -264 -245 5.39487 0.29
NP_442533.1_6 Forward -304 -295 10.9145 0.0503
NP_442533.1_6 Reverse -325 -334 4.0313 0.194
NP_441697.1_5 Reverse -129 -148 -9.40638 0.268
NP_441697.1_5 Forward -158 -139 -10.6478 0.28
NP_441527.1_4 Reverse -246 -265 -7.01908 0.229
NP_441527.1_4 Reverse -249 -268 -9.97933 0.263
NP_441527.1_4 Forward -183 -164 -12.2711 0.285
NP_439965.1_3 Reverse -320 -339 9.14423 0.277
NP_442673.1_6 Reverse -118 -137 11.5064 0.295
NP_440886.1_7 Reverse -331 -341 3.42118 0.282
NP_440083.1_9 Reverse -123 -142 10.8738 0.281
NP_442614.1_2 Forward -334 -320 10.9143 0.223
NP_442459.1_7 Forward -232 -213 -0.983855 0.28
NP_442893.1_4 Reverse -116 -135 -3.14789 0.295
NP_441460.1_5 Forward -390 -376 13.5686 0.286
NP_442794.1_1 Reverse -220 -232 13.3137 0.0721
NP_441425.1_3 Forward -240 -230 17.7779 0.273
NP_439988.1_10 Reverse -247 -266 11.7109 0.213
NP_442930.1_1 Forward -138 -128 13.0576 0.239
NP_442930.1_1 Forward -137 -127 12.9592 0.239
NP_442930.1_1 Forward -98 -88 12.7626 0.239
NP_439910.1_2 Reverse -204 -221 -14.3175 0.183
NP_442514.1_5 Forward -312 -293 -8.85106 0.29
NP_442703.1_9 Reverse -234 -252 3.06741 0.3
NP_441173.1_9 Forward -132 -124 12.507 0.206
NP_442638.1_3 Forward -246 -227 14.1801 0.277
NP_442638.1_3 Reverse -123 -142 10.7424 0.298
NP_441635.1_2 Reverse -245 -264 13.3207 0.241
NP_439951.1_3 Reverse -284 -301 16.0668 0.0937
NP_442495.1_5 Forward -332 -313 6.58763 0.291
NP_442214.1_1 Forward -352 -333 13.2741 0.209
NP_441226.1_7 Reverse -326 -333 8.29857 0.205
NP_443052.1_9 Forward -322 -303 -2.75381 0.242
NP_443052.1_9 Reverse -9 -28 -5.50708 0.271
NP_442116.1_1 Reverse -310 -328 18.997 0.126
NP_442116.1_6 Reverse -130 -147 19.1505 0.0788
NP_442116.1_6 Forward -147 -130 7.78699 0.254
NP_441135.1_3 Reverse -113 -132 13.4708 0.199
NP_442154.1_1 Reverse -304 -322 -17.7788 0.267
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTTATTGCTTTGTTGAAATTACCTACCGCTGACGAAAGTTAAGTTTACCTGCTCCGTCGGGAATAGGGGATGGGAAACCACCAGCGCACAGACTAGCCCAGGGCCATATTTAGCTAAATACCATCATTAGGGACTTTTATTTATTAATTTTTAAGAAGAAAAATTGAGCGATTTTAATGGCTATGTCTGGGTATTTTTACCGAGATAAATTGTCCCAAAATCAAGAATGATAAGTTTATATAATGGTAGTCAAAACTATTTTAAAAATTTCCCCAAGTCTTGCTCCCTACCTAGATTACGTAAAAAATTAACTGTTTAGAAGCGTTTTTATACCTAGAGTCTAAATTGAGTGAACTAAGAATCTCTGTTAATCTGGAGGCAGTTTCAAGGGACAATTCA

CDS

ATGGTTACACTAGATAAAACTGCAACAAAAATCATTAAACTAAACTCCGGAGCAATCCCTGCCATTCAATCCGTCTTGGAGCAGGAAGCAATGGTCTTATTAGGTTTAGCCACTACCTATGTGCTAGTAGTCAATGGTGCTAGTCCCAGGGCAGTAGCCCAGTTGCGAGCCTTTAAGCAATTTGACAAAGACCAACCCCTAGGCATTCTCACCCGTGGCGATCGGGCCATGGATGTGGCAAAAATTCCCCCCGCCGCTAAAAAATTGATGGGTCTTTTTCCTTTGCCCATAACCCTCATTGTGGAAGCCCTGCCCAAATTAGACCCAGGTATTACCCAGGGCTTTCGGAATATTTTTATTGCCTGTCCCGATGCTTTTGTTTTCGATTTAGTGGGAGCAATGCCTTTTCCCTTGGTTTGTGCCACGGCTAAGGTAGGGGGAGAACCGGTGACTAGTTTTGAGGCGGCTAGTCGTTATTTCGAAGGGCAGGTGCCTTTAATTGGCGATGGTGGTCGATGCCGTTACGCCCGCCGGGGAACATTGATTGACTGTACTTTGCCGTTGCCCACCATTATGAATTTTGGTCCCATTTCCTTTGACGACCTGCGCCCCCTGATACCTGAAATCATTTTGCCTTCCCATCTGATGAAATAA

Protein

MVTLDKTATKIIKLNSGAIPAIQSVLEQEAMVLLGLATTYVLVVNGASPRAVAQLRAFKQFDKDQPLGILTRGDRAMDVAKIPPAAKKLMGLFPLPITLIVEALPKLDPGITQGFRNIFIACPDAFVFDLVGAMPFPLVCATAKVGGEPVTSFEAASRYFEGQVPLIGDGGRCRYARRGTLIDCTLPLPTIMNFGPISFDDLRPLIPEIILPSHLMK