Your browser is old and dusty. Try Google Chrome!

Details for slr0001

ORF slr0001
Accession NP_442110.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -311 -297 6.19444 0.123
NP_441061.1_2 Reverse -214 -228 4.91614 0.142
NP_441061.1_2 Forward -323 -309 2.94952 0.168
NP_440795.1_7 Forward -221 -214 14.6904 0.0123
NP_440795.1_7 Reverse -214 -221 14.6904 0.0123
NP_442100.1_1 Reverse -132 -151 5.29938 0.296
NP_441418.1_6 Reverse -291 -310 -10.522 0.0362
NP_441418.1_6 Reverse -349 -368 -28.6149 0.206
NP_441418.1_6 Reverse -213 -232 -29.1065 0.216
NP_441418.1_6 Reverse -294 -313 -29.4015 0.224
NP_441418.1_6 Forward -222 -203 -29.4998 0.228
NP_441418.1_6 Reverse -303 -322 -29.6965 0.234
NP_441418.1_6 Reverse -300 -319 -30.6798 0.291
NP_440815.1_5 Forward -62 -43 2.94938 0.29
NP_442291.1_5 Reverse -52 -68 -0.629782 0.187
NP_440897.1_6 Reverse -213 -232 0.293673 0.18
NP_441453.1_4 Reverse -213 -221 16.539 0.00633
NP_441453.1_4 Forward -222 -214 16.539 0.00633
NP_442151.1_6 Reverse -213 -227 18.0925 0.0083
NP_441818.1_1 Reverse -214 -225 10.1862 0.232
NP_441818.1_9 Reverse -291 -310 3.83436 0.18
NP_441642.1_8 Reverse -101 -120 12.3892 0.287
NP_440226.1_1 Forward -222 -203 7.27595 0.109
NP_440150.1_6 Reverse -210 -229 6.68596 0.223
NP_440150.1_6 Forward -225 -206 2.94938 0.263
NP_442655.1_10 Reverse -355 -374 -2.55715 0.19
NP_442655.1_10 Reverse -210 -229 -19.8634 0.292
NP_442173.1_1 Forward -221 -213 15.4574 0.00633
NP_442173.1_1 Reverse -214 -222 15.4574 0.00633
NP_442752.1_4 Forward -222 -215 13.8055 0.0199
NP_442752.1_4 Reverse -213 -220 13.8055 0.0199
NP_443027.1_4 Forward -224 -214 14.0414 0.0452
NP_443027.1_4 Reverse -211 -221 11.8781 0.0872
NP_441812.1_3 Forward -223 -209 7.47274 0.272
NP_442975.1_10 Reverse -209 -223 4.91554 0.234
NP_440784.1_7 Forward -221 -214 15.9687 0.0123
NP_440784.1_7 Reverse -214 -221 15.9687 0.0123
NP_440784.1_7 Reverse -316 -323 7.21728 0.15
NP_440061.1_9 Forward -224 -210 11.2087 0.116
NP_440061.1_9 Reverse -211 -225 10.717 0.123
NP_442062.1_8 Forward -222 -212 19.4496 0.000558
NP_442062.1_8 Reverse -213 -223 17.3846 0.00193
NP_441900.1_2 Forward -380 -362 6.90155 0.13
NP_441859.1_3 Reverse -290 -309 3.73524 0.236
NP_440304.1_4 Forward -224 -214 10.8948 0.051
NP_440304.1_4 Reverse -211 -221 1.84832 0.299
NP_442242.1_4 Forward -221 -214 14.3954 0.0124
NP_442242.1_4 Reverse -214 -221 14.3954 0.0124
NP_440044.1_8 Reverse -304 -323 0.687771 0.193
NP_441208.1_9 Forward -225 -211 6.09611 0.253
NP_441208.1_9 Forward -346 -332 5.30946 0.271
NP_441594.1_6 Reverse -306 -325 5.60432 0.209
NP_441594.1_6 Forward -231 -212 0.58944 0.282
NP_441594.1_6 Forward -321 -302 0.392778 0.287
NP_440370.1_10 Forward -231 -212 11.5042 0.181
NP_440132.1_1 Reverse -211 -229 8.37728 0.272
NP_442110.1_1 Forward -110 -91 17.101 0.198
NP_442110.1_2 Forward -355 -342 17.1313 0.136
NP_442110.1_7 Reverse -213 -227 10.816 0.0644
NP_442110.1_7 Reverse -84 -98 3.24451 0.213
NP_442110.1_7 Forward -324 -310 0.982901 0.241
NP_442367.1_1 Reverse -302 -321 -1.47551 0.26
NP_441925.1_4 Forward -316 -297 -6.68779 0.185
NP_441925.1_4 Forward -377 -358 -6.98278 0.188
NP_441083.1_5 Reverse -213 -223 20.3345 0.00053
NP_441083.1_5 Forward -222 -212 11.3864 0.0159
NP_441434.1_1 Forward -127 -113 18.728 0.0703
NP_441434.1_1 Reverse -112 -126 16.0543 0.186
NP_441434.1_7 Forward -220 -206 3.44117 0.242
NP_441738.1_2 Forward -220 -213 15.28 0.0102
NP_441738.1_2 Reverse -215 -222 15.28 0.0102
NP_441738.1_2 Reverse -55 -62 6.52862 0.261
NP_441558.1_5 Forward -224 -205 8.55425 0.147
NP_440209.1_1 Reverse -213 -221 18.1123 0.00295
NP_440209.1_1 Forward -222 -214 18.1123 0.00295
NP_442889.1_8 Reverse -210 -224 13.1753 0.0588
NP_440447.1_6 Forward -351 -333 2.67408 0.228
NP_441713.1_1 Forward -228 -209 -7.4737 0.13
NP_441713.1_1 Reverse -207 -226 -14.7502 0.259
NP_442570.1_3 Reverse -301 -320 -6.49039 0.258
NP_441716.1_1 Reverse -213 -227 22.2224 0.00332
NP_441716.1_1 Reverse -303 -317 7.47274 0.169
NP_441716.1_1 Forward -324 -310 6.88276 0.186
NP_441327.1_5 Forward -47 -38 12.7828 0.29
NP_442111.1_4 Forward -223 -209 12.4876 0.043
NP_442111.1_4 Reverse -212 -226 2.94952 0.259
NP_440343.1_9 Reverse -299 -318 7.57094 0.278
NP_440906.1_5 Forward -221 -214 15.8704 0.0124
NP_440906.1_5 Reverse -214 -221 15.8704 0.0124
NP_440906.1_5 Reverse -85 -92 8.79057 0.149
NP_440747.1_10 Forward -225 -213 17.2469 0.000522
NP_440747.1_10 Reverse -210 -222 17.0502 0.000794
NP_440747.1_10 Forward -315 -303 -11.7607 0.142
NP_440747.1_10 Reverse -312 -324 -11.7607 0.142
NP_440747.1_10 Forward -327 -315 -12.2524 0.254
NP_441130.1_10 Forward -224 -210 9.34103 0.126
NP_441854.1_8 Forward -326 -308 17.2271 0.279
NP_441486.1_1 Forward -225 -211 4.22782 0.0475
NP_441486.1_1 Reverse -210 -224 2.85119 0.074
NP_441486.1_1 Forward -96 -82 -6.09693 0.278
NP_442634.1_4 Reverse -211 -225 7.76774 0.0479
NP_441265.1_3 Forward -228 -214 3.14618 0.181
NP_440842.1_4 Forward -156 -137 3.44851 0.207
NP_442848.1_1 Forward -228 -214 -0.983719 0.263
NP_442848.1_9 Forward -317 -298 12.5858 0.144
NP_441012.1_4 Forward -226 -213 7.49244 0.272
NP_441012.1_4 Forward -316 -303 5.72248 0.291
NP_443018.1_3 Forward -221 -214 14.8871 0.0123
NP_443018.1_3 Reverse -214 -221 14.8871 0.0123
NP_443018.1_3 Reverse -220 -227 10.2655 0.107
NP_443018.1_3 Reverse -77 -84 5.34899 0.212
NP_443018.1_3 Reverse -292 -299 4.26735 0.267
NP_443018.1_3 Forward -299 -292 4.07068 0.299
NP_441634.1_8 Forward -224 -210 3.73617 0.143
NP_441634.1_8 Forward -314 -300 2.16287 0.17
NP_441634.1_8 Reverse -289 -303 -2.16369 0.295
NP_441634.1_8 Reverse -298 -312 -4.13031 0.295
NP_440376.1_1 Forward -222 -213 19.4693 0.000692
NP_440376.1_1 Reverse -213 -222 19.4693 0.000692
NP_440376.1_1 Reverse -303 -312 4.71961 0.15
NP_442687.1_7 Reverse -212 -222 15.8113 0.0125
NP_442687.1_7 Forward -223 -213 8.92815 0.0994
NP_442485.1_3 Forward -314 -295 -4.13045 0.278
NP_441846.1_10 Reverse -358 -377 -21.83 0.256
NP_442530.1_2 Forward -156 -146 11.6814 0.282
NP_440642.1_10 Forward -383 -369 3.63724 0.269
NP_441013.1_2 Reverse -208 -226 3.06741 0.231
NP_441013.1_2 Reverse -298 -316 -2.73412 0.285
NP_441422.1_7 Reverse -211 -228 -0.256152 0.163
NP_440533.1_9 Reverse -213 -232 9.14423 0.151
NP_440533.1_9 Forward -222 -203 7.37428 0.187
NP_440667.1_2 Reverse -297 -316 1.76941 0.204
NP_441950.1_7 Reverse -294 -313 0.294447 0.188
NP_441950.1_7 Reverse -297 -316 -7.96535 0.283
NP_442658.1_1 Reverse -211 -221 17.0891 0.00615
NP_442658.1_1 Forward -224 -214 6.76441 0.214
NP_440141.1_8 Reverse -294 -313 9.63589 0.214
NP_440662.1_2 Reverse -103 -122 -5.60541 0.298
NP_442782.1_2 Forward -222 -208 11.111 0.173
NP_440184.1_1 Forward -155 -136 7.66133 0.155
NP_440607.1_8 Reverse -292 -311 0.491109 0.28
NP_442300.1_1 Reverse -316 -335 3.83436 0.288
NP_441256.1_1 Forward -370 -351 -0.983855 0.217
NP_441256.1_1 Reverse -210 -229 -9.14533 0.273
NP_439959.1_6 Reverse -359 -378 14.2574 0.145
NP_442937.1_5 Reverse -208 -227 10.8159 0.152
NP_441317.1_4 Forward -351 -337 15.3844 0.161
NP_441958.1_5 Forward -223 -213 12.2714 0.00183
NP_441958.1_5 Reverse -212 -222 12.2714 0.00183
NP_441127.1_1 Reverse -300 -314 16.4209 0.1
NP_441127.1_1 Reverse -219 -233 9.2427 0.278
NP_441127.1_1 Forward -109 -95 8.25939 0.3
NP_441127.1_1 Reverse -309 -323 8.16106 0.3
NP_442486.1_6 Forward -115 -96 0.982764 0.266
NP_442836.1_5 Forward -296 -277 1.17943 0.287
NP_440203.1_5 Reverse -216 -226 15.7125 0.0611
NP_441441.1_4 Reverse -114 -128 17.9935 0.279
NP_439905.1_1 Reverse -310 -323 14.4739 0.125
NP_439905.1_1 Forward -311 -298 9.75405 0.216
NP_443001.1_7 Forward -79 -60 1.0811 0.287
NP_440984.1_7 Reverse -208 -222 6.19444 0.224
NP_439990.1_5 Forward -227 -214 20.7671 0.00296
NP_442690.1_1 Reverse -140 -159 -15.1435 0.278
NP_442911.1_2 Forward -232 -213 -2.85214 0.104
NP_442536.1_8 Reverse -288 -307 15.3391 0.187
NP_442536.1_8 Reverse -297 -316 11.2092 0.275
NP_443044.1_1 Reverse -49 -68 1.67108 0.296
NP_441129.1_3 Reverse -209 -228 -17.6018 0.281
NP_441099.1_5 Forward -232 -213 0.294447 0.0807
NP_441099.1_5 Forward -310 -291 -7.96535 0.183
NP_442002.1_9 Reverse -212 -219 10.7572 0.185
NP_441294.1_7 Reverse -209 -223 10.1145 0.207
NP_442438.1_10 Forward -227 -213 8.75105 0.0731
NP_442438.1_10 Reverse -208 -222 5.50613 0.132
NP_442431.1_10 Reverse -297 -315 6.60732 0.187
NP_442431.1_10 Reverse -288 -306 5.72234 0.197
NP_442431.1_10 Reverse -291 -309 2.77242 0.23
NP_441000.1_6 Forward -223 -209 5.99778 0.0933
NP_442771.1_1 Forward -224 -206 -5.58572 0.166
NP_440147.1_4 Reverse -211 -224 9.95071 0.0362
NP_440147.1_4 Forward -224 -211 8.47575 0.0504
NP_440147.1_4 Reverse -279 -292 3.16588 0.193
NP_441295.1_4 Forward -227 -208 14.0608 0.243
NP_441550.1_8 Forward -224 -214 12.3692 0.0336
NP_441550.1_8 Reverse -211 -221 8.82935 0.112
NP_441916.1_7 Forward -222 -212 18.4663 0.00144
NP_441916.1_7 Reverse -213 -223 10.3048 0.0261
NP_440465.1_4 Forward -223 -204 11.8975 0.217
NP_441041.1_4 Reverse -213 -232 6.4893 0.0427
NP_441041.1_4 Reverse -291 -310 1.37609 0.0808
NP_441041.1_4 Forward -222 -203 -7.76869 0.192
NP_441041.1_4 Reverse -303 -322 -11.8003 0.252
NP_441041.1_4 Reverse -84 -103 -12.0953 0.258
NP_441041.1_7 Reverse -210 -222 14.6087 0.0342
NP_442004.1_6 Reverse -213 -227 8.55439 0.14
NP_441725.1_4 Reverse -208 -222 2.94893 0.279
NP_441725.1_5 Reverse -214 -224 11.2881 0.0247
NP_441725.1_5 Forward -221 -211 2.04498 0.115
NP_439966.1_7 Reverse -211 -221 17.9741 0.00631
NP_439966.1_7 Forward -224 -214 15.8108 0.0124
NP_439966.1_7 Forward -302 -292 5.58445 0.216
NP_439966.1_9 Reverse -211 -220 0.884706 0.253
NP_442941.1_3 Reverse -214 -224 19.9412 0.00262
NP_442941.1_3 Forward -221 -211 10.7964 0.0116
NP_440289.1_2 Reverse -210 -223 11.1307 0.0212
NP_440289.1_2 Forward -225 -212 -2.93064 0.262
NP_440983.1_5 Forward -315 -296 -4.42544 0.257
NP_440983.1_5 Forward -324 -305 -7.57203 0.291
NP_440260.1_7 Forward -350 -331 -5.31042 0.261
NP_440260.1_8 Forward -231 -213 -7.65067 0.298
NP_441514.1_1 Forward -130 -120 13.6766 0.284
NP_442281.1_1 Reverse -208 -222 18.4851 0.0043
NP_442281.1_1 Forward -227 -213 8.84875 0.075
NP_441079.1_7 Reverse -119 -138 1.76863 0.177
NP_442049.1_3 Forward -364 -345 16.5191 0.154
NP_441556.1_4 Forward -312 -293 10.1015 0.286
NP_440498.1_1 Reverse -204 -222 -1.25915 0.222
NP_441644.1_6 Reverse -213 -223 17.3841 0.00127
NP_441644.1_6 Forward -222 -212 10.1076 0.0628
NP_441644.1_6 Reverse -309 -319 5.87944 0.174
NP_442215.1_2 Reverse -211 -227 4.68009 0.0831
NP_442215.1_2 Forward -326 -310 -3.08806 0.209
NP_442177.1_5 Forward -355 -341 16.1259 0.22
NP_442029.1_1 Reverse -307 -326 -13.1769 0.263
NP_442029.1_6 Reverse -208 -227 10.1275 0.182
NP_440253.1_2 Reverse -213 -231 10.6389 0.0381
NP_440929.1_8 Forward -222 -213 19.2726 0.000701
NP_440929.1_8 Reverse -213 -222 19.2726 0.000701
NP_440780.1_1 Forward -22 -3 9.02356 0.274
NP_442933.1_10 Forward -222 -213 17.601 0.00325
NP_442933.1_10 Reverse -213 -222 17.601 0.00325
NP_440576.1_2 Reverse -246 -265 11.1109 0.237
NP_441751.2_8 Reverse -214 -228 6.3911 0.0354
NP_441751.2_8 Forward -221 -207 -3.04867 0.134
NP_442926.1_3 Reverse -292 -311 12.7825 0.108
NP_442554.1_8 Reverse -214 -224 15.9097 0.00747
NP_442554.1_8 Forward -221 -211 14.1397 0.0144
NP_442554.1_8 Forward -317 -307 3.42162 0.226
NP_442554.1_8 Reverse -220 -230 2.04498 0.285
NP_441762.1_7 Forward -223 -211 2.98891 0.0676
NP_441762.1_7 Reverse -212 -224 2.30059 0.0676
NP_441762.1_7 Reverse -290 -302 -3.30428 0.1
NP_442142.1_4 Forward -225 -212 18.0132 0.0255
NP_442142.1_4 Forward -303 -290 16.3416 0.0264
NP_442142.1_4 Reverse -210 -223 15.1616 0.0289
NP_442142.1_4 Forward -321 -308 5.82024 0.182
NP_442142.1_4 Forward -315 -302 4.73861 0.212
NP_442292.1_1 Reverse -214 -223 18.486 0.00229
NP_442292.1_1 Forward -221 -212 9.63616 0.0183
NP_442476.1_6 Forward -221 -207 11.5043 0.056
NP_440895.1_6 Forward -228 -215 10.8357 0.202
NP_440895.1_6 Reverse -207 -220 9.06573 0.229
NP_441264.1_10 Reverse -297 -311 17.7975 0.139
NP_442381.1_8 Forward -225 -206 -5.21209 0.141
NP_441523.1_6 Forward -226 -207 5.211 0.239
NP_443009.1_5 Forward -223 -212 18.3477 0.00265
NP_443009.1_5 Reverse -52 -63 7.92465 0.118
NP_443009.1_5 Reverse -83 -94 6.84301 0.147
NP_442301.1_2 Forward -316 -297 10.6184 0.189
NP_442301.1_2 Forward -310 -291 5.01354 0.269
NP_441715.1_4 Forward -221 -211 18.8596 0.00741
NP_441715.1_4 Reverse -214 -224 14.828 0.0268
NP_441715.1_4 Reverse -316 -326 6.17489 0.157
NP_441448.1_1 Reverse -292 -311 4.22769 0.279
NP_440158.1_8 Reverse -301 -320 8.84924 0.292
NP_440183.1_9 Forward -316 -297 -21.0434 0.296
NP_441468.1_1 Forward -221 -214 15.8704 0.0124
NP_441468.1_1 Reverse -214 -221 15.8704 0.0124
NP_441468.1_1 Reverse -292 -299 3.97235 0.277
NP_441020.2_6 Forward -224 -207 6.43035 0.262
NP_441015.1_10 Reverse -298 -317 -2.75381 0.182
NP_441015.1_10 Reverse -208 -227 -7.67036 0.27
NP_441015.1_10 Reverse -304 -323 -9.63698 0.282
NP_441015.1_10 Reverse -356 -375 -10.522 0.284
NP_441673.1_1 Forward -222 -213 20.8459 0.000698
NP_441673.1_1 Reverse -213 -222 20.8459 0.000698
NP_441016.2_6 Forward -309 -290 9.04509 0.222
NP_442757.1_7 Reverse -296 -315 14.8474 0.172
NP_441426.1_6 Reverse -282 -301 19.0757 0.0727
NP_441826.1_2 Forward -228 -214 5.89945 0.0946
NP_441826.1_2 Forward -306 -292 -0.492064 0.213
NP_441330.1_1 Reverse -208 -227 -14.1602 0.214
NP_441637.1_9 Forward -386 -368 5.91901 0.245
NP_442490.1_4 Forward -322 -303 16.4833 0.283
NP_442490.1_9 Reverse -303 -322 -5.31042 0.273
NP_441764.1_1 Reverse -139 -158 11.4058 0.164
NP_441764.1_4 Forward -158 -141 17.621 0.0666
NP_441764.1_4 Reverse -137 -154 10.9366 0.232
NP_442868.1_6 Reverse -211 -221 10.3048 0.038
NP_442868.1_6 Forward -224 -214 9.91146 0.038
NP_441612.1_2 Reverse -213 -223 8.54929 0.21
NP_442227.1_2 Forward -307 -288 -0.0988766 0.253
NP_442227.1_2 Forward -310 -291 -2.26216 0.272
NP_442808.1_1 Reverse -212 -222 18.4657 0.00201
NP_442808.1_1 Forward -223 -213 8.63269 0.0481
NP_442808.1_1 Forward -301 -291 5.19112 0.168
NP_442775.1_6 Reverse -350 -369 9.73422 0.292
NP_440145.1_3 Forward -232 -213 16.4207 0.00993
NP_440145.1_3 Reverse -203 -222 10.5209 0.04
NP_441906.1_5 Forward -313 -294 8.84842 0.279
NP_442718.1_1 Reverse -100 -119 5.99764 0.17
NP_442718.1_2 Forward -203 -184 10.7175 0.0789
NP_442542.1_2 Reverse -211 -224 17.6205 0.0422
NP_442113.1_10 Forward -374 -355 -6.49039 0.263
NP_442050.1_5 Forward -224 -214 16.4991 0.00812
NP_442050.1_5 Reverse -211 -221 6.96107 0.27
NP_442342.1_9 Reverse -211 -227 8.02334 0.194
NP_442342.1_9 Forward -345 -329 5.17175 0.241
NP_440385.1_8 Forward -152 -133 10.1695 0.25
NP_440558.1_2 Forward -231 -212 9.43923 0.102
NP_440558.1_2 Forward -321 -302 1.27776 0.182
NP_440558.1_2 Forward -346 -327 0.687771 0.188
NP_440558.1_2 Reverse -306 -325 -6.29373 0.273
NP_440558.1_2 Reverse -204 -223 -6.98204 0.284
NP_440274.1_4 Forward -112 -94 3.85406 0.157
NP_442593.1_7 Forward -318 -299 12.5858 0.252
NP_441878.1_6 Forward -223 -213 10.4031 0.0176
NP_441878.1_6 Reverse -212 -222 10.4031 0.0176
NP_441878.1_6 Forward -344 -334 -7.0998 0.204
NP_441878.1_6 Reverse -302 -312 -7.39479 0.222
NP_441036.1_8 Reverse -212 -222 17.7779 0.000554
NP_441036.1_8 Forward -223 -213 8.33817 0.174
NP_442650.1_2 Reverse -213 -227 6.6861 0.13
NP_441557.1_5 Forward -222 -213 19.9609 0.000699
NP_441557.1_5 Reverse -213 -222 19.9609 0.000699
NP_441445.1_1 Reverse -300 -319 5.30933 0.172
NP_441445.1_1 Reverse -294 -313 4.03102 0.203
NP_441445.1_1 Reverse -204 -223 3.34271 0.215
NP_442419.1_2 Forward -227 -208 1.96607 0.238
NP_442419.1_2 Reverse -208 -227 -0.0988766 0.243
NP_440101.1_3 Reverse -298 -317 15.2408 0.0613
NP_440101.1_3 Reverse -208 -227 5.60432 0.192
NP_440101.1_5 Reverse -206 -225 1.67108 0.249
NP_441458.1_8 Reverse -141 -160 2.48435 0.295
NP_442183.1_1 Reverse -213 -227 7.07942 0.149
NP_442183.1_1 Forward -222 -208 6.29277 0.18
NP_442183.1_9 Reverse -297 -307 11.3864 0.206
NP_442166.1_3 Forward -346 -327 -10.1286 0.264
NP_442397.1_9 Reverse -302 -321 7.07928 0.246
NP_440356.1_10 Reverse -305 -323 12.1139 0.253
NP_441116.1_9 Reverse -118 -132 17.4042 0.126
NP_441574.1_1 Reverse -297 -316 13.9625 0.0793
NP_441574.1_1 Reverse -291 -310 6.58763 0.112
NP_442347.1_2 Reverse -214 -223 12.4878 0.056
NP_442347.1_2 Forward -221 -212 11.1111 0.056
NP_442347.1_2 Reverse -95 -104 5.99792 0.201
NP_442645.1_2 Forward -230 -211 -14.4552 0.175
NP_441037.1_4 Reverse -211 -221 6.92787 0.237
NP_441633.1_3 Reverse -211 -224 5.62415 0.0481
NP_441633.1_3 Reverse -65 -78 1.69091 0.109
NP_441633.1_3 Forward -224 -211 1.39592 0.109
NP_441633.1_3 Reverse -332 -345 -6.86388 0.277
NP_440136.1_2 Forward -221 -214 15.9687 0.0123
NP_440136.1_2 Reverse -214 -221 15.9687 0.0123
NP_440136.1_2 Reverse -85 -92 3.97235 0.288
NP_442590.1_10 Reverse -297 -316 8.35759 0.208
NP_442998.1_10 Forward -220 -213 15.5754 0.0102
NP_442998.1_10 Reverse -215 -222 15.5754 0.0102
NP_442998.1_10 Forward -288 -281 7.21728 0.144
NP_440899.1_8 Forward -386 -367 -2.26216 0.221
NP_440299.1_1 Forward -226 -213 22.3398 0.000547
NP_440299.1_1 Reverse -209 -222 8.47516 0.0926
NP_440299.1_1 Forward -304 -291 6.41022 0.143
NP_440299.1_1 Forward -316 -303 2.18201 0.294
NP_441799.1_1 Reverse -209 -223 11.897 0.0503
NP_441799.1_1 Forward -226 -212 7.86545 0.13
NP_441007.1_10 Reverse -295 -308 4.34585 0.182
NP_440256.1_1 Forward -225 -206 5.80098 0.0334
NP_441559.1_8 Reverse -208 -222 2.85119 0.143
NP_441559.1_8 Forward -227 -213 2.75286 0.143
NP_440915.1_6 Forward -226 -212 3.8345 0.1
NP_440915.1_6 Reverse -209 -223 2.94952 0.11
NP_440717.1_2 Reverse -294 -313 -2.65548 0.238
NP_441704.1_8 Forward -233 -214 13.6666 0.112
NP_442452.1_8 Forward -228 -214 13.6669 0.273
NP_442866.1_1 Reverse -298 -317 -3.83545 0.222
NP_442866.1_6 Forward -353 -334 11.4058 0.182
NP_441464.1_8 Reverse -334 -348 10.816 0.178
NP_441464.1_10 Forward -353 -339 14.7492 0.166
NP_440702.1_2 Reverse -356 -375 -7.67036 0.286
NP_442993.1_1 Forward -222 -206 0.451859 0.0636
NP_442993.1_1 Reverse -213 -229 -7.21796 0.146
NP_442386.1_9 Reverse -212 -221 15.7322 0.0144
NP_442386.1_9 Forward -223 -214 13.8639 0.0289
NP_442386.1_9 Forward -301 -292 6.58748 0.219
NP_442386.1_9 Reverse -99 -108 6.19416 0.23
NP_442386.1_9 Reverse -327 -336 4.7192 0.289
NP_441340.1_5 Forward -221 -214 15.6737 0.0124
NP_441340.1_5 Reverse -214 -221 15.6737 0.0124
NP_439976.1_5 Reverse -24 -38 11.4053 0.268
NP_440161.1_3 Forward -369 -350 7.7676 0.287
NP_440586.1_1 Reverse -299 -318 3.53937 0.202
NP_440586.1_1 Reverse -296 -315 -1.08219 0.237
NP_440586.1_8 Forward -221 -214 13.2151 0.026
NP_440586.1_8 Reverse -214 -221 13.2151 0.026
NP_440586.1_8 Reverse -220 -227 9.08521 0.178
NP_440586.1_8 Reverse -292 -299 7.70858 0.227
NP_440586.1_8 Reverse -310 -317 5.8403 0.283
NP_440586.1_8 Forward -311 -304 5.64364 0.297
NP_442251.1_6 Forward -221 -214 15.2804 0.0124
NP_442251.1_6 Reverse -214 -221 15.2804 0.0124
NP_441262.1_3 Reverse -213 -220 14.7888 0.0223
NP_441262.1_3 Forward -222 -215 14.7888 0.0223
NP_440027.1_3 Forward -318 -300 11.2281 0.159
NP_443051.1_1 Reverse -212 -221 10.4228 0.00754
NP_443051.1_1 Forward -223 -214 10.4228 0.00754
NP_439984.1_10 Forward -372 -358 11.9953 0.246
NP_439937.1_9 Reverse -212 -229 -8.61494 0.176
NP_439937.1_9 Reverse -98 -115 -13.0398 0.279
NP_440408.1_3 Forward -330 -311 0.58944 0.204
NP_440439.1_1 Reverse -210 -223 10.2457 0.0372
NP_440439.1_1 Forward -225 -212 7.29578 0.0664
NP_442239.1_8 Reverse -293 -312 11.1109 0.239
NP_439943.1_7 Forward -295 -276 9.73422 0.168
NP_439943.1_7 Forward -227 -208 7.17762 0.208
NP_440372.1_2 Forward -221 -214 16.3621 0.0124
NP_440372.1_2 Reverse -214 -221 16.3621 0.0124
NP_440271.1_2 Reverse -349 -368 7.7676 0.23
NP_441803.1_2 Forward -317 -298 2.75272 0.204
NP_441803.1_2 Forward -308 -289 0.392778 0.253
NP_439977.1_5 Reverse -207 -226 14.7491 0.0531
NP_442368.1_10 Reverse -287 -306 15.2408 0.27
NP_440139.1_1 Reverse -207 -226 13.8633 0.0567
NP_441572.1_7 Forward -228 -209 -0.688862 0.182
NP_441572.1_7 Reverse -207 -226 -5.21209 0.253
NP_440267.1_2 Forward -329 -315 8.16044 0.173
NP_442384.1_10 Reverse -213 -226 17.4239 0.00585
NP_442384.1_10 Forward -222 -209 10.2457 0.0465
NP_442384.1_10 Reverse -303 -316 6.01747 0.113
NP_442384.1_10 Forward -324 -311 3.5592 0.186
NP_442114.1_4 Forward -222 -211 9.20345 0.17
NP_440364.1_6 Reverse -212 -225 14.375 0.275
NP_441877.1_5 Forward -293 -274 0.982764 0.276
NP_441877.1_9 Forward -157 -140 8.59364 0.228
NP_441877.1_9 Reverse -137 -154 6.23369 0.284
NP_441018.1_7 Reverse -305 -324 7.7676 0.265
NP_442790.1_4 Reverse -204 -223 -14.0619 0.271
NP_442262.1_10 Forward -221 -214 14.1988 0.0123
NP_442262.1_10 Reverse -214 -221 14.1988 0.0123
NP_442262.1_10 Reverse -220 -227 9.18389 0.211
NP_442262.1_10 Reverse -77 -84 7.6106 0.274
NP_441689.1_5 Forward -224 -214 15.3192 0.0403
NP_441814.1_5 Forward -338 -319 11.7992 0.186
NP_440163.1_10 Forward -225 -215 12.4681 0.159
NP_440344.1_10 Forward -229 -212 1.21881 0.0311
NP_440344.1_10 Reverse -206 -223 -5.76269 0.109
NP_442910.1_1 Reverse -46 -65 -3.73712 0.254
NP_440487.1_1 Reverse -210 -229 -4.13045 0.214
NP_440562.1_3 Reverse -214 -231 13.8052 0.0648
NP_440562.1_3 Reverse -335 -352 2.20212 0.298
NP_441965.1_7 Forward -317 -298 11.0117 0.296
NP_441965.1_10 Forward -321 -305 3.69678 0.256
NP_441640.1_8 Reverse -214 -233 -2.26216 0.226
NP_442750.1_3 Forward -244 -225 -11.0136 0.236
NP_440297.1_9 Reverse -214 -224 9.32148 0.0917
NP_440297.1_9 Reverse -220 -230 0.0783647 0.282
NP_440297.1_9 Forward -221 -211 -0.118297 0.282
NP_441592.1_4 Reverse -213 -232 -1.7705 0.259
NP_441896.1_3 Forward -231 -212 0.0977854 0.23
NP_440894.1_10 Forward -348 -329 2.26107 0.292
NP_442129.1_6 Forward -146 -127 12.9769 0.295
NP_440999.1_9 Reverse -209 -223 10.4227 0.0529
NP_440999.1_9 Forward -304 -290 0.88457 0.174
NP_440999.1_9 Reverse -299 -313 0.687908 0.177
NP_440999.1_9 Forward -313 -299 -0.787057 0.217
NP_440888.1_2 Reverse -213 -227 16.8135 0.00536
NP_440888.1_2 Forward -222 -208 12.487 0.0442
NP_441748.1_3 Forward -326 -307 18.1213 0.142
NP_442948.1_2 Forward -223 -204 5.01433 0.256
NP_442948.1_2 Reverse -212 -231 3.93269 0.278
NP_442033.1_10 Reverse -211 -230 16.7157 0.025
NP_440575.1_8 Forward -238 -219 -7.4737 0.298
NP_441543.1_2 Forward -221 -212 18.486 0.00236
NP_441543.1_2 Reverse -214 -223 16.9127 0.00359
NP_442845.1_2 Forward -228 -214 12.6843 0.104
NP_442845.1_2 Reverse -303 -317 8.84938 0.185
NP_442845.1_2 Reverse -213 -227 7.86607 0.195
NP_441551.1_5 Reverse -209 -225 7.82599 0.241
NP_441319.1_5 Forward -336 -317 13.9625 0.236
NP_441319.1_8 Forward -318 -300 9.85225 0.205
NP_441918.1_7 Reverse -290 -309 0.0977854 0.297
NP_441469.1_8 Reverse -212 -221 16.126 0.00797
NP_441469.1_8 Forward -223 -214 6.48957 0.227
NP_442315.1_1 Reverse -292 -310 15.1621 0.095
NP_442315.1_1 Reverse -301 -319 4.9357 0.256
NP_443064.1_6 Reverse -213 -223 12.5669 0.0796
NP_442337.1_8 Forward -362 -343 0.392778 0.252
NP_442578.1_7 Forward -221 -214 14.5921 0.026
NP_442578.1_7 Reverse -214 -221 14.5921 0.026
NP_441462.1_2 Forward -222 -212 11.5831 0.00406
NP_441462.1_2 Reverse -213 -223 11.5831 0.00406
NP_441621.1_7 Forward -224 -210 -3.24533 0.188
NP_441621.1_7 Reverse -211 -225 -3.34366 0.188
NP_443062.1_1 Forward -222 -204 5.42569 0.229
NP_443062.1_6 Forward -230 -211 1.0811 0.28
NP_442204.1_1 Forward -226 -215 9.69511 0.0736
NP_442204.1_1 Reverse -209 -220 1.82863 0.266
NP_442204.1_5 Reverse -203 -222 -0.688862 0.296
NP_440516.1_8 Forward -222 -213 16.9127 0.00442
NP_440516.1_8 Reverse -213 -222 16.9127 0.00442
NP_442428.1_5 Forward -221 -214 15.8704 0.0124
NP_442428.1_5 Reverse -214 -221 15.8704 0.0124
NP_442428.1_5 Reverse -292 -299 4.36568 0.271
NP_442859.1_2 Forward -227 -208 2.26107 0.28
NP_442120.1_10 Reverse -297 -316 -8.752 0.238
NP_442120.1_10 Reverse -30 -49 -8.85033 0.239
NP_442120.1_10 Reverse -207 -226 -16.0285 0.296
NP_440673.1_2 Reverse -299 -318 16.9256 0.0543
NP_440673.1_3 Forward -298 -291 13.2155 0.0426
NP_440673.1_3 Forward -220 -213 12.4288 0.0426
NP_440673.1_3 Reverse -215 -222 12.4288 0.0426
NP_440865.1_9 Reverse -207 -226 -7.57203 0.247
NP_441052.1_2 Reverse -213 -223 19.9412 0.00106
NP_441052.1_2 Forward -222 -212 10.5014 0.0285
NP_441052.1_2 Reverse -315 -325 5.19158 0.128
NP_441052.1_2 Forward -324 -314 5.09324 0.132
NP_441052.1_2 Reverse -303 -313 4.99491 0.135
NP_441052.1_2 Forward -318 -308 4.60159 0.154
NP_442219.1_8 Forward -232 -213 9.32671 0.233
NP_442219.1_9 Reverse -214 -223 17.7976 0.00718
NP_442219.1_9 Forward -221 -212 8.35786 0.0681
NP_442219.1_9 Reverse -304 -313 1.86802 0.295
NP_440436.1_4 Forward -221 -212 18.1905 0.00233
NP_440436.1_4 Reverse -214 -223 17.2072 0.00233
NP_440436.1_4 Forward -299 -290 9.73406 0.0871
NP_440436.1_4 Forward -92 -83 8.45576 0.105
NP_441884.1_9 Reverse -297 -316 -21.24 0.235
NP_440314.1_9 Forward -221 -202 -7.67036 0.241
NP_440314.1_9 Reverse -214 -233 -7.96535 0.243
NP_440314.1_9 Reverse -335 -354 -9.14533 0.26
NP_440041.1_2 Reverse -301 -320 -6.39206 0.296
NP_442907.1_9 Forward -311 -292 -2.85214 0.257
NP_441719.1_4 Forward -221 -214 16.3621 0.0124
NP_441719.1_4 Reverse -214 -221 16.3621 0.0124
NP_441733.1_10 Forward -225 -212 7.49244 0.153
NP_441004.1_1 Reverse -297 -316 -10.3253 0.219
NP_441004.1_1 Reverse -352 -371 -17.4051 0.291
NP_441004.1_3 Reverse -294 -313 7.7676 0.204
NP_442366.1_3 Reverse -212 -230 4.05072 0.101
NP_442366.1_3 Forward -223 -205 -4.99573 0.28
NP_440296.1_6 Reverse -113 -131 11.843 0.295
NP_442206.1_10 Reverse -213 -228 4.40479 0.178
NP_443054.1_2 Forward -224 -210 3.14618 0.24
NP_443054.1_2 Reverse -332 -346 -0.000409212 0.283
NP_442430.1_2 Forward -322 -303 4.03102 0.268
NP_441851.1_10 Reverse -212 -222 16.008 0.00552
NP_441851.1_10 Forward -223 -213 15.8113 0.00552
NP_442700.1_4 Forward -298 -279 12.3892 0.15
NP_441542.1_4 Forward -349 -335 3.53951 0.272
NP_442856.1_7 Reverse -204 -223 8.84924 0.101
NP_442856.1_7 Reverse -306 -325 -1.37718 0.225
NP_442515.1_1 Reverse -333 -347 12.586 0.0337
NP_442515.1_1 Forward -223 -209 3.14618 0.124
NP_441396.1_5 Reverse -362 -371 8.65285 0.21
NP_441683.1_7 Reverse -357 -376 -7.17871 0.272
NP_441982.1_6 Forward -157 -148 10.7665 0.292
NP_440463.1_8 Reverse -293 -312 7.49989 0.264
NP_441046.1_2 Reverse -298 -317 6.29264 0.221
NP_441349.1_10 Reverse -203 -222 5.50599 0.0432
NP_441349.1_10 Forward -232 -213 -0.295539 0.0936
NP_441349.1_10 Forward -334 -315 -5.11376 0.192
NP_441409.1_6 Forward -228 -209 20.4523 0.0044
NP_441409.1_6 Reverse -207 -226 -14.7502 0.266
NP_441409.1_7 Forward -286 -267 10.4225 0.261
NP_441107.1_10 Reverse -218 -232 14.7492 0.235
NP_440432.1_9 Forward -299 -284 -2.8717 0.176
NP_440432.1_9 Forward -92 -77 -4.05167 0.196
NP_440726.1_2 Forward -316 -297 1.67108 0.278
NP_441477.1_10 Forward -229 -211 6.11567 0.184
NP_440877.1_1 Reverse -329 -348 8.25926 0.296
NP_442450.1_5 Forward -224 -214 9.32148 0.115
NP_440588.1_2 Forward -231 -212 11.8975 0.0305
NP_440588.1_2 Reverse -204 -223 -0.000545616 0.149
NP_440588.1_2 Forward -333 -314 -6.58872 0.285
NP_440040.1_8 Forward -144 -125 17.7133 0.11
NP_441570.1_1 Reverse -303 -321 -3.81576 0.0729
NP_441570.1_1 Reverse -213 -231 -16.5988 0.249
NP_441570.1_1 Forward -228 -210 -17.1888 0.267
NP_440078.1_10 Forward -222 -203 6.09597 0.224
NP_441078.1_4 Forward -222 -213 19.6659 0.0007
NP_441078.1_4 Reverse -213 -222 19.6659 0.0007
NP_441078.1_4 Forward -343 -334 -1.08191 0.222
NP_441078.1_4 Reverse -334 -343 -1.6719 0.266
NP_441078.1_4 Reverse -303 -312 -1.96689 0.282
NP_442729.1_5 Reverse -308 -318 17.6796 0.0748
NP_442729.1_5 Reverse -290 -300 15.713 0.199
NP_442729.1_8 Forward -226 -213 8.37742 0.125
NP_441663.1_6 Reverse -283 -302 16.8141 0.196
NP_441663.1_8 Reverse -207 -226 -1.57384 0.243
NP_442443.1_1 Reverse -362 -381 0.982764 0.212
NP_442443.1_1 Reverse -295 -314 -1.96717 0.246
NP_440793.1_1 Forward -383 -369 11.012 0.279
NP_441091.1_5 Reverse -209 -228 2.94938 0.286
NP_440526.1_3 Reverse -214 -225 7.92465 0.126
NP_441432.1_8 Forward -223 -214 16.8143 0.00595
NP_441432.1_8 Reverse -212 -221 8.25953 0.0755
NP_441432.1_8 Reverse -333 -342 5.21127 0.185
NP_442320.1_8 Reverse -207 -221 8.16106 0.0184
NP_442320.1_8 Forward -228 -214 5.89945 0.0309
NP_442344.1_7 Forward -221 -202 5.11266 0.0638
NP_441732.1_2 Forward -226 -210 -7.41462 0.0849
NP_441732.1_2 Reverse -209 -225 -16.3627 0.165
NP_441732.1_2 Reverse -330 -346 -16.7561 0.195
NP_441732.1_2 Forward -316 -300 -16.9527 0.223
NP_442797.1_1 Forward -310 -291 6.98095 0.152
NP_440199.1_10 Forward -225 -215 7.64985 0.231
NP_441057.1_4 Reverse -290 -308 -1.45582 0.272
NP_441057.1_4 Reverse -299 -317 -2.73412 0.275
NP_440913.1_1 Reverse -289 -307 5.62401 0.237
NP_440713.1_4 Reverse -305 -324 6.78429 0.185
NP_442489.1_7 Forward -222 -213 20.1576 0.000695
NP_442489.1_7 Reverse -213 -222 20.1576 0.000695
NP_442489.1_7 Reverse -303 -312 -1.47524 0.203
NP_442489.1_7 Forward -343 -334 -2.06522 0.288
NP_442079.1_7 Reverse -214 -233 4.03102 0.2
NP_442079.1_7 Reverse -292 -311 -0.0988766 0.29
NP_440559.1_1 Reverse -214 -223 17.4043 0.00658
NP_440559.1_1 Forward -221 -212 8.75118 0.0586
NP_440559.1_1 Forward -299 -290 4.62128 0.24
NP_441659.2_8 Reverse -213 -223 18.1713 0.00133
NP_441659.2_8 Forward -222 -212 11.9764 0.0147
NP_441040.1_5 Reverse -208 -227 2.94938 0.275
NP_441040.1_5 Reverse -276 -295 1.86774 0.296
NP_441800.1_7 Forward -308 -290 7.98396 0.113
NP_441800.1_7 Forward -317 -299 5.82068 0.176
NP_442346.1_2 Reverse -208 -227 5.60432 0.281
NP_442346.1_5 Forward -223 -213 16.6963 0.00248
NP_442346.1_5 Reverse -212 -222 9.02648 0.118
NP_442346.1_5 Reverse -308 -318 4.89658 0.269
NP_440545.1_3 Forward -226 -209 3.87375 0.0775
NP_440545.1_3 Reverse -209 -226 -2.51776 0.187
NP_440555.1_1 Forward -233 -214 0.58944 0.294
NP_441923.1_6 Reverse -292 -306 9.5377 0.278
NP_440486.1_6 Reverse -302 -321 13.3725 0.207
NP_440010.1_4 Forward -310 -291 4.62021 0.22
NP_440010.1_4 Reverse -209 -228 4.32522 0.22
NP_440010.1_4 Forward -316 -297 -0.787962 0.262
NP_440010.1_4 Forward -328 -309 -1.18128 0.267
NP_440010.1_4 Forward -322 -303 -3.54122 0.299
NP_440010.1_10 Forward -234 -215 4.62101 0.244
NP_442603.1_7 Reverse -213 -227 19.7634 0.00895
NP_441888.1_7 Reverse -208 -222 3.93283 0.225
NP_441888.1_7 Forward -305 -291 2.16287 0.225
NP_441833.1_4 Forward -221 -214 15.9687 0.0124
NP_441833.1_4 Reverse -214 -221 15.9687 0.0124
NP_441833.1_4 Reverse -85 -92 4.56234 0.248
NP_441329.1_6 Forward -268 -249 6.73176 0.179
NP_441895.1_10 Forward -159 -140 -19.5684 0.282
NP_442060.1_5 Reverse -296 -315 11.8975 0.29
NP_442162.1_9 Forward -221 -214 16.2637 0.0124
NP_442162.1_9 Reverse -214 -221 16.2637 0.0124
NP_440671.1_4 Forward -228 -214 18.3875 0.0136
NP_440671.1_4 Reverse -207 -221 9.14437 0.184
NP_440224.1_1 Forward -233 -214 -0.590531 0.144
NP_440772.1_10 Forward -137 -118 10.1973 0.284
NP_442199.1_5 Reverse -205 -224 -2.65548 0.191
NP_442140.1_3 Reverse -292 -302 16.7946 0.0255
NP_442140.1_3 Forward -221 -211 14.238 0.0486
NP_442140.1_3 Reverse -310 -320 5.78156 0.197
NP_442140.1_3 Reverse -214 -224 4.40493 0.243
NP_440875.1_9 Forward -220 -210 17.327 0.0126
NP_441813.1_5 Reverse -211 -221 19.4496 0.00647
NP_441813.1_5 Forward -224 -214 15.9097 0.01
NP_440590.1_4 Reverse -214 -227 6.1158 0.0583
NP_440590.1_4 Forward -221 -208 3.65753 0.0702
NP_440567.1_1 Reverse -214 -228 6.58777 0.0816
NP_440567.1_1 Forward -221 -207 4.22782 0.126
NP_442497.1_10 Forward -221 -212 10.4228 0.0087
NP_442497.1_10 Reverse -214 -223 10.4228 0.0087
NP_440821.1_4 Forward -224 -214 18.2696 0.00448
NP_440821.1_4 Reverse -211 -221 10.2065 0.0163
NP_441239.1_9 Reverse -211 -223 14.1986 0.0288
NP_441239.1_9 Forward -224 -212 6.92215 0.173
NP_441239.1_9 Forward -302 -290 2.98891 0.3
NP_441727.1_8 Reverse -298 -317 2.26107 0.197
NP_440400.1_1 Forward -309 -290 -1.37794 0.285
NP_441892.1_1 Reverse -210 -227 8.69197 0.0769
NP_441892.1_1 Reverse -75 -92 -5.1727 0.275
NP_441508.1_4 Reverse -342 -356 15.2903 0.244
NP_442629.1_5 Reverse -359 -373 15.0442 0.279
NP_441769.1_3 Reverse -188 -207 -5.70449 0.249
NP_442216.1_4 Forward -376 -368 8.08217 0.255
NP_440949.1_7 Reverse -335 -354 16.9115 0.144
NP_440546.1_4 Forward -222 -212 11.8882 0.0679
NP_440546.1_4 Reverse -291 -301 11.2095 0.0923
NP_440546.1_4 Reverse -213 -223 10.046 0.109
NP_440546.1_4 Reverse -309 -319 6.94336 0.269
NP_442041.1_5 Forward -311 -292 -0.000545616 0.266
NP_441230.1_5 Reverse -208 -227 6.88262 0.168
NP_440462.1_6 Reverse -211 -221 17.2863 0.00752
NP_440462.1_6 Forward -224 -214 7.74818 0.0699
NP_442340.1_3 Forward -316 -297 -9.53865 0.275
NP_442611.1_1 Forward -222 -203 12.2908 0.07
NP_442611.1_1 Reverse -213 -232 -2.0655 0.284
NP_440868.1_4 Reverse -209 -221 17.3452 0.0124
NP_440868.1_4 Forward -226 -214 6.1355 0.0878
NP_440868.1_8 Reverse -299 -318 1.57275 0.227
NP_440401.1_9 Reverse -340 -347 14.5917 0.287
NP_442499.1_1 Reverse -329 -348 5.30933 0.225
NP_442499.1_3 Reverse -212 -230 5.13236 0.284
NP_441848.1_4 Forward -262 -246 8.98304 0.288
NP_441848.1_4 Forward -160 -144 8.3146 0.288
NP_442039.1_4 Forward -221 -214 15.1821 0.0124
NP_442039.1_4 Reverse -214 -221 15.1821 0.0124
NP_442039.1_10 Reverse -61 -79 14.178 0.227
NP_442679.1_1 Reverse -366 -385 -2.55715 0.24
NP_442829.1_2 Reverse -380 -396 12.4896 0.287
NP_442786.1_2 Forward -58 -39 19.5277 0.0812
NP_442837.1_3 Forward -221 -214 15.7721 0.0124
NP_442837.1_3 Reverse -214 -221 15.7721 0.0124
NP_439994.1_3 Reverse -212 -231 7.85324 0.298
NP_442053.1_1 Forward -222 -213 18.3876 0.0007
NP_442053.1_1 Reverse -213 -222 18.3876 0.0007
NP_440505.1_3 Forward -224 -214 16.303 0.00696
NP_440505.1_3 Reverse -211 -221 15.9097 0.00857
NP_441203.1_1 Reverse -214 -233 -18.9784 0.297
NP_440914.1_1 Reverse -213 -223 17.5935 0.000537
NP_440914.1_1 Forward -222 -212 8.6151 0.186
NP_440914.1_1 Reverse -84 -94 7.05364 0.254
NP_440914.1_2 Reverse -297 -316 17.994 0.233
NP_441011.1_8 Forward -221 -212 16.9127 0.00602
NP_441011.1_8 Reverse -214 -223 8.25953 0.144
NP_442101.1_10 Forward -230 -211 -8.85033 0.242
NP_442533.1_1 Reverse -352 -371 -13.6686 0.237
NP_442533.1_6 Forward -222 -213 17.2076 0.00137
NP_442533.1_6 Reverse -213 -222 17.2076 0.00137
NP_442533.1_6 Forward -312 -303 5.70292 0.132
NP_442533.1_6 Reverse -315 -324 2.16301 0.27
NP_442322.1_4 Forward -315 -298 -9.69657 0.296
NP_440854.1_7 Reverse -123 -137 15.0024 0.246
NP_441219.1_8 Reverse -99 -118 16.2232 0.158
NP_441482.1_7 Forward -228 -214 0.589577 0.0554
NP_441482.1_7 Reverse -207 -221 -0.983719 0.0612
NP_439944.1_9 Reverse -214 -224 19.0562 0.00329
NP_441697.1_5 Forward -161 -142 -8.16498 0.256
NP_441697.1_5 Reverse -119 -138 -9.31089 0.268
NP_440116.1_8 Reverse -214 -233 -3.63879 0.157
NP_440115.1_6 Forward -225 -215 9.41981 0.115
NP_440115.1_6 Reverse -210 -220 7.64985 0.146
NP_440007.1_9 Forward -226 -212 1.86788 0.282
NP_439965.1_1 Reverse -204 -223 -2.16383 0.177
NP_441680.1_10 Forward -145 -126 15.6079 0.263
NP_441961.1_4 Forward -345 -326 8.35759 0.262
NP_440608.1_6 Reverse -335 -354 3.44025 0.29
NP_442673.1_5 Reverse -93 -111 19.1937 0.126
NP_441106.1_1 Reverse -212 -221 18.191 0.0028
NP_441106.1_1 Forward -223 -214 9.63616 0.0311
NP_442928.1_6 Reverse -303 -316 16.8339 0.275
NP_442306.1_10 Forward -227 -208 -19.3717 0.197
NP_441286.1_1 Reverse -212 -224 11.8387 0.0114
NP_441286.1_1 Forward -223 -211 6.03717 0.0258
NP_440670.1_8 Forward -222 -213 18.3876 0.000699
NP_440670.1_8 Reverse -213 -222 18.3876 0.000699
NP_441705.1_3 Forward -51 -32 -2.55715 0.284
NP_440886.1_7 Reverse -212 -222 17.7774 0.0011
NP_440886.1_7 Forward -304 -294 11.9759 0.0805
NP_440886.1_7 Forward -223 -213 7.94438 0.0805
NP_440886.1_7 Forward -371 -361 5.28945 0.188
NP_440828.1_4 Forward -319 -300 2.9486 0.152
NP_442614.1_2 Reverse -367 -381 11.996 0.172
NP_442614.1_2 Reverse -213 -227 9.2427 0.242
NP_442614.1_2 Reverse -309 -323 7.66941 0.268
NP_441808.1_8 Reverse -297 -316 15.9291 0.152
NP_442022.1_4 Reverse -297 -316 13.2741 0.166
NP_440907.2_8 Forward -221 -211 7.94438 0.117
NP_442264.1_2 Forward -232 -215 14.2968 0.133
NP_442264.1_2 Forward -347 -330 7.31533 0.242
NP_442264.1_2 Reverse -299 -316 6.23369 0.265
NP_440841.1_4 Forward -224 -205 4.03102 0.0964
NP_441463.1_2 Reverse -134 -152 0.466766 0.269
NP_441463.1_3 Reverse -203 -222 -0.787193 0.133
NP_441463.1_3 Forward -310 -291 -3.04881 0.167
NP_441463.1_3 Forward -322 -303 -5.9004 0.235
NP_441463.1_6 Forward -224 -210 8.83177 0.25
NP_441626.1_2 Forward -221 -214 15.7721 0.0124
NP_441626.1_2 Reverse -214 -221 15.7721 0.0124
NP_442365.1_7 Forward -226 -207 -3.83545 0.225
NP_442794.1_1 Forward -226 -214 19.7052 0.00523
NP_442615.1_1 Reverse -204 -222 15.1621 0.00922
NP_442615.1_1 Forward -231 -213 -5.29072 0.209
NP_441962.1_4 Reverse -214 -233 -8.16202 0.196
NP_440387.1_1 Reverse -213 -229 5.36841 0.0325
NP_440387.1_1 Forward -222 -206 -1.71142 0.143
NP_440855.1_5 Forward -224 -205 11.11 0.238
NP_441431.1_2 Reverse -210 -224 10.422 0.159
NP_441836.1_2 Reverse -297 -316 5.30933 0.125
NP_441836.1_2 Reverse -207 -226 0.982764 0.197
NP_441836.1_2 Forward -324 -305 -3.04881 0.233
NP_440634.1_10 Forward -315 -296 19.0748 0.124
NP_441993.1_1 Forward -228 -209 9.4509 0.136
NP_441993.1_1 Reverse -309 -328 1.65431 0.273
NP_440467.1_8 Forward -315 -296 10.2259 0.288
NP_440114.1_10 Forward -222 -208 8.84938 0.192
NP_442437.1_8 Reverse -292 -311 7.17762 0.242
NP_442698.1_10 Reverse -366 -385 -1.08219 0.297
NP_441853.1_5 Reverse -316 -335 8.84924 0.245
NP_441510.2_7 Reverse -337 -351 10.1271 0.281
NP_440293.1_3 Reverse -301 -320 -5.60541 0.28
NP_440766.1_4 Forward -226 -212 17.5025 0.0255
NP_440766.1_4 Forward -97 -83 0.589577 0.276
NP_440766.1_5 Forward -158 -146 11.9529 0.25
NP_440766.1_5 Reverse -105 -117 9.47014 0.275
NP_439988.1_7 Reverse -212 -226 11.5037 0.292
NP_440422.1_10 Forward -388 -369 7.20946 0.24
NP_440422.1_10 Forward -193 -174 4.69232 0.281
NP_442930.1_1 Forward -150 -140 11.1893 0.26
NP_442930.1_1 Reverse -246 -256 10.1076 0.278
NP_439910.1_2 Reverse -205 -222 -21.889 0.195
NP_439910.1_2 Forward -230 -213 -22.184 0.215
NP_440457.1_1 Forward -226 -214 8.29878 0.101
NP_440457.1_1 Reverse -209 -221 0.628964 0.25
NP_440798.1_6 Forward -221 -208 2.57589 0.17
NP_440801.1_8 Forward -319 -300 -0.983855 0.275
NP_440142.1_7 Reverse -214 -233 7.07928 0.259
NP_442297.1_4 Reverse -209 -228 12.2379 0.276
NP_441984.1_1 Reverse -297 -315 12.3105 0.19
NP_441889.1_4 Forward -231 -212 -0.295539 0.296
NP_442509.1_9 Forward -222 -212 16.2041 0.00739
NP_442509.1_9 Reverse -213 -223 8.14104 0.192
NP_442582.1_3 Forward -18 -4 18.5371 0.0839
NP_442514.1_10 Forward -324 -305 9.73422 0.253
NP_440554.1_4 Forward -221 -211 16.4996 0.0189
NP_440554.1_4 Reverse -214 -224 7.05986 0.106
NP_441885.1_5 Reverse -213 -223 20.9245 0.000538
NP_441885.1_5 Forward -222 -212 11.4848 0.00668
NP_440478.1_10 Forward -302 -288 6.48943 0.291
NP_442341.1_7 Reverse -212 -226 16.1259 0.0186
NP_442341.1_7 Forward -313 -299 7.27608 0.109
NP_442341.1_7 Forward -223 -209 1.17956 0.297
NP_442341.1_9 Reverse -211 -225 19.5668 0.00907
NP_441756.1_5 Reverse -311 -330 -4.42544 0.294
NP_441173.1_9 Reverse -149 -157 14.0803 0.17
NP_442395.2_4 Forward -223 -204 -0.591301 0.298
NP_443000.1_7 Forward -224 -214 17.0896 0.00865
NP_443000.1_7 Reverse -211 -221 11.5831 0.0344
NP_443000.1_7 Forward -326 -316 4.89658 0.158
NP_443000.1_7 Reverse -313 -323 1.94665 0.226
NP_440507.2_3 Forward -231 -212 23.4013 0.00495
NP_440507.2_3 Forward -321 -302 8.75009 0.244
NP_440275.1_3 Reverse -211 -221 15.418 0.0178
NP_440275.1_3 Forward -224 -214 8.1415 0.0602
NP_440091.1_1 Reverse -209 -221 1.41561 0.197
NP_440091.1_1 Forward -226 -214 -0.452677 0.273
NP_440679.1_10 Reverse -296 -315 -9.047 0.18
NP_441207.1_7 Reverse -379 -393 14.4833 0.179
NP_441207.1_7 Reverse -172 -186 9.06177 0.282
NP_440175.1_4 Forward -230 -211 -6.09707 0.166
NP_441105.1_3 Reverse -202 -221 1.37609 0.114
NP_441105.1_3 Forward -329 -310 -1.96717 0.154
NP_442373.1_2 Reverse -291 -310 -5.01543 0.213
NP_440216.1_1 Forward -222 -208 15.4376 0.00367
NP_440216.1_1 Reverse -213 -227 -10.3252 0.145
NP_440216.1_1 Reverse -315 -329 -11.2101 0.169
NP_440216.1_9 Forward -316 -307 7.37455 0.286
NP_440172.1_1 Reverse -213 -223 15.0247 0.00945
NP_440172.1_1 Forward -222 -212 8.73149 0.0586
NP_440172.1_1 Reverse -281 -291 2.83163 0.264
NP_440167.1_3 Reverse -318 -337 8.65258 0.28
NP_442788.1_5 Forward -244 -225 15.7324 0.284
NP_442015.1_10 Forward -226 -213 18.8988 0.00492
NP_442015.1_10 Reverse -209 -222 11.7207 0.0372
NP_442015.1_10 Reverse -311 -324 4.24752 0.177
NP_442015.1_10 Forward -316 -303 3.65753 0.178
NP_441045.1_6 Forward -310 -292 15.063 0.284
NP_441226.1_7 Forward -221 -214 14.4934 0.0123
NP_441226.1_7 Reverse -214 -221 14.4934 0.0123
NP_441111.1_7 Forward -221 -213 18.7023 0.00294
NP_441111.1_7 Reverse -214 -222 18.7023 0.00294
NP_441766.1_2 Forward -222 -213 17.5026 0.00297
NP_441766.1_2 Reverse -213 -222 17.5026 0.00297
NP_440416.1_1 Forward -222 -203 -2.26216 0.116
NP_440416.1_9 Forward -229 -210 1.47442 0.0451
NP_440416.1_9 Forward -319 -300 -7.76869 0.106
NP_440416.1_9 Reverse -206 -225 -14.8485 0.18
NP_443052.1_8 Reverse -203 -222 7.37428 0.0281
NP_443052.1_9 Forward -307 -288 0.58944 0.194
NP_443052.1_9 Forward -313 -294 -3.3438 0.249
NP_443052.1_9 Forward -316 -297 -7.17871 0.294
NP_443052.1_9 Forward -310 -291 -7.27704 0.295
NP_440072.1_3 Reverse -292 -311 19.174 0.24
NP_442116.1_6 Forward -177 -160 8.8374 0.238
NP_442116.1_6 Reverse -146 -163 6.06813 0.287
NP_440591.1_9 Forward -229 -211 5.03403 0.258
NP_442154.1_1 Reverse -292 -310 22.1436 0.0132
NP_442154.1_1 Reverse -301 -319 4.05072 0.0591
NP_441430.1_6 Reverse -323 -342 11.7992 0.25
NP_440261.1_5 Forward -221 -208 -2.73398 0.0924
NP_440261.1_5 Reverse -214 -227 -2.93064 0.0983
NP_440261.1_5 Reverse -335 -348 -12.4687 0.297
NP_440988.1_10 Forward -111 -97 6.06058 0.234
NP_440988.1_10 Forward -224 -210 5.4797 0.243
NP_440988.1_10 Forward -320 -306 3.64026 0.285
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGTAAAGGGCTTCAATTTTTTCGTTACTTCCCCCACCACTACCCTGATTGGTTTTGGGGTTATTGCCTTTGCAACTGGTGCTCACCATGGCCAACACCGCCACCATCGCTAGATATTGCCTAACCTGTTTACGATAAATAGGCCGAGAAATATTACCGGGGAAATGATTTGGTTCCATGGCGATCGCCGGGTCACACAGTAATGATGGAATTATTGTATTGAGATTTTCTCGGAATAAACTAATTGGTAAAAATTATTTACGAAAGAATCATGAAAATTAGCTAATTTCAGCGCCATTGGGACCAAATGCGATCCTTCAATGGGGTTGATTAGAGGACAGGGATTGTTAAGCTAAGGAAATATGGACTGCCAAATTGTCATTCAATCTTGAGAAAATATC

CDS

GTGCTAGACGAACAAGCAAAGAAAACCCTCCTGCGTAAAATTCCCCACGGCCTCTACGTCTGTGGTGTTAAGTCCGGAGAAGAAGCCAATGGTTTCACCGCCAGTTGGGTAATGCAGGGTTCCTTTGAGCCGCCCCTGGTGGTTAATTGCGTGCGCACTGATTCCATTTCCCATCGGCTGTTACAGGAAAGTGGCCAGTTTGCCCTCAGTTTTCTGGCGGCGGACCAAAAAGATGTGGCGGCGCAATTTTTTAAACCCCAACGGCGGGTGGGGGACAAGTTTGAAAATTTTGATGTGCTTGATGCCCCCGAAACCGGTTGTCCTGTGCTCAAAGACTGTCTCGGTTATGTGGAGTGTCGGGTGGTAGGGTCTGTGGCCCACGGCGATCACACCGTTTTTGTCGGCGAAGTCATTGGAGCCCAGGTTTTTAATGAAGGAGATCCCTTATTACTAGAAAGCACTGGCTGGAACTACGGCGGTTAG

Protein

MLDEQAKKTLLRKIPHGLYVCGVKSGEEANGFTASWVMQGSFEPPLVVNCVRTDSISHRLLQESGQFALSFLAADQKDVAAQFFKPQRRVGDKFENFDVLDAPETGCPVLKDCLGYVECRVVGSVAHGDHTVFVGEVIGAQVFNEGDPLLLESTGWNYGG