Your browser is old and dusty. Try Google Chrome!

Details for sll2015

ORF sll2015
Accession NP_441028.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -155 -141 12.0943 0.222
NP_441061.1_2 Forward -154 -140 7.86607 0.0956
NP_441061.1_2 Forward -186 -172 4.62115 0.146
NP_440557.1_1 Forward -154 -135 -1.08219 0.27
NP_440795.1_7 Forward -154 -147 14.6904 0.0123
NP_440795.1_7 Reverse -147 -154 14.6904 0.0123
NP_440795.1_10 Reverse -287 -306 12.29 0.242
NP_441418.1_6 Forward -155 -136 8.94757 0.00332
NP_441418.1_6 Reverse -178 -197 -29.3032 0.221
NP_441418.1_6 Forward -187 -168 -29.4015 0.224
NP_442291.1_5 Reverse -177 -193 2.41848 0.126
NP_442291.1_5 Reverse -145 -161 -0.826444 0.189
NP_440897.1_6 Reverse -146 -165 9.24175 0.0705
NP_440897.1_6 Reverse -187 -206 9.14342 0.0705
NP_440897.1_6 Forward -308 -289 -5.01617 0.298
NP_441453.1_1 Reverse -139 -157 6.99988 0.221
NP_441453.1_4 Reverse -146 -154 16.539 0.00633
NP_441453.1_4 Forward -155 -147 16.539 0.00633
NP_441453.1_4 Reverse -178 -186 6.70593 0.121
NP_442151.1_6 Forward -155 -141 12.4876 0.0722
NP_442838.1_7 Reverse -141 -160 -9.047 0.232
NP_440226.1_1 Forward -155 -136 6.88262 0.118
NP_440226.1_1 Reverse -146 -165 6.78429 0.119
NP_441465.1_8 Reverse -167 -185 5.32902 0.29
NP_442169.1_1 Forward -81 -62 -2.75381 0.28
NP_441630.1_3 Forward -163 -144 5.30933 0.143
NP_440259.1_4 Reverse -33 -47 14.6131 0.201
NP_442623.1_3 Forward -154 -135 -8.16202 0.127
NP_442173.1_1 Forward -154 -146 15.4574 0.00633
NP_442173.1_1 Reverse -147 -155 15.4574 0.00633
NP_442173.1_1 Forward -186 -178 5.82095 0.2
NP_442752.1_4 Reverse -178 -185 13.8055 0.0199
NP_442752.1_4 Forward -155 -148 13.8055 0.0199
NP_442752.1_4 Reverse -146 -153 13.8055 0.0199
NP_443027.1_4 Reverse -144 -154 13.943 0.0452
NP_443027.1_4 Forward -157 -147 13.2547 0.0521
NP_443027.1_4 Reverse -176 -186 10.9931 0.109
NP_443027.1_4 Reverse -185 -195 9.02648 0.18
NP_442975.1_10 Reverse -142 -156 21.6317 0.000774
NP_442975.1_10 Forward -41 -27 5.50552 0.219
NP_440784.1_7 Forward -154 -147 15.9687 0.0123
NP_440784.1_7 Reverse -147 -154 15.9687 0.0123
NP_440784.1_7 Forward -186 -179 6.23397 0.241
NP_440784.1_7 Reverse -179 -186 6.13563 0.241
NP_440110.1_6 Forward -211 -192 11.4058 0.297
NP_440878.1_9 Reverse -136 -155 -2.16383 0.258
NP_442062.1_8 Forward -155 -145 19.4496 0.000558
NP_442062.1_8 Reverse -146 -156 10.3048 0.0493
NP_442062.1_8 Reverse -178 -188 9.22315 0.0658
NP_440761.1_4 Reverse -141 -160 -13.4719 0.257
NP_441859.1_3 Forward -156 -137 7.57013 0.157
NP_441859.1_3 Reverse -219 -238 1.17865 0.293
NP_440304.1_4 Forward -157 -147 10.8948 0.051
NP_440304.1_4 Reverse -144 -154 9.91146 0.051
NP_442242.1_4 Forward -154 -147 14.3954 0.0124
NP_442242.1_4 Reverse -147 -154 14.3954 0.0124
NP_442242.1_4 Reverse -179 -186 12.4288 0.0393
NP_441208.1_1 Forward -142 -123 -4.72043 0.263
NP_441208.1_9 Reverse -143 -157 5.99778 0.254
NP_441594.1_6 Reverse -137 -156 -0.0988766 0.297
NP_442196.1_10 Forward -157 -138 15.9291 0.149
NP_442110.1_7 Forward -155 -141 10.226 0.0684
NP_440300.1_5 Reverse -355 -373 12.1295 0.271
NP_440856.1_4 Forward -162 -143 9.83255 0.0546
NP_440856.1_7 Forward -155 -136 -6.68705 0.246
NP_441083.1_5 Forward -155 -145 11.3864 0.0159
NP_441083.1_5 Reverse -146 -156 11.2881 0.0159
NP_442827.1_8 Reverse -138 -157 8.55343 0.0799
NP_441434.1_1 Reverse -317 -331 7.45999 0.278
NP_441434.1_7 Forward -153 -139 5.40779 0.225
NP_441738.1_2 Forward -185 -178 15.28 0.0102
NP_441738.1_2 Forward -153 -146 15.28 0.0102
NP_441738.1_2 Reverse -148 -155 15.28 0.0102
NP_441558.1_5 Forward -157 -138 22.6156 0.00172
NP_441955.1_8 Reverse -172 -189 11.7402 0.207
NP_440209.1_1 Reverse -146 -154 18.1123 0.00295
NP_440209.1_1 Forward -155 -147 18.1123 0.00295
NP_440209.1_1 Reverse -178 -186 14.8674 0.012
NP_442136.1_4 Forward -227 -208 5.30853 0.295
NP_442889.1_1 Forward -92 -73 -2.55715 0.145
NP_442889.1_8 Reverse -143 -157 3.73557 0.273
NP_440447.1_6 Reverse -138 -156 1.19912 0.267
NP_441713.1_1 Reverse -140 -159 -6.78538 0.121
NP_441770.1_5 Reverse -155 -174 4.71934 0.213
NP_441770.1_10 Forward -157 -138 12.9791 0.214
NP_440178.1_7 Forward -156 -137 -21.83 0.241
NP_442111.1_4 Reverse -145 -159 10.7177 0.0518
NP_442111.1_4 Forward -156 -142 9.83269 0.0575
NP_440906.1_5 Forward -154 -147 15.8704 0.0124
NP_440906.1_5 Reverse -147 -154 15.8704 0.0124
NP_440906.1_5 Forward -186 -179 12.0355 0.0724
NP_440906.1_5 Reverse -179 -186 12.0355 0.0724
NP_442442.1_5 Reverse -153 -172 10.4225 0.205
NP_440747.1_10 Forward -158 -146 7.31547 0.00577
NP_440747.1_10 Reverse -143 -155 -2.02597 0.0196
NP_440747.1_10 Forward -190 -178 -12.2524 0.254
NP_441130.1_10 Reverse -176 -190 20.6491 0.00768
NP_441130.1_10 Reverse -144 -158 10.0294 0.117
NP_441130.1_10 Forward -157 -143 8.94771 0.131
NP_442973.1_5 Forward -164 -145 10.2259 0.287
NP_441486.1_1 Forward -190 -176 -1.77037 0.175
NP_441486.1_1 Reverse -143 -157 -3.34366 0.178
NP_441486.1_1 Reverse -175 -189 -5.80194 0.26
NP_442850.1_10 Forward -256 -237 20.6365 0.107
NP_442634.1_4 Forward -157 -143 5.80112 0.051
NP_442634.1_4 Reverse -144 -158 -3.147 0.161
NP_442634.1_4 Reverse -278 -292 -4.7203 0.217
NP_441265.1_3 Reverse -140 -154 2.94952 0.181
NP_440470.1_5 Reverse -260 -279 7.59119 0.274
NP_441014.1_10 Reverse -298 -317 7.96345 0.139
NP_442848.1_1 Reverse -140 -154 -3.24533 0.263
NP_443018.1_3 Forward -154 -147 14.8871 0.0123
NP_443018.1_3 Reverse -147 -154 14.8871 0.0123
NP_443018.1_3 Reverse -221 -228 6.62729 0.168
NP_443018.1_3 Forward -186 -179 5.34899 0.212
NP_443018.1_3 Reverse -179 -186 5.34899 0.212
NP_441634.1_8 Forward -157 -143 15.1426 0.0248
NP_441634.1_8 Forward -88 -74 1.86788 0.178
NP_441182.1_1 Reverse -126 -142 9.98996 0.28
NP_440376.1_1 Forward -155 -146 19.4693 0.000692
NP_440376.1_1 Reverse -146 -155 19.4693 0.000692
NP_440376.1_1 Reverse -178 -187 -0.000272808 0.285
NP_440376.1_1 Forward -187 -178 -0.0986038 0.285
NP_441857.1_5 Reverse -139 -157 7.00065 0.189
NP_441588.1_4 Forward -185 -175 6.96153 0.178
NP_441588.1_4 Forward -153 -143 6.96153 0.178
NP_442687.1_7 Reverse -145 -155 15.8113 0.0125
NP_442687.1_7 Forward -156 -146 9.02648 0.0994
NP_442687.1_7 Reverse -177 -187 5.19158 0.217
NP_442687.1_7 Reverse -27 -37 4.89658 0.23
NP_442191.1_4 Forward -154 -140 15.3562 0.0603
NP_441013.1_2 Forward -201 -183 -4.8974 0.299
NP_442296.1_9 Reverse -140 -159 -2.0655 0.219
NP_441763.1_10 Reverse -135 -154 8.16011 0.22
NP_440360.1_8 Reverse -179 -198 18.289 0.233
NP_442658.1_1 Reverse -144 -154 18.7607 0.00222
NP_442658.1_1 Forward -157 -147 14.2375 0.0237
NP_442658.1_1 Forward -189 -179 11.8776 0.0697
NP_442658.1_1 Reverse -176 -186 6.0761 0.238
NP_442782.1_2 Reverse -280 -294 1.17956 0.282
NP_442782.1_2 Reverse -146 -160 0.982901 0.282
NP_442205.1_9 Forward -140 -124 -2.5964 0.272
NP_441414.1_9 Reverse -146 -165 4.22769 0.0552
NP_441414.1_9 Forward -187 -168 -10.9153 0.297
NP_441958.1_5 Forward -156 -146 21.2195 0.000805
NP_441958.1_5 Reverse -145 -155 12.2714 0.00183
NP_441958.1_5 Reverse -177 -187 -6.41148 0.28
NP_439905.1_1 Reverse -147 -160 8.27909 0.234
NP_439905.1_1 Reverse -179 -192 7.39411 0.262
NP_440984.1_7 Forward -160 -146 12.0943 0.122
NP_440984.1_7 Reverse -141 -155 10.6193 0.122
NP_440985.1_10 Forward -232 -213 15.8307 0.225
NP_442911.1_2 Reverse -136 -155 0.294447 0.0682
NP_442911.1_2 Forward -165 -146 -0.0988766 0.0718
NP_442911.1_2 Reverse -201 -220 -5.99873 0.172
NP_441580.1_6 Reverse -135 -154 13.6675 0.0472
NP_440153.1_5 Reverse -147 -161 5.30946 0.191
NP_440153.1_5 Forward -154 -140 3.93283 0.199
NP_441591.1_10 Forward -157 -138 6.88262 0.275
NP_440369.1_5 Forward -98 -79 8.94757 0.276
NP_443055.1_6 Reverse -232 -250 -2.24319 0.291
NP_440993.1_2 Forward -160 -144 14.6115 0.0631
NP_440993.1_2 Reverse -141 -157 3.89344 0.256
NP_440993.1_3 Reverse -136 -155 -2.16459 0.297
NP_440169.1_10 Forward -115 -96 15.7324 0.245
NP_441099.1_5 Reverse -136 -155 5.80098 0.0469
NP_441099.1_5 Reverse -93 -112 -10.817 0.262
NP_442002.1_9 Reverse -177 -184 10.7572 0.185
NP_442002.1_9 Reverse -145 -152 10.7572 0.185
NP_441654.1_6 Forward -335 -317 14.3258 0.278
NP_441294.1_7 Reverse -142 -156 13.0902 0.0747
NP_442438.1_10 Reverse -141 -155 17.7975 0.0179
NP_441000.1_6 Reverse -145 -159 4.71948 0.0933
NP_441000.1_6 Reverse -177 -191 3.8345 0.104
NP_441000.1_6 Forward -156 -142 -3.34366 0.221
NP_441000.1_6 Forward -188 -174 -3.93365 0.225
NP_440147.1_4 Forward -157 -144 18.4072 0.00407
NP_440147.1_4 Reverse -144 -157 10.4424 0.0355
NP_441175.1_2 Forward -211 -192 10.7175 0.175
NP_441550.1_8 Forward -157 -147 15.8108 0.0132
NP_441550.1_8 Reverse -144 -154 10.501 0.066
NP_441916.1_7 Reverse -146 -156 18.9579 0.00144
NP_441916.1_7 Forward -155 -145 18.4663 0.00144
NP_441041.1_4 Forward -155 -136 0.392778 0.0881
NP_441041.1_7 Reverse -143 -155 19.5648 0.00277
NP_441041.1_7 Forward -158 -146 7.22324 0.171
NP_441725.1_4 Forward -160 -146 2.75226 0.279
NP_441725.1_5 Forward -154 -144 9.02648 0.0553
NP_441725.1_5 Reverse -147 -157 1.94665 0.115
NP_441725.1_5 Forward -186 -176 1.55333 0.133
NP_439966.1_7 Reverse -144 -154 17.4824 0.00636
NP_439966.1_7 Forward -157 -147 14.3359 0.0203
NP_439966.1_7 Reverse -176 -186 8.63269 0.132
NP_439966.1_7 Forward -189 -179 6.46942 0.18
NP_439966.1_9 Reverse -144 -153 10.7178 0.0863
NP_439966.1_9 Reverse -176 -185 0.983037 0.253
NP_442941.1_3 Reverse -147 -157 19.2529 0.00262
NP_442941.1_3 Forward -154 -144 2.53664 0.14
NP_442941.1_3 Forward -186 -176 1.74999 0.147
NP_440289.1_2 Reverse -143 -156 12.9006 0.0132
NP_440289.1_2 Forward -158 -145 -3.52063 0.267
NP_440289.1_2 Reverse -175 -188 -4.40561 0.288
NP_440983.1_2 Reverse -164 -183 4.03102 0.297
NP_440983.1_5 Reverse -131 -150 1.67108 0.209
NP_442281.1_1 Reverse -141 -155 17.6985 0.00542
NP_442281.1_1 Reverse -173 -187 8.16044 0.0845
NP_442281.1_1 Reverse -72 -86 2.35894 0.269
NP_442281.1_1 Reverse -182 -196 1.76896 0.29
NP_442281.1_5 Forward -152 -133 19.8614 0.0775
NP_441334.1_7 Forward -157 -138 -10.3253 0.12
NP_441334.1_7 Reverse -144 -163 -20.2567 0.275
NP_442901.1_4 Reverse -326 -345 2.75272 0.278
NP_442256.1_2 Reverse -144 -162 -8.33898 0.221
NP_440437.1_1 Forward -161 -142 2.45773 0.133
NP_440647.1_9 Forward -150 -132 3.3624 0.279
NP_441457.1_7 Forward -157 -138 6.78429 0.171
NP_441457.1_7 Forward -136 -117 4.71934 0.206
NP_441556.1_4 Reverse -242 -261 12.5117 0.214
NP_441556.1_4 Reverse -134 -153 10.0051 0.286
NP_441644.1_6 Reverse -146 -156 19.0557 0.000803
NP_441644.1_6 Forward -155 -145 10.1076 0.0628
NP_441644.1_6 Reverse -178 -188 3.32285 0.288
NP_442215.1_2 Reverse -144 -160 -4.56302 0.235
NP_440253.1_2 Forward -155 -137 6.60732 0.0778
NP_440929.1_8 Forward -155 -146 19.2726 0.000701
NP_440929.1_8 Reverse -146 -155 19.2726 0.000701
NP_440929.1_8 Forward -187 -178 7.86621 0.0522
NP_440929.1_8 Reverse -178 -187 7.57121 0.0706
NP_442933.1_10 Forward -155 -146 17.601 0.00325
NP_442933.1_10 Reverse -146 -155 17.601 0.00325
NP_442933.1_10 Reverse -178 -187 5.40793 0.19
NP_441751.2_8 Reverse -147 -161 -2.16369 0.132
NP_441751.2_8 Forward -186 -172 -4.7203 0.179
NP_442926.1_3 Forward -145 -126 4.81767 0.248
NP_442554.1_8 Reverse -147 -157 17.2863 0.00543
NP_442554.1_8 Forward -154 -144 16.008 0.0065
NP_442554.1_8 Forward -186 -176 4.10993 0.198
NP_442167.1_6 Forward -343 -327 11.0709 0.256
NP_441762.1_7 Forward -156 -144 12.527 0.0142
NP_441762.1_7 Reverse -145 -157 2.30059 0.0676
NP_441762.1_7 Reverse -177 -189 -5.07423 0.187
NP_441762.1_7 Forward -188 -176 -5.17256 0.191
NP_442142.1_4 Reverse -143 -156 14.4733 0.0311
NP_442142.1_4 Forward -158 -145 6.21356 0.17
NP_442142.1_4 Reverse -217 -230 4.64028 0.214
NP_442142.1_9 Reverse -171 -190 9.0459 0.254
NP_442292.1_1 Reverse -147 -156 17.5026 0.00435
NP_442292.1_1 Forward -154 -145 9.63616 0.0183
NP_442292.1_1 Forward -186 -177 -0.0986038 0.239
NP_442292.1_1 Reverse -179 -188 -0.786921 0.287
NP_442476.1_6 Reverse -147 -161 1.96621 0.199
NP_442476.1_6 Reverse -179 -193 1.76955 0.205
NP_442381.1_8 Reverse -143 -162 -2.95047 0.126
NP_441711.1_4 Reverse -137 -156 9.14423 0.144
NP_443009.1_5 Forward -156 -145 19.626 0.00102
NP_443009.1_5 Reverse -145 -156 7.82632 0.118
NP_441741.1_6 Reverse -278 -297 12.2908 0.247
NP_442741.1_7 Forward -155 -136 15.0441 0.196
NP_441715.1_4 Reverse -147 -157 16.7946 0.0106
NP_441715.1_4 Forward -154 -144 9.32148 0.097
NP_441715.1_4 Forward -186 -176 6.56821 0.138
NP_440279.1_2 Forward -222 -203 5.211 0.277
NP_441448.1_1 Reverse -191 -210 6.68596 0.245
NP_442076.1_8 Reverse -200 -219 6.98095 0.262
NP_440379.1_5 Forward -138 -119 -2.65548 0.199
NP_440379.1_5 Forward -152 -133 -8.65367 0.253
NP_441468.1_1 Forward -154 -147 15.8704 0.0124
NP_441468.1_1 Reverse -147 -154 15.8704 0.0124
NP_441468.1_1 Forward -186 -179 6.13563 0.209
NP_441468.1_1 Reverse -179 -186 6.0373 0.223
NP_441020.2_6 Reverse -144 -161 15.0835 0.0446
NP_441020.2_6 Forward -157 -140 9.08529 0.18
NP_441020.2_6 Forward -145 -128 5.54538 0.298
NP_441015.1_10 Forward -139 -120 -10.7186 0.287
NP_441673.1_1 Forward -155 -146 20.8459 0.000698
NP_441673.1_1 Reverse -146 -155 20.8459 0.000698
NP_441673.1_1 Forward -187 -178 1.27803 0.155
NP_441673.1_1 Reverse -178 -187 1.27803 0.155
NP_441826.1_2 Reverse -140 -154 13.9626 0.0213
NP_441826.1_2 Forward -226 -212 -4.81863 0.3
NP_441330.1_1 Forward -160 -141 -1.57384 0.0791
NP_441637.1_9 Forward -276 -258 -2.14413 0.292
NP_442868.1_6 Forward -157 -147 10.4031 0.038
NP_442868.1_6 Reverse -144 -154 8.53483 0.0555
NP_441612.1_2 Forward -295 -285 15.2294 0.209
NP_442227.1_2 Reverse -127 -146 -1.57384 0.264
NP_442361.1_3 Reverse -140 -153 10.5407 0.272
NP_442361.1_3 Reverse -172 -185 7.78743 0.288
NP_442808.1_1 Reverse -145 -155 18.4657 0.00201
NP_442808.1_1 Forward -156 -146 8.73102 0.0481
NP_442808.1_1 Forward -188 -178 8.53436 0.0493
NP_440145.1_4 Reverse -212 -222 14.0409 0.264
NP_442542.1_2 Reverse -249 -262 12.114 0.114
NP_442542.1_2 Reverse -144 -157 10.344 0.126
NP_442542.1_9 Reverse -139 -153 21.6317 0.00646
NP_442542.1_9 Reverse -171 -185 9.73373 0.13
NP_442505.1_2 Reverse -368 -387 16.1319 0.175
NP_442050.1_5 Forward -157 -147 15.9091 0.0091
NP_442050.1_5 Reverse -144 -154 8.23937 0.234
NP_442739.1_2 Reverse -340 -359 9.98091 0.291
NP_441518.1_3 Reverse -168 -187 -5.01543 0.122
NP_441518.1_3 Reverse -136 -155 -6.1954 0.132
NP_441878.1_6 Forward -156 -146 10.5014 0.0176
NP_441878.1_6 Reverse -145 -155 10.4031 0.0176
NP_441878.1_6 Reverse -27 -37 -7.49312 0.231
NP_441036.1_8 Reverse -145 -155 17.7779 0.000554
NP_441036.1_8 Forward -156 -146 15.713 0.00724
NP_441036.1_8 Forward -188 -178 15.2213 0.0116
NP_441557.1_5 Forward -155 -146 19.9609 0.000699
NP_441557.1_5 Reverse -146 -155 19.9609 0.000699
NP_441557.1_5 Forward -187 -178 7.66954 0.0443
NP_441557.1_5 Reverse -178 -187 0.983037 0.0911
NP_442066.2_4 Forward -155 -136 -2.0655 0.211
NP_442066.2_9 Forward -159 -146 12.409 0.154
NP_442066.2_9 Reverse -142 -155 8.37742 0.185
NP_441433.1_8 Reverse -246 -265 4.71934 0.178
NP_441433.1_8 Forward -148 -129 -2.0655 0.265
NP_441308.1_8 Reverse -144 -154 9.22315 0.226
NP_440101.1_3 Forward -160 -141 0.392778 0.299
NP_442183.1_1 Forward -155 -141 11.406 0.0702
NP_440979.1_3 Reverse -179 -197 23.1269 0.0533
NP_441574.1_1 Forward -172 -153 -7.08038 0.283
NP_442347.1_2 Forward -154 -145 11.1111 0.056
NP_442347.1_2 Reverse -147 -156 3.34298 0.284
NP_442645.1_2 Forward -163 -144 -21.535 0.29
NP_441037.1_4 Reverse -144 -154 16.2838 0.0168
NP_441037.1_4 Forward -157 -147 7.22024 0.237
NP_441037.1_4 Reverse -176 -186 5.95329 0.289
NP_441633.1_3 Forward -157 -144 13.3923 0.018
NP_441633.1_3 Forward -189 -176 5.03416 0.0629
NP_441633.1_3 Reverse -144 -157 -3.81562 0.177
NP_441633.1_3 Reverse -209 -222 -5.09393 0.223
NP_440136.1_2 Forward -154 -147 15.9687 0.0123
NP_440136.1_2 Reverse -147 -154 15.9687 0.0123
NP_440136.1_2 Forward -186 -179 6.23397 0.171
NP_440136.1_2 Reverse -179 -186 6.13563 0.193
NP_442998.1_5 Reverse -198 -208 12.8614 0.158
NP_442998.1_5 Reverse -199 -209 10.6981 0.206
NP_442998.1_10 Forward -185 -178 15.5754 0.0102
NP_442998.1_10 Forward -153 -146 15.5754 0.0102
NP_442998.1_10 Reverse -148 -155 15.5754 0.0102
NP_440299.1_1 Reverse -142 -155 11.4251 0.0489
NP_440299.1_1 Forward -159 -146 7.78685 0.105
NP_440299.1_1 Reverse -24 -37 3.06699 0.261
NP_441799.1_1 Forward -159 -145 16.3219 0.0152
NP_441799.1_1 Reverse -142 -156 3.44058 0.298
NP_442802.1_6 Forward -156 -137 0.982764 0.204
NP_441007.1_5 Forward -85 -66 9.63589 0.225
NP_441007.1_10 Reverse -141 -154 3.46087 0.182
NP_441007.1_10 Forward -160 -147 1.10092 0.209
NP_441007.1_10 Reverse -173 -186 0.412608 0.23
NP_440256.1_1 Forward -158 -139 12.4875 0.0121
NP_440256.1_1 Reverse -143 -162 6.78429 0.0288
NP_440087.1_1 Forward -196 -177 11.7992 0.0688
NP_441512.1_4 Forward -159 -140 10.8159 0.237
NP_441559.1_8 Forward -160 -146 -0.197071 0.174
NP_441559.1_8 Reverse -183 -197 -5.60527 0.267
NP_441559.1_8 Forward -201 -187 -5.70361 0.27
NP_441559.1_8 Forward -202 -188 -6.19526 0.275
NP_441559.1_8 Reverse -141 -155 -6.29359 0.276
NP_440915.1_6 Reverse -142 -156 24.9757 0.000297
NP_440915.1_6 Forward -159 -145 7.57108 0.0681
NP_442158.1_4 Reverse -328 -338 14.0414 0.203
NP_442069.1_8 Forward -232 -213 6.29264 0.235
NP_442866.1_1 Forward -160 -141 -9.63698 0.296
NP_440026.1_7 Forward -160 -145 16.6962 0.159
NP_440306.1_8 Forward -215 -196 0.293673 0.206
NP_441939.1_3 Forward -154 -135 13.3725 0.0913
NP_441939.1_3 Reverse -147 -166 6.29264 0.245
NP_441199.1_7 Forward -378 -359 3.93269 0.245
NP_442386.1_9 Reverse -145 -154 15.7322 0.0144
NP_442386.1_9 Reverse -76 -85 8.16077 0.209
NP_442386.1_9 Forward -87 -78 7.47246 0.219
NP_442386.1_9 Forward -156 -147 6.39082 0.219
NP_442386.1_9 Reverse -177 -186 5.89917 0.233
NP_442386.1_9 Forward -188 -179 4.81753 0.282
NP_441750.1_4 Forward -190 -171 8.06259 0.159
NP_441340.1_5 Forward -154 -147 15.6737 0.0124
NP_441340.1_5 Reverse -147 -154 15.6737 0.0124
NP_441340.1_5 Reverse -179 -186 6.13563 0.175
NP_441340.1_5 Forward -186 -179 5.93897 0.198
NP_441947.1_4 Reverse -167 -186 10.1275 0.3
NP_442484.1_2 Reverse -135 -154 6.19431 0.156
NP_440168.1_9 Forward -198 -179 -1.86883 0.28
NP_441776.1_5 Forward -200 -181 15.0441 0.229
NP_441132.1_5 Forward -157 -138 14.2574 0.265
NP_439976.1_5 Forward -332 -318 12.487 0.257
NP_440161.1_3 Forward -189 -170 18.1907 0.0611
NP_440161.1_3 Reverse -144 -163 9.14423 0.255
NP_440586.1_8 Forward -154 -147 13.2151 0.026
NP_440586.1_8 Reverse -147 -154 13.2151 0.026
NP_440586.1_8 Reverse -179 -186 11.4451 0.0645
NP_442251.1_6 Forward -154 -147 15.2804 0.0124
NP_442251.1_6 Reverse -147 -154 15.2804 0.0124
NP_442251.1_6 Forward -186 -179 12.0355 0.0627
NP_440684.1_9 Reverse -172 -186 8.55439 0.226
NP_441262.1_3 Reverse -178 -185 14.7888 0.0223
NP_441262.1_3 Reverse -146 -153 14.7888 0.0223
NP_441262.1_3 Forward -155 -148 14.7888 0.0223
NP_441262.1_3 Forward -187 -180 5.15232 0.265
NP_443051.1_1 Forward -156 -147 19.5676 0.00335
NP_443051.1_1 Reverse -145 -154 10.4228 0.00754
NP_443051.1_1 Reverse -177 -186 0.786375 0.125
NP_439937.1_9 Reverse -145 -162 -16.383 0.287
NP_442294.1_3 Forward -329 -315 12.3887 0.289
NP_440439.1_1 Forward -158 -145 10.8357 0.0339
NP_440439.1_1 Reverse -143 -156 9.36073 0.0465
NP_440439.1_1 Forward -190 -177 0.412608 0.192
NP_440372.1_2 Forward -154 -147 16.3621 0.0124
NP_440372.1_2 Reverse -147 -154 16.3621 0.0124
NP_440372.1_2 Reverse -179 -186 6.72562 0.0929
NP_440372.1_2 Forward -186 -179 6.62729 0.151
NP_440171.1_3 Reverse -195 -214 3.6377 0.284
NP_440819.1_5 Reverse -313 -321 7.8859 0.266
NP_440819.1_5 Reverse -198 -206 7.68924 0.266
NP_440316.1_10 Reverse -250 -260 7.64985 0.246
NP_440316.1_10 Forward -149 -139 5.38824 0.299
NP_441803.1_2 Forward -160 -141 0.392778 0.253
NP_439977.1_5 Forward -161 -142 1.37609 0.194
NP_440139.1_1 Forward -161 -142 14.5516 0.048
NP_441572.1_7 Reverse -140 -159 8.65258 0.074
NP_440267.1_2 Forward -160 -146 10.9137 0.125
NP_440267.1_2 Reverse -120 -134 6.98048 0.215
NP_442384.1_10 Reverse -146 -159 18.2105 0.00523
NP_442384.1_10 Forward -155 -142 2.2809 0.23
NP_442114.1_2 Forward -103 -84 6.09597 0.262
NP_442114.1_4 Forward -155 -144 12.1534 0.107
NP_442790.1_4 Reverse -137 -156 -15.4385 0.294
NP_442262.1_10 Forward -154 -147 14.1988 0.0123
NP_442262.1_10 Reverse -147 -154 14.1988 0.0123
NP_442262.1_10 Reverse -221 -228 10.1672 0.162
NP_441689.1_5 Forward -157 -147 8.3377 0.132
NP_440163.1_10 Reverse -175 -185 15.2213 0.0762
NP_440344.1_10 Reverse -139 -156 8.7903 0.00973
NP_440344.1_10 Reverse -171 -188 -4.48438 0.097
NP_440531.1_6 Reverse -170 -189 -4.13045 0.276
NP_442123.1_3 Reverse -146 -165 11.8975 0.22
NP_441060.1_4 Forward -343 -325 5.91901 0.242
NP_441335.1_7 Forward -257 -238 16.2241 0.205
NP_442529.1_4 Reverse -137 -156 10.2259 0.227
NP_442693.1_6 Forward -161 -142 -0.787193 0.297
NP_442556.1_1 Reverse -191 -210 12.6841 0.222
NP_440297.1_9 Forward -134 -124 1.35667 0.282
NP_440297.1_9 Forward -154 -144 -0.216628 0.282
NP_440297.1_9 Reverse -147 -157 -0.216628 0.282
NP_440297.1_9 Forward -186 -176 -0.41329 0.283
NP_441896.1_3 Reverse -137 -156 8.75091 0.0879
NP_440999.1_9 Reverse -142 -156 21.1407 0.0083
NP_440888.1_2 Forward -155 -141 20.9434 0.000502
NP_440888.1_2 Reverse -146 -160 17.7968 0.00308
NP_440888.1_2 Reverse -187 -201 8.94708 0.142
NP_442454.1_2 Reverse -341 -360 7.30471 0.291
NP_440491.1_1 Reverse -143 -162 10.1331 0.198
NP_439969.1_3 Reverse -141 -160 11.2092 0.116
NP_442277.1_4 Reverse -137 -156 15.0432 0.0404
NP_442277.1_4 Forward -164 -145 11.7983 0.0703
NP_442033.1_10 Forward -199 -180 -8.26035 0.193
NP_440575.1_1 Reverse -367 -386 -1.77127 0.29
NP_441543.1_2 Forward -154 -145 18.486 0.00236
NP_441543.1_2 Reverse -147 -156 15.9293 0.00518
NP_441543.1_2 Forward -186 -177 8.75118 0.0968
NP_442845.1_2 Reverse -181 -195 4.42448 0.259
NP_441469.1_8 Reverse -145 -154 16.126 0.00797
NP_441469.1_8 Reverse -76 -85 13.8644 0.0682
NP_441469.1_8 Forward -197 -188 12.8811 0.0929
NP_441469.1_8 Forward -188 -179 6.78456 0.227
NP_441469.1_8 Forward -156 -147 6.5879 0.227
NP_441469.1_8 Reverse -177 -186 6.29291 0.227
NP_442637.1_1 Forward -94 -75 6.29264 0.0904
NP_443064.1_6 Reverse -146 -156 10.8217 0.13
NP_442337.1_8 Forward -92 -73 0.982764 0.241
NP_442578.1_7 Forward -154 -147 14.5921 0.026
NP_442578.1_7 Reverse -147 -154 14.5921 0.026
NP_442578.1_7 Reverse -179 -186 5.93897 0.183
NP_440710.1_1 Forward -163 -145 3.46073 0.113
NP_440071.1_4 Reverse -150 -169 12.0942 0.265
NP_440220.1_4 Reverse -64 -83 5.70185 0.205
NP_441462.1_2 Reverse -146 -156 20.2362 0.000805
NP_441462.1_2 Forward -155 -145 11.5831 0.00406
NP_441621.1_7 Reverse -144 -158 4.32615 0.0934
NP_441621.1_7 Forward -157 -143 -3.34366 0.188
NP_441621.1_7 Reverse -135 -149 -6.58858 0.298
NP_443062.1_1 Forward -155 -137 6.79079 0.192
NP_443062.1_1 Reverse -178 -196 4.93815 0.244
NP_443062.1_1 Reverse -146 -164 3.67056 0.289
NP_443062.1_6 Reverse -170 -189 6.78429 0.18
NP_441410.1_3 Forward -164 -145 6.09597 0.23
NP_442204.1_1 Forward -159 -148 1.92696 0.266
NP_442204.1_1 Forward -200 -189 -0.137991 0.286
NP_442204.1_5 Reverse -168 -187 0.687771 0.256
NP_440544.1_5 Reverse -375 -382 13.8024 0.28
NP_440516.1_2 Forward -193 -175 1.10079 0.207
NP_440516.1_8 Forward -155 -146 16.9127 0.00442
NP_440516.1_8 Reverse -146 -155 16.9127 0.00442
NP_440516.1_8 Reverse -178 -187 8.25953 0.0391
NP_442428.1_5 Forward -154 -147 15.8704 0.0124
NP_442428.1_5 Reverse -147 -154 15.8704 0.0124
NP_442428.1_5 Forward -186 -179 6.13563 0.209
NP_442428.1_5 Reverse -179 -186 6.0373 0.212
NP_441790.1_3 Forward -154 -135 4.81767 0.113
NP_440673.1_3 Forward -185 -178 12.4288 0.0426
NP_440673.1_3 Forward -153 -146 12.4288 0.0426
NP_440673.1_3 Reverse -148 -155 12.4288 0.0426
NP_440673.1_7 Reverse -135 -154 14.2574 0.0925
NP_441052.1_2 Forward -155 -145 10.5014 0.0285
NP_441052.1_2 Reverse -146 -156 10.4031 0.0285
NP_442219.1_9 Forward -154 -145 8.35786 0.0681
NP_442219.1_9 Reverse -147 -156 8.25953 0.0681
NP_440436.1_4 Forward -154 -145 18.1905 0.00233
NP_440436.1_4 Forward -186 -177 14.9456 0.0103
NP_440436.1_4 Reverse -147 -156 9.24241 0.0871
NP_440436.1_4 Reverse -179 -188 5.80084 0.182
NP_441884.1_9 Forward -158 -139 -12.5869 0.138
NP_441884.1_9 Reverse -143 -162 -12.7836 0.138
NP_440689.1_5 Reverse -74 -93 20.1573 0.0801
NP_440314.1_9 Reverse -179 -198 -8.45701 0.248
NP_440648.1_1 Reverse -146 -165 8.75091 0.189
NP_441086.1_3 Forward -75 -56 10.2692 0.185
NP_441719.1_4 Forward -154 -147 16.3621 0.0124
NP_441719.1_4 Reverse -147 -154 16.3621 0.0124
NP_441719.1_4 Reverse -179 -186 6.72562 0.093
NP_441719.1_4 Forward -186 -179 6.62729 0.151
NP_441733.1_10 Reverse -143 -156 10.5407 0.106
NP_441733.1_10 Forward -158 -145 5.52582 0.213
NP_441004.1_2 Forward -145 -126 -0.787193 0.259
NP_441004.1_2 Forward -151 -132 -3.73712 0.283
NP_442366.1_3 Forward -188 -170 -2.14413 0.221
NP_442366.1_3 Reverse -145 -163 -3.42244 0.247
NP_440129.1_10 Reverse -171 -185 3.63784 0.191
NP_442873.1_3 Reverse -136 -155 11.11 0.169
NP_440296.1_10 Reverse -143 -162 -6.09707 0.225
NP_441115.1_4 Reverse -145 -163 16.4396 0.0279
NP_441115.1_4 Forward -156 -138 15.653 0.0361
NP_442206.1_10 Forward -196 -181 1.2582 0.236
NP_443054.1_2 Forward -157 -143 19.7641 0.0121
NP_442430.1_10 Reverse -136 -155 10.3234 0.262
NP_441966.1_7 Forward -258 -239 0.686995 0.229
NP_441851.1_10 Reverse -145 -155 16.008 0.00552
NP_441851.1_10 Forward -156 -146 8.53483 0.114
NP_441851.1_10 Reverse -177 -187 6.07655 0.187
NP_441851.1_10 Forward -188 -178 4.69992 0.254
NP_441851.1_10 Forward -197 -187 4.60159 0.259
NP_442622.1_1 Forward -156 -137 -11.1119 0.257
NP_442856.1_7 Reverse -137 -156 -5.70374 0.286
NP_441668.1_4 Reverse -52 -71 -2.65548 0.293
NP_442515.1_1 Reverse -145 -159 -4.22864 0.298
NP_440940.1_7 Reverse -168 -186 4.34495 0.256
NP_440940.1_7 Reverse -136 -154 2.67334 0.295
NP_441349.1_10 Forward -165 -146 -7.67036 0.258
NP_440432.1_9 Forward -154 -139 9.02635 0.0427
NP_440432.1_9 Reverse -147 -162 5.3881 0.0555
NP_440432.1_9 Forward -186 -171 -2.38005 0.17
NP_442843.1_1 Forward -85 -66 -8.65367 0.258
NP_442843.1_1 Reverse -179 -198 -10.817 0.281
NP_440474.1_8 Forward -154 -140 9.73373 0.156
NP_440474.1_8 Reverse -147 -161 6.0955 0.233
NP_440474.1_8 Forward -186 -172 4.91554 0.263
NP_440588.1_2 Forward -164 -145 0.196116 0.148
NP_440195.1_4 Reverse -134 -153 4.22769 0.297
NP_442006.1_2 Reverse -137 -154 -16.4808 0.254
NP_441003.1_9 Forward -187 -168 4.52268 0.277
NP_440483.1_1 Forward -153 -134 -8.85033 0.297
NP_440483.1_1 Forward -148 -129 -8.94866 0.297
NP_441570.1_1 Forward -155 -137 -0.177514 0.0437
NP_441570.1_1 Reverse -146 -164 -17.1888 0.267
NP_441570.1_1 Forward -187 -169 -17.1888 0.267
NP_441078.1_4 Forward -155 -146 19.6659 0.0007
NP_441078.1_4 Reverse -146 -155 19.6659 0.0007
NP_441078.1_4 Reverse -178 -187 0.0980582 0.205
NP_441078.1_4 Forward -187 -178 0.0980582 0.205
NP_441078.1_4 Forward -37 -28 -1.27858 0.246
NP_442729.1_8 Reverse -142 -155 8.47575 0.125
NP_442443.1_1 Forward -142 -123 -2.45882 0.256
NP_440526.1_3 Forward -154 -143 11.7595 0.0646
NP_440526.1_3 Reverse -212 -223 4.77807 0.267
NP_441432.1_8 Forward -156 -147 16.8143 0.00595
NP_441432.1_8 Reverse -145 -154 8.25953 0.0755
NP_441432.1_9 Reverse -320 -333 12.9614 0.189
NP_442320.1_8 Reverse -140 -154 14.7492 0.0132
NP_442320.1_8 Reverse -172 -186 -5.50694 0.228
NP_442344.1_7 Forward -154 -135 -8.94866 0.232
NP_441732.1_2 Forward -159 -143 -15.3794 0.145
NP_442003.1_9 Reverse -300 -319 8.65258 0.219
NP_440760.1_1 Forward -155 -136 -22.6167 0.263
NP_442797.1_6 Reverse -127 -146 8.51591 0.265
NP_442797.1_7 Reverse -138 -156 -0.275845 0.282
NP_440199.1_10 Reverse -175 -185 14.533 0.0861
NP_442353.1_4 Reverse -140 -159 2.16195 0.236
NP_442353.1_4 Forward -304 -285 1.76863 0.242
NP_442353.1_8 Reverse -276 -295 21.1397 0.147
NP_440913.1_1 Forward -157 -139 14.6705 0.116
NP_442751.1_1 Reverse -126 -145 15.6565 0.248
NP_441072.1_2 Forward -159 -140 8.16093 0.24
NP_442489.1_7 Forward -155 -146 20.1576 0.000695
NP_442489.1_7 Reverse -146 -155 20.1576 0.000695
NP_442489.1_7 Forward -187 -178 0.786375 0.152
NP_442489.1_7 Reverse -178 -187 0.589713 0.17
NP_441452.1_1 Reverse -128 -147 13.4708 0.292
NP_440559.1_1 Forward -154 -145 8.75118 0.0586
NP_440559.1_1 Reverse -147 -156 8.65285 0.0586
NP_440559.1_1 Forward -186 -177 5.50626 0.14
NP_441659.2_8 Reverse -146 -156 20.9245 0.000805
NP_441659.2_8 Forward -155 -145 11.9764 0.0147
NP_441659.2_8 Reverse -178 -188 5.28991 0.112
NP_442913.1_10 Reverse -137 -156 2.55606 0.124
NP_442913.1_10 Forward -164 -145 -4.03212 0.225
NP_441968.1_1 Forward -337 -329 15.162 0.257
NP_441800.1_7 Reverse -63 -81 -1.35749 0.242
NP_440779.1_5 Forward -155 -138 -5.27103 0.14
NP_442346.1_1 Forward -154 -135 11.7992 0.27
NP_442346.1_5 Forward -156 -146 16.303 0.00248
NP_442346.1_5 Reverse -145 -155 9.02648 0.118
NP_442346.1_5 Reverse -177 -187 6.37155 0.205
NP_440545.1_3 Forward -159 -142 0.333834 0.141
NP_440545.1_3 Reverse -142 -159 -2.12444 0.179
NP_440459.1_2 Reverse -137 -154 8.7903 0.249
NP_440459.1_2 Forward -157 -140 7.512 0.288
NP_440459.1_7 Reverse -144 -158 16.7791 0.147
NP_441653.1_2 Reverse -135 -154 20.9237 0.0259
NP_440847.1_3 Forward -209 -195 11.9953 0.254
NP_441888.1_7 Reverse -141 -155 2.5562 0.225
NP_441888.1_7 Forward -192 -178 1.96621 0.232
NP_440449.1_6 Reverse -138 -156 13.8971 0.102
NP_441948.1_4 Forward -162 -144 14.8671 0.0294
NP_441948.1_4 Reverse -139 -157 -2.14413 0.16
NP_440170.1_6 Forward -160 -141 11.5042 0.285
NP_441502.1_3 Forward -157 -138 11.4058 0.21
NP_441833.1_4 Forward -154 -147 15.9687 0.0124
NP_441833.1_4 Reverse -147 -154 15.9687 0.0124
NP_441833.1_4 Forward -186 -179 14.1004 0.0258
NP_441833.1_4 Reverse -179 -186 6.13563 0.198
NP_442799.1_9 Forward -148 -129 22.3206 0.0371
NP_441112.1_6 Forward -342 -323 6.68596 0.172
NP_442162.1_9 Forward -154 -147 16.2637 0.0124
NP_442162.1_9 Reverse -147 -154 16.2637 0.0124
NP_442162.1_9 Forward -186 -179 6.62729 0.142
NP_442162.1_9 Reverse -179 -186 6.52896 0.178
NP_442943.1_1 Reverse -56 -71 3.10562 0.285
NP_442199.1_5 Forward -163 -144 1.0811 0.165
NP_442140.1_3 Forward -154 -144 17.4829 0.0159
NP_442140.1_3 Reverse -179 -189 13.7464 0.0542
NP_442140.1_3 Reverse -147 -157 4.69992 0.238
NP_440875.1_9 Forward -153 -143 17.619 0.0104
NP_440875.1_9 Forward -185 -175 8.37203 0.233
NP_440875.1_9 Reverse -148 -158 7.69067 0.255
NP_440875.1_9 Forward -89 -79 7.30133 0.269
NP_441813.1_5 Forward -157 -147 18.1713 0.00743
NP_441813.1_5 Reverse -144 -154 10.0098 0.0208
NP_441813.1_5 Forward -189 -179 9.12481 0.0308
NP_441813.1_5 Reverse -176 -186 7.35486 0.0762
NP_440594.1_8 Reverse -147 -160 11.7201 0.152
NP_439901.1_5 Forward -256 -237 2.26107 0.273
NP_440590.1_4 Forward -154 -141 21.7504 0.00377
NP_440590.1_4 Reverse -147 -160 1.29759 0.127
NP_440567.1_1 Forward -154 -140 17.3058 0.0153
NP_440567.1_1 Reverse -147 -161 8.65272 0.0554
NP_440567.1_1 Forward -186 -172 2.5562 0.17
NP_442497.1_10 Reverse -147 -156 17.601 0.00813
NP_442497.1_10 Forward -154 -145 10.4228 0.0087
NP_442497.1_10 Forward -186 -177 0.688044 0.141
NP_440821.1_4 Reverse -144 -154 18.7612 0.00422
NP_440821.1_4 Reverse -176 -186 9.22315 0.0334
NP_440821.1_4 Forward -157 -147 2.24165 0.131
NP_440821.1_4 Forward -189 -179 -0.118297 0.229
NP_441239.1_7 Forward -378 -359 11.6025 0.221
NP_441239.1_9 Reverse -144 -156 16.0669 0.0175
NP_441239.1_9 Forward -157 -145 15.5753 0.0186
NP_441239.1_9 Forward -189 -177 7.51213 0.158
NP_441951.1_4 Forward -155 -136 1.17943 0.287
NP_441892.1_1 Reverse -137 -154 3.67709 0.121
NP_440665.1_1 Forward -152 -133 -11.9969 0.244
NP_440665.1_1 Reverse -214 -233 -16.7168 0.293
NP_440604.1_6 Reverse -146 -165 -3.04881 0.225
NP_440876.1_5 Forward -185 -166 6.4893 0.283
NP_440212.1_9 Reverse -318 -337 1.04177 0.284
NP_440354.1_7 Forward -161 -143 9.0656 0.231
NP_442138.1_10 Forward -155 -136 -8.06369 0.296
NP_440546.1_4 Reverse -146 -156 13.5365 0.0459
NP_440546.1_4 Forward -155 -145 11.8882 0.0679
NP_440546.1_4 Forward -148 -138 8.39772 0.192
NP_440462.1_6 Forward -157 -147 18.7612 0.00454
NP_440462.1_6 Reverse -144 -154 17.9746 0.00578
NP_440462.1_6 Reverse -176 -186 5.78156 0.138
NP_440868.1_4 Forward -159 -147 8.00379 0.0602
NP_440868.1_4 Forward -191 -179 4.8572 0.109
NP_440868.1_4 Reverse -142 -154 2.98891 0.142
NP_440868.1_4 Reverse -174 -186 1.12062 0.192
NP_441497.1_3 Forward -179 -160 -11.9969 0.294
NP_440270.1_6 Forward -352 -333 11.8975 0.187
NP_441474.1_1 Reverse -136 -155 1.27698 0.247
NP_442402.1_2 Forward -210 -196 15.7319 0.263
NP_442402.1_4 Forward -214 -195 -4.22953 0.224
NP_441848.1_7 Forward -212 -193 -4.42619 0.292
NP_441084.1_6 Forward -157 -143 12.4467 0.16
NP_440653.1_10 Forward -154 -135 4.03102 0.258
NP_439942.1_7 Reverse -185 -204 1.0811 0.21
NP_440696.1_6 Forward -160 -141 4.71934 0.285
NP_442039.1_4 Forward -154 -147 15.1821 0.0124
NP_442039.1_4 Reverse -147 -154 15.1821 0.0124
NP_441926.1_3 Forward -134 -118 6.15506 0.17
NP_441926.1_3 Reverse -146 -162 4.0901 0.201
NP_442837.1_3 Forward -154 -147 15.7721 0.0124
NP_442837.1_3 Reverse -147 -154 15.7721 0.0124
NP_442837.1_3 Forward -186 -179 6.13563 0.25
NP_442837.1_3 Reverse -179 -186 5.93897 0.265
NP_442053.1_1 Forward -155 -146 18.3876 0.0007
NP_442053.1_1 Reverse -146 -155 18.3876 0.0007
NP_440505.1_3 Forward -157 -147 17.188 0.00332
NP_440505.1_3 Reverse -144 -154 14.1397 0.0235
NP_440505.1_3 Reverse -176 -186 12.5664 0.0482
NP_441701.1_3 Forward -144 -127 9.08529 0.246
NP_441701.1_3 Forward -84 -67 8.20031 0.247
NP_441203.1_1 Reverse -147 -166 -15.4385 0.229
NP_442532.1_7 Reverse -178 -192 3.73617 0.191
NP_440914.1_1 Reverse -146 -156 16.3248 0.00196
NP_440914.1_1 Forward -155 -145 8.6151 0.186
NP_441011.1_8 Forward -154 -145 16.9127 0.00602
NP_441011.1_8 Reverse -147 -156 16.6177 0.00602
NP_441011.1_8 Forward -186 -177 7.17789 0.179
NP_442533.1_6 Forward -155 -146 17.2076 0.00137
NP_442533.1_6 Reverse -146 -155 17.2076 0.00137
NP_442533.1_6 Forward -196 -187 3.7363 0.204
NP_442232.1_3 Forward -163 -144 -15.0452 0.288
NP_442322.1_4 Forward -262 -245 -2.51845 0.234
NP_442322.1_4 Reverse -131 -148 -5.17337 0.266
NP_441482.1_7 Reverse -22 -36 -4.03198 0.145
NP_441482.1_7 Forward -161 -147 -4.7203 0.156
NP_439944.1_9 Forward -154 -144 10.4031 0.0887
NP_439944.1_9 Reverse -147 -157 9.12481 0.1
NP_442203.1_3 Forward -337 -318 4.79023 0.268
NP_442269.1_10 Reverse -280 -299 2.26107 0.28
NP_441697.1_5 Forward -281 -262 -9.31089 0.268
NP_440816.1_7 Reverse -142 -161 8.45592 0.29
NP_441028.1_4 Forward -226 -212 24.6807 0.0397
NP_441028.1_5 Forward -322 -310 16.7552 0.24
NP_441028.1_6 Forward -205 -195 15.2208 0.152
NP_441028.1_6 Reverse -290 -300 6.46942 0.23
NP_441028.1_6 Forward -206 -196 5.38779 0.255
NP_440116.1_8 Forward -154 -135 -1.08219 0.116
NP_440116.1_8 Reverse -147 -166 -3.83545 0.158
NP_440115.1_6 Forward -158 -148 4.79825 0.282
NP_439965.1_1 Forward -164 -145 -9.24366 0.284
NP_441680.1_4 Reverse -132 -151 -3.63879 0.3
NP_441059.1_1 Reverse -275 -294 9.14423 0.168
NP_441602.1_3 Forward -160 -141 0.0977854 0.219
NP_441602.1_4 Reverse -135 -154 11.7992 0.278
NP_441972.1_5 Forward -154 -135 10.9142 0.0538
NP_441106.1_1 Forward -156 -147 18.486 0.0028
NP_441106.1_1 Reverse -145 -154 18.191 0.0028
NP_441106.1_1 Reverse -177 -186 8.35786 0.0585
NP_441106.1_1 Forward -188 -179 5.70292 0.131
NP_442306.1_10 Forward -160 -141 -10.9153 0.111
NP_441286.1_1 Forward -156 -144 5.34885 0.0259
NP_441286.1_1 Reverse -145 -157 -3.59927 0.145
NP_441286.1_1 Forward -188 -176 -6.05754 0.245
NP_440670.1_8 Forward -155 -146 18.3876 0.000699
NP_440670.1_8 Reverse -146 -155 18.3876 0.000699
NP_440670.1_8 Forward -187 -178 13.2744 0.0157
NP_440670.1_8 Reverse -178 -187 7.37455 0.0774
NP_440670.1_8 Forward -37 -28 3.44131 0.267
NP_441479.1_1 Reverse -143 -162 19.2723 0.0605
NP_440886.1_7 Reverse -145 -155 17.7774 0.0011
NP_440886.1_7 Forward -156 -146 8.04271 0.0805
NP_440886.1_7 Reverse -177 -187 4.60114 0.227
NP_440886.1_7 Forward -309 -299 3.91283 0.26
NP_439995.1_5 Reverse -168 -187 5.11266 0.28
NP_442072.1_9 Forward -156 -138 6.01734 0.0146
NP_442072.1_9 Reverse -145 -163 -21.0237 0.206
NP_440907.2_8 Forward -154 -144 17.4824 0.00685
NP_440907.2_8 Reverse -147 -157 9.616 0.103
NP_441021.1_1 Forward -154 -135 -7.08038 0.181
NP_441021.1_8 Forward -192 -174 0.707465 0.299
NP_441463.1_3 Reverse -136 -155 -0.197208 0.132
NP_441463.1_3 Forward -165 -146 -10.522 0.296
NP_441626.1_2 Forward -154 -147 15.7721 0.0124
NP_441626.1_2 Reverse -147 -154 15.7721 0.0124
NP_441626.1_2 Forward -186 -179 6.0373 0.212
NP_441626.1_2 Reverse -179 -186 6.0373 0.212
NP_440107.1_5 Forward -162 -143 -5.99873 0.225
NP_442615.1_1 Forward -164 -146 10.2456 0.0216
NP_442615.1_1 Reverse -137 -155 -3.32411 0.159
NP_441962.1_4 Forward -160 -141 -13.1769 0.271
NP_440387.1_1 Reverse -146 -162 0.353528 0.127
NP_440387.1_1 Forward -155 -139 -0.531451 0.139
NP_440387.1_1 Reverse -178 -194 -3.77637 0.167
NP_441431.1_2 Reverse -143 -157 9.24208 0.19
NP_441431.1_3 Forward -149 -130 3.53937 0.265
NP_441488.1_7 Forward -161 -142 8.45592 0.121
NP_441836.1_2 Forward -161 -142 -2.75381 0.231
NP_441993.1_1 Forward -155 -136 3.01872 0.244
NP_441993.1_1 Reverse -140 -159 1.75177 0.27
NP_441993.1_1 Forward -158 -139 0.874656 0.29
NP_440114.1_10 Reverse -146 -160 14.3559 0.0418
NP_440114.1_10 Forward -155 -141 6.88276 0.253
NP_442090.1_2 Forward -369 -350 6.92274 0.281
NP_440766.1_4 Reverse -142 -156 8.35772 0.0871
NP_439988.1_7 Reverse -148 -162 12.6836 0.292
NP_442743.1_4 Forward -154 -135 -7.86702 0.281
NP_442743.1_5 Forward -186 -167 4.62101 0.215
NP_441311.1_2 Forward -161 -147 13.4703 0.23
NP_441133.1_1 Forward -148 -129 13.1758 0.243
NP_439910.1_2 Reverse -138 -155 -21.3973 0.183
NP_440457.1_1 Forward -159 -147 8.9871 0.0988
NP_440457.1_1 Reverse -142 -154 5.34885 0.141
NP_440798.1_6 Forward -154 -141 3.85419 0.147
NP_440798.1_6 Reverse -147 -160 3.65753 0.15
NP_442561.1_6 Forward -142 -123 14.4541 0.191
NP_441984.1_3 Forward -159 -141 13.6872 0.153
NP_442509.1_9 Forward -155 -145 16.2041 0.00739
NP_442509.1_9 Forward -187 -177 12.0743 0.105
NP_442509.1_9 Reverse -146 -156 8.04271 0.192
NP_441384.1_1 Forward -389 -371 20.472 0.102
NP_441384.1_2 Forward -50 -33 19.6917 0.28
NP_441384.1_3 Forward -294 -275 24.7789 0.0163
NP_441496.1_1 Reverse -343 -357 14.4309 0.265
NP_440554.1_4 Reverse -147 -157 17.9746 0.0131
NP_440554.1_4 Forward -154 -144 13.943 0.0218
NP_440554.1_4 Reverse -179 -189 7.94484 0.0898
NP_440554.1_4 Forward -186 -176 5.09324 0.162
NP_441845.1_6 Reverse -134 -152 2.0841 0.262
NP_441885.1_5 Forward -155 -145 11.4848 0.00668
NP_441885.1_5 Reverse -146 -156 11.3864 0.00668
NP_442228.1_10 Reverse -241 -260 13.2741 0.231
NP_440478.1_10 Reverse -144 -158 15.2409 0.107
NP_442341.1_7 Forward -156 -142 13.5693 0.0338
NP_441756.1_5 Reverse -142 -161 7.37428 0.158
NP_442395.2_4 Reverse -145 -164 10.0284 0.103
NP_440423.1_6 Reverse -170 -189 -13.8652 0.224
NP_443000.1_7 Forward -157 -147 20.3345 0.00223
NP_443000.1_7 Reverse -144 -154 2.04498 0.226
NP_442513.1_5 Reverse -138 -157 5.60352 0.293
NP_441842.1_10 Reverse -139 -153 18.1908 0.0173
NP_441842.1_10 Reverse -171 -185 13.1759 0.0809
NP_441842.1_10 Forward -162 -148 9.04604 0.2
NP_440275.1_3 Reverse -144 -154 17.9746 0.0082
NP_440275.1_3 Forward -157 -147 16.1063 0.0155
NP_440275.1_3 Forward -189 -179 12.6647 0.0315
NP_440091.1_1 Reverse -142 -154 12.6253 0.0353
NP_440091.1_1 Reverse -174 -186 0.923956 0.225
NP_440679.1_10 Forward -185 -166 -14.1602 0.226
NP_442451.1_2 Reverse -138 -157 -9.83364 0.26
NP_441190.1_2 Forward -306 -287 3.14605 0.192
NP_441207.1_7 Reverse -260 -274 8.19046 0.293
NP_439962.1_4 Reverse -135 -154 -3.83545 0.259
NP_439962.1_4 Reverse -138 -157 -6.1954 0.281
NP_440149.1_8 Forward -155 -136 4.03102 0.0873
NP_441105.1_3 Forward -166 -147 -2.16383 0.158
NP_440216.1_1 Reverse -146 -160 25.959 0.000481
NP_440216.1_1 Forward -155 -141 8.25939 0.0061
NP_440216.1_1 Reverse -178 -192 -11.0135 0.159
NP_440216.1_1 Forward -134 -120 -12.1934 0.247
NP_440216.1_6 Reverse -139 -155 4.87675 0.189
NP_440216.1_9 Forward -338 -329 5.80125 0.289
NP_440216.1_9 Reverse -79 -88 5.60459 0.292
NP_440172.1_1 Reverse -146 -156 17.5813 0.00421
NP_440172.1_1 Forward -155 -145 8.73149 0.0586
NP_442015.1_10 Forward -191 -178 4.73917 0.162
NP_442015.1_10 Reverse -142 -155 3.95252 0.178
NP_441226.1_7 Forward -154 -147 14.4934 0.0123
NP_441226.1_7 Reverse -147 -154 14.4934 0.0123
NP_441111.1_7 Forward -154 -146 18.7023 0.00294
NP_441111.1_7 Reverse -147 -155 18.7023 0.00294
NP_441111.1_7 Forward -186 -178 8.96754 0.0463
NP_442379.1_10 Reverse -139 -156 -3.10775 0.248
NP_441766.1_2 Forward -155 -146 17.5026 0.00297
NP_441766.1_2 Reverse -146 -155 17.5026 0.00297
NP_441766.1_2 Forward -187 -178 6.5879 0.0918
NP_442417.1_5 Reverse -220 -234 7.37441 0.19
NP_442417.1_5 Reverse -146 -160 5.60446 0.255
NP_440416.1_9 Forward -162 -143 -8.65367 0.119
NP_440416.1_9 Reverse -139 -158 -12.8819 0.16
NP_440416.1_9 Forward -203 -184 -20.5517 0.286
NP_443052.1_8 Reverse -136 -155 -6.39206 0.143
NP_443052.1_8 Forward -197 -178 -13.2752 0.279
NP_442154.1_1 Forward -154 -136 -8.14232 0.157
NP_442154.1_1 Forward -85 -67 -17.9754 0.273
NP_440261.1_5 Forward -154 -141 -1.06236 0.0655
NP_440261.1_5 Reverse -147 -160 -2.73398 0.0924
NP_440261.1_5 Reverse -212 -225 -11.0921 0.237
NP_440261.1_7 Reverse -192 -211 -3.93378 0.209
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTTTGCTCACTAAGCCAGAAGAAAAGTCAATTTATGTAGAAGTAAAAAATACTACCTTGTCCCAAGAAAAATTGGCTTTATTTCCCGATACGGAAACCACCAGAGGGCAAAAACATCTCCAGGAGTTAATAGATATTCTCCCTACAGCCCGGGCAGTGATGCTTTACTTCATCAATCGGGGTGATTGTACCCATTTTTCCCCCGGAGATGCCTACGATCGCCGTTATGGAGAACTATTCCGTCAGGCGATCGCCGCTGGGGTGGAGGTAATGCCCTGTCGATTTATGGTTAATCCGGAGGGGGTTAAATTCCTTGGCATGGCAGAGTTAGTGGTTTGACAATTTATTCGGAGAGTTAAAATAGACTATCTCCCTAGTTTCAGTCCCTGCTACTACTACC

CDS

ATGGCCACCACCGCCGATGACGTCTGGCAAATATTAGCCGAACTTGCCGCCTCCCAAAAACAGACCCAGCAAAATTTGCGTGAGACCGAGCGCCTCTTTAAGGAACAGGGACAAGAGCTTGATCGCCGTTTTCAAGAAACTGATCGCCGCTTCCAAGAGACAGAGCGTTACATCAAACGAGTTAGTAGGGATGTGGGTAAACTCAGTAATCGGTTGGGGGAATTTGTGGAATGGCAAGTTAGACCCGCTGTGGTGGGACTGTTTCAGGATAGAGGCATTGACGTCCATGAGTTTCATCCTGGCGTATCGGTACAACGGGAAGATGGGGGATTAGAAATTGACCTGTTAGTAGTCAATGAAACCCAAGCTATTTTAATTGAAGTAAAAAGTAAGTTAACGGAAAAGGATGTGGATGAGCATCTGGAACGGTTGGGTAAATTCAAACAGTTTATGCCCCGCTACCGGGATGTTAAAGCTTTAGGTGCAGTGGCAGCCATGGTGTTAAGCCAAGAAGTGGTCAGCTATGCCTATGGTAAGGGTCTGTTTGTGCTAGCTCCGTCCGGGGACACGTTGGTGATTTTAAATGATGCCAATTTTCGGCCCAGCTATTGGTAG

Protein

MATTADDVWQILAELAASQKQTQQNLRETERLFKEQGQELDRRFQETDRRFQETERYIKRVSRDVGKLSNRLGEFVEWQVRPAVVGLFQDRGIDVHEFHPGVSVQREDGGLEIDLLVVNETQAILIEVKSKLTEKDVDEHLERLGKFKQFMPRYRDVKALGAVAAMVLSQEVVSYAYGKGLFVLAPSGDTLVILNDANFRPSYW