Your browser is old and dusty. Try Google Chrome!

Details for sll2013

ORF sll2013
Accession NP_441030.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_1 Forward -164 -145 11.9838 0.203
NP_442657.1_5 Reverse -141 -155 16.7122 0.248
NP_440226.1_1 Reverse -357 -376 5.01433 0.17
NP_442169.1_1 Reverse -29 -48 4.81767 0.26
NP_441098.1_3 Reverse -52 -71 1.25016 0.25
NP_441098.1_3 Forward -83 -64 -2.96081 0.28
NP_441098.1_3 Forward -82 -63 -6.88467 0.285
NP_442287.1_1 Forward -295 -285 18.0724 0.085
NP_442909.1_2 Reverse -262 -281 11.1109 0.255
NP_442000.2_6 Reverse -286 -305 14.7491 0.267
NP_440110.1_6 Forward -40 -21 12.8808 0.252
NP_441476.1_5 Forward -305 -286 -5.50708 0.263
NP_442062.1_3 Forward -164 -145 7.47261 0.154
NP_442062.1_8 Reverse -108 -118 9.91146 0.0554
NP_441859.1_3 Reverse -107 -126 2.55527 0.258
NP_441434.1_1 Reverse -58 -72 10.6112 0.233
NP_440209.1_1 Forward -366 -358 2.1827 0.254
NP_441444.1_1 Reverse -10 -29 2.26107 0.295
NP_442136.1_1 Reverse -52 -71 6.68596 0.27
NP_442889.1_1 Reverse -250 -269 -15.3402 0.289
NP_442889.1_8 Reverse -354 -368 6.68548 0.178
NP_442675.1_1 Reverse -319 -338 4.22769 0.274
NP_441025.1_6 Forward -69 -50 7.66233 0.17
NP_441716.1_1 Reverse -357 -371 4.81781 0.248
NP_442111.1_4 Forward -367 -353 1.86788 0.293
NP_441495.1_2 Forward -239 -220 12.8808 0.201
NP_441209.1_4 Forward -296 -277 10.2251 0.295
NP_441486.1_1 Reverse -288 -302 1.37622 0.112
NP_442145.1_4 Reverse -52 -71 14.3711 0.0989
NP_442145.1_4 Forward -72 -53 4.34446 0.282
NP_442145.1_4 Reverse -146 -165 2.7211 0.299
NP_442330.1_4 Forward -247 -228 16.2148 0.233
NP_440842.1_4 Reverse -63 -82 6.62992 0.135
NP_440842.1_5 Forward -201 -182 15.9781 0.269
NP_440057.1_4 Reverse -247 -266 15.7477 0.184
NP_443018.1_3 Reverse -109 -116 8.49558 0.141
NP_440376.1_1 Reverse -285 -294 11.7994 0.0223
NP_442530.1_2 Reverse -166 -176 13.8447 0.226
NP_441013.1_2 Forward -288 -270 -4.8974 0.299
NP_441013.1_9 Reverse -289 -307 14.2771 0.202
NP_442735.1_2 Reverse -286 -305 10.0292 0.105
NP_442296.1_9 Forward -369 -350 -3.54046 0.254
NP_441763.1_5 Forward -287 -268 -4.22878 0.239
NP_442658.1_1 Forward -203 -193 6.17443 0.235
NP_442782.1_2 Reverse -280 -294 1.57289 0.281
NP_442782.1_2 Forward -277 -263 0.491246 0.289
NP_440184.1_1 Forward -70 -51 3.9289 0.229
NP_440184.1_1 Forward -79 -60 0.579281 0.298
NP_442937.1_5 Forward -311 -292 6.58763 0.275
NP_441127.1_1 Reverse -382 -396 10.521 0.244
NP_440318.1_1 Reverse -102 -121 0.0977854 0.298
NP_441097.1_2 Reverse -276 -293 16.2635 0.11
NP_439990.1_5 Reverse -103 -116 6.90245 0.22
NP_442690.1_1 Reverse -64 -83 -8.65367 0.189
NP_443055.1_6 Forward -273 -255 2.77167 0.203
NP_442002.1_1 Reverse -276 -294 -4.79907 0.228
NP_440106.1_2 Reverse -275 -293 8.96727 0.299
NP_441646.1_1 Reverse -278 -297 2.16274 0.221
NP_440484.1_1 Forward -29 -10 9.7334 0.244
NP_440484.1_3 Reverse -301 -315 11.0127 0.242
NP_441916.1_7 Forward -366 -356 4.40493 0.178
NP_441916.1_7 Forward -117 -107 3.91327 0.198
NP_439966.1_7 Forward -368 -358 4.50281 0.269
NP_442941.1_3 Forward -365 -355 -0.314959 0.256
NP_441079.1_7 Forward -76 -57 -6.49113 0.278
NP_442012.1_1 Reverse -102 -121 1.57275 0.214
NP_442012.1_2 Forward -246 -227 4.81767 0.216
NP_441556.1_6 Forward -61 -43 16.2122 0.215
NP_440498.1_1 Forward -375 -357 -2.14413 0.235
NP_442982.1_5 Forward -206 -187 -1.57384 0.267
NP_443049.1_6 Reverse -356 -366 11.6409 0.24
NP_440253.1_2 Reverse -237 -255 -3.6191 0.297
NP_440780.1_1 Forward -77 -58 10.074 0.261
NP_441715.1_4 Forward -276 -266 5.78156 0.18
NP_440357.1_3 Forward -276 -257 2.94938 0.245
NP_440379.1_8 Reverse -257 -276 15.1424 0.199
NP_441758.1_10 Forward -74 -55 1.57197 0.193
NP_439939.1_5 Reverse -218 -237 13.8641 0.282
NP_441764.1_1 Forward -70 -51 20.1573 0.0472
NP_441764.1_4 Forward -82 -65 11.0321 0.232
NP_441764.1_4 Forward -72 -55 9.21776 0.295
NP_441764.1_8 Forward -161 -151 13.8947 0.284
NP_442427.1_8 Forward -210 -191 5.99764 0.25
NP_442808.1_1 Forward -367 -357 6.17443 0.126
NP_442808.1_1 Forward -295 -285 2.24121 0.274
NP_441114.1_3 Reverse -266 -275 6.39124 0.277
NP_440558.1_2 Reverse -261 -280 2.85105 0.164
NP_440558.1_5 Reverse -285 -299 13.9626 0.289
NP_440923.1_1 Reverse -62 -80 18.2096 0.0506
NP_440923.1_1 Reverse -52 -70 16.5379 0.0836
NP_440923.1_10 Reverse -223 -242 12.3892 0.298
NP_441878.1_6 Reverse -284 -294 -7.19813 0.21
NP_441878.1_6 Forward -118 -108 -7.49312 0.231
NP_441036.1_8 Forward -241 -231 6.37155 0.234
NP_442503.1_9 Forward -313 -294 12.0942 0.179
NP_442503.1_9 Reverse -191 -210 5.30933 0.279
NP_441557.1_7 Forward -26 -7 14.3558 0.277
NP_440233.1_2 Forward -173 -154 5.11266 0.25
NP_439980.1_2 Forward -252 -233 15.3391 0.196
NP_441549.1_9 Forward -298 -280 -7.25734 0.206
NP_442645.1_2 Reverse -283 -302 1.47442 0.0459
NP_442317.1_6 Reverse -103 -122 2.55606 0.275
NP_441728.2_4 Forward -84 -65 14.0846 0.234
NP_441728.2_4 Forward -74 -55 11.2199 0.293
NP_442998.1_5 Reverse -390 -400 11.6814 0.179
NP_442998.1_10 Forward -364 -357 12.5271 0.0457
NP_441799.1_1 Reverse -287 -301 6.58715 0.167
NP_441090.1_6 Forward -190 -176 12.8809 0.142
NP_441270.1_5 Reverse -16 -35 11.4328 0.291
NP_440915.1_6 Forward -250 -236 -0.0987402 0.182
NP_442855.1_3 Reverse -276 -295 15.8307 0.157
NP_440717.1_3 Forward -35 -21 7.27547 0.28
NP_442452.1_3 Reverse -269 -288 0.0977854 0.298
NP_441464.1_1 Forward -40 -21 7.66927 0.261
NP_440695.1_6 Forward -85 -71 13.2231 0.24
NP_442386.1_9 Forward -295 -286 7.57079 0.219
NP_441676.1_2 Forward -234 -215 23.7955 0.00417
NP_441676.1_3 Forward -207 -188 12.3892 0.202
NP_441676.1_5 Forward -179 -160 22.6156 0.0165
NP_441676.1_6 Forward -255 -236 30.777 0.000428
NP_441676.1_9 Forward -348 -331 16.066 0.218
NP_440211.1_4 Forward -353 -343 15.2213 0.23
NP_440586.1_8 Reverse -292 -299 7.51192 0.239
NP_442959.1_4 Reverse -259 -278 7.27595 0.224
NP_441912.1_3 Reverse -274 -293 7.37428 0.27
NP_440684.1_9 Reverse -285 -299 9.5377 0.218
NP_440027.1_3 Forward -41 -23 1.69003 0.299
NP_443051.1_1 Reverse -356 -365 0.196389 0.213
NP_439937.1_9 Forward -351 -334 -11.5649 0.257
NP_441572.1_7 Forward -306 -287 -4.32711 0.232
NP_442384.1_10 Forward -300 -287 12.2123 0.0296
NP_442384.1_10 Reverse -268 -281 2.87088 0.21
NP_441877.1_9 Reverse -52 -69 11.6419 0.15
NP_441877.1_9 Forward -72 -55 2.00546 0.292
NP_441018.1_7 Reverse -22 -41 9.83255 0.218
NP_442262.1_10 Reverse -109 -116 8.59391 0.22
NP_440282.1_10 Reverse -293 -312 0.196116 0.196
NP_441965.1_3 Reverse -281 -300 0.982764 0.225
NP_442693.1_6 Forward -42 -23 0.884433 0.278
NP_440350.1_5 Reverse -4 -23 -5.31042 0.289
NP_442280.1_10 Forward -139 -121 6.13623 0.28
NP_442892.1_9 Forward -137 -123 14.4536 0.293
NP_442277.1_4 Forward -126 -107 1.17865 0.286
NP_441949.1_5 Forward -72 -53 16.9464 0.115
NP_441543.1_2 Reverse -358 -367 3.93297 0.3
NP_441829.1_3 Forward -222 -204 18.8979 0.213
NP_442315.1_2 Reverse -280 -292 9.77374 0.291
NP_442337.1_8 Forward -284 -265 -0.885524 0.278
NP_440710.1_1 Reverse -277 -295 -1.45582 0.18
NP_440071.1_2 Forward -297 -283 17.6008 0.24
NP_441462.1_5 Reverse -300 -319 0.491109 0.296
NP_441621.1_7 Reverse -301 -315 -4.32697 0.219
NP_442204.1_1 Reverse -276 -287 5.8602 0.186
NP_442780.1_1 Forward -78 -59 18.3873 0.0634
NP_442537.1_3 Forward -312 -293 11.6025 0.28
NP_440516.1_8 Reverse -357 -366 0.688044 0.136
NP_442859.1_2 Forward -200 -181 6.78429 0.199
NP_442823.1_8 Reverse -253 -272 12.5858 0.266
NP_441052.1_2 Reverse -357 -367 3.61828 0.177
NP_440992.1_5 Forward -248 -229 13.9334 0.272
NP_442219.1_9 Reverse -238 -247 2.65466 0.241
NP_441004.1_2 Forward -276 -257 -2.16383 0.263
NP_442366.1_3 Reverse -290 -308 3.55906 0.108
NP_442366.1_5 Reverse -288 -298 13.8442 0.0595
NP_442206.1_1 Reverse -108 -127 -13.4719 0.252
NP_442206.1_1 Forward -274 -255 -14.4552 0.27
NP_442854.1_6 Reverse -274 -293 0.687771 0.29
NP_441966.1_8 Reverse -175 -193 5.62401 0.107
NP_441851.1_6 Forward -82 -63 18.3095 0.125
NP_441273.1_9 Forward -74 -55 14.8401 0.258
NP_440593.1_3 Reverse -286 -305 -1.27885 0.211
NP_441982.1_6 Reverse -72 -81 11.053 0.288
NP_441046.1_2 Reverse -380 -399 3.34271 0.235
NP_442689.1_8 Reverse -68 -85 -5.66436 0.273
NP_441349.1_10 Forward -380 -361 -8.85033 0.279
NP_441409.1_6 Forward -372 -353 -6.09707 0.119
NP_441394.1_6 Forward -29 -10 15.6917 0.298
NP_441394.1_10 Reverse -220 -238 10.2448 0.263
NP_440432.1_9 Forward -365 -350 -4.445 0.209
NP_440726.1_8 Forward -330 -311 12.9791 0.205
NP_441124.1_5 Reverse -53 -63 10.0479 0.298
NP_440588.1_2 Reverse -282 -301 -4.72043 0.226
NP_441031.1_1 Forward -75 -56 16.367 0.086
NP_441031.1_1 Reverse -59 -78 10.2934 0.205
NP_441031.1_1 Forward -85 -66 8.75086 0.23
NP_441031.1_1 Reverse -49 -68 8.07601 0.25
NP_442006.1_2 Reverse -303 -320 1.31714 0.124
NP_441570.1_1 Reverse -285 -303 -15.2222 0.228
NP_441078.1_4 Reverse -357 -366 -1.37691 0.254
NP_441078.1_4 Forward -294 -285 -1.6719 0.266
NP_441078.1_4 Reverse -285 -294 -1.86856 0.272
NP_442388.1_3 Reverse -262 -281 10.7175 0.215
NP_442443.1_1 Forward -357 -338 -3.54046 0.267
NP_441432.1_8 Reverse -356 -365 5.99792 0.124
NP_441030.1_6 Forward -203 -184 13.9104 0.199
NP_440497.1_2 Reverse -248 -267 5.80098 0.28
NP_442274.1_7 Reverse -242 -256 19.0758 0.219
NP_440281.1_9 Reverse -41 -60 17.404 0.218
NP_442489.1_7 Reverse -285 -294 -1.37691 0.195
NP_442489.1_7 Forward -366 -357 -1.77023 0.247
NP_442079.1_7 Forward -311 -292 4.42435 0.192
NP_441659.2_8 Forward -294 -284 -0.314959 0.298
NP_440336.1_7 Forward -81 -62 19.4322 0.0612
NP_440708.1_6 Forward -287 -268 -8.85033 0.259
NP_442776.1_1 Reverse -346 -365 2.94938 0.294
NP_442346.1_5 Reverse -290 -300 10.3048 0.101
NP_440486.1_9 Forward -287 -273 13.2743 0.251
NP_440010.1_10 Reverse -253 -272 6.29264 0.226
NP_441329.1_1 Reverse -61 -80 5.39487 0.265
NP_441329.1_6 Forward -24 -5 21.533 0.106
NP_440671.1_1 Forward -156 -137 7.56662 0.213
NP_440772.1_10 Reverse -48 -67 14.9324 0.253
NP_442140.1_3 Forward -357 -347 5.09324 0.227
NP_442723.1_1 Forward -150 -131 2.26028 0.291
NP_441951.1_4 Reverse -237 -256 3.44104 0.275
NP_442399.1_3 Forward -169 -150 10.3644 0.252
NP_440604.1_6 Reverse -27 -46 -2.36049 0.221
NP_440219.1_1 Reverse -59 -78 13.2234 0.255
NP_441508.1_1 Reverse -55 -74 12.0953 0.233
NP_441508.1_1 Forward -69 -50 11.2303 0.252
NP_441508.1_2 Reverse -51 -70 18.0059 0.234
NP_442643.1_3 Reverse -320 -339 -6.78538 0.262
NP_441017.1_8 Reverse -86 -101 14.6312 0.174
NP_441541.1_1 Forward -81 -63 10.1241 0.0935
NP_441541.1_1 Reverse -62 -80 6.49544 0.153
NP_440546.1_4 Reverse -381 -391 7.52511 0.235
NP_441230.1_3 Reverse -262 -281 3.73603 0.269
NP_440462.1_6 Reverse -355 -365 5.68323 0.145
NP_440462.1_6 Forward -123 -113 3.71661 0.23
NP_442340.1_3 Reverse -110 -129 1.0811 0.144
NP_440868.1_4 Forward -370 -358 5.74217 0.0913
NP_442787.1_9 Reverse -331 -350 18.3873 0.197
NP_441084.1_6 Reverse -124 -138 13.6102 0.125
NP_442837.1_3 Reverse -113 -120 6.52896 0.2
NP_440160.1_1 Forward -84 -65 17.3284 0.0563
NP_440160.1_1 Forward -74 -55 12.1604 0.205
NP_440160.1_7 Forward -277 -258 13.3725 0.223
NP_440160.1_7 Reverse -253 -272 11.6025 0.252
NP_442053.1_1 Forward -366 -357 4.42462 0.249
NP_441576.1_10 Reverse -47 -66 9.93088 0.291
NP_440914.1_1 Forward -201 -191 7.73678 0.224
NP_440037.1_2 Reverse -121 -140 7.47261 0.248
NP_442533.1_6 Forward -294 -285 7.57121 0.0898
NP_442533.1_6 Reverse -291 -300 3.04799 0.228
NP_440854.1_7 Reverse -62 -76 14.334 0.253
NP_441219.1_4 Reverse -28 -47 6.88262 0.217
NP_441482.1_7 Reverse -126 -140 -11.7018 0.281
NP_439944.1_9 Forward -311 -301 10.1081 0.0928
NP_441697.1_5 Reverse -48 -67 -6.8281 0.237
NP_440116.1_4 Reverse -277 -296 15.1424 0.251
NP_441527.1_4 Forward -20 -1 -4.34531 0.184
NP_441527.1_4 Forward -23 -4 -7.78302 0.237
NP_441527.1_4 Forward -22 -3 -11.3162 0.281
NP_441527.1_4 Reverse -307 -326 -11.9847 0.285
NP_441527.1_4 Forward -24 -5 -12.4621 0.288
NP_441106.1_3 Reverse -51 -70 20.2556 0.038
NP_442306.1_10 Forward -278 -259 -14.3569 0.197
NP_440886.1_7 Reverse -348 -358 5.97777 0.151
NP_442614.1_2 Reverse -132 -146 6.29277 0.291
NP_441021.1_1 Reverse -109 -128 -6.98204 0.181
NP_442842.1_10 Reverse -3 -22 15.1241 0.206
NP_442842.1_10 Forward -146 -127 4.34852 0.222
NP_442061.1_8 Reverse -36 -50 14.5526 0.217
NP_442365.1_7 Forward -298 -279 -6.49039 0.295
NP_440107.1_5 Reverse -230 -249 -6.98204 0.272
NP_440387.1_1 Forward -294 -278 -6.13632 0.268
NP_441431.1_3 Forward -244 -225 2.0644 0.295
NP_441836.1_2 Reverse -262 -281 -3.54046 0.239
NP_440143.1_9 Forward -68 -49 3.14526 0.188
NP_441858.1_2 Reverse -274 -293 9.16077 0.293
NP_442698.1_10 Forward -121 -102 -1.18052 0.297
NP_441510.2_7 Forward -300 -286 9.53707 0.281
NP_440287.1_5 Reverse -214 -233 6.88182 0.286
NP_440293.1_3 Reverse -278 -297 -6.88371 0.294
NP_442743.1_5 Reverse -286 -305 3.83436 0.245
NP_442743.1_8 Reverse -51 -70 13.1525 0.181
NP_441332.1_8 Reverse -284 -298 16.9125 0.218
NP_442514.1_6 Forward -368 -349 10.6192 0.208
NP_441845.1_6 Forward -133 -115 2.0841 0.262
NP_441885.1_5 Reverse -357 -367 1.06167 0.113
NP_441275.1_1 Reverse -52 -70 11.4255 0.0496
NP_441275.1_1 Reverse -62 -80 2.57575 0.189
NP_442395.2_4 Forward -234 -215 0.293673 0.274
NP_443000.1_7 Reverse -355 -365 0.766681 0.29
NP_440552.1_8 Reverse -65 -82 10.9382 0.262
NP_440727.1_8 Forward -158 -144 17.3912 0.198
NP_441122.1_1 Reverse -287 -302 11.6813 0.198
NP_439962.1_4 Reverse -228 -247 -4.81876 0.272
NP_440149.1_8 Reverse -285 -304 0.294447 0.14
NP_441105.1_3 Reverse -257 -276 -9.24366 0.286
NP_440216.1_1 Forward -366 -352 -4.4253 0.111
NP_441226.1_7 Forward -293 -286 8.29857 0.205
NP_440416.1_9 Forward -284 -265 -18.3884 0.256
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGATTTTGCCACCTATGCCTCCCTACAGTTGGATCTCGATAGCCTGATGGCGGAATTAACGCCCCAACAACGGGAAGTTCTCATTCTCCGCTTTGGCCTCAATGATGGCCAACCCCTAACCTTGGCGAGCATTGGCTCCATGCTCAGCATCAGTCGGGAACGGGTGCGGCAGATTGAGCGGGAAGCCCTAAATAAATTACGCAAACGCAAGTCCATGATCCAGGAATATTTAGCTAGCTAAAGAAAAGCTAACTTTCATTACGTTACCCCTGGTTTTGACGGGATCAATGGCCTAAAAACCGTATAATCCCTACCAGCATTTTTAAGAAATGTAAATAAATTTAACAATTCTCCTTTTCAGCAAACCTCACCCCTGGAATAAAAGGAACAACAATAAATT

CDS

ATGCGAGTTACCTTTTCCGCCACCGAACAATTACAACTGCGGCAGTCTGAACCTCTGCCTAGTTTGCAGCACTATTTACGCCAACCCCAGCGCCTAGTCCAGGCGATCGCCGACCCTAAATTGATGGAAGTGCTACCAGGCGATCAGTTTAGATTGAAAATGCGACCGCTCAATTTTTTAGATATTTATCATTTTCAACCCACAGTGGTACTGAAAGTGTGGGCCAACGCCACTGGCACTGTATTTTTAGAATCGGAAAGCTGTGAAATCCGGGGCATCGACTATATTAACCATCGCTTTAGTTTGCAATTAAAAGGTCGTTTGGCTCCCTATTGCCAAGATGGCCATACCCTCCTCCAGGGCAAAGCAGATTTGCAAGTGGGAGTAGATTTGCCCCAGGCCCTTTGGTTAACTCCAAAGCCGTTGTTAGAAATGGCGGCCAATGGTCTATTGCGGGGAGTTTTGGCCCGCATCAAACAACGACTCCAAGGACAACTATTGGCAGATTATCAACAGTGGTTGGCCCAGCAGAATGATAATCTAGTAACCCAGGCTTCTCCCACTGCTGAAGCTTTGGAAGCAATTTAG

Protein

MRVTFSATEQLQLRQSEPLPSLQHYLRQPQRLVQAIADPKLMEVLPGDQFRLKMRPLNFLDIYHFQPTVVLKVWANATGTVFLESESCEIRGIDYINHRFSLQLKGRLAPYCQDGHTLLQGKADLQVGVDLPQALWLTPKPLLEMAANGLLRGVLARIKQRLQGQLLADYQQWLAQQNDNLVTQASPTAEALEAI