Your browser is old and dusty. Try Google Chrome!

Details for sll2011

ORF sll2011
Accession NP_441032.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -399 -392 10.2655 0.154
NP_440561.1_1 Forward -309 -290 9.14342 0.285
NP_443002.1_5 Forward -234 -216 9.55647 0.286
NP_442752.1_4 Forward -378 -371 7.6106 0.151
NP_442752.1_6 Reverse -335 -353 19.3903 0.0711
NP_442861.1_1 Forward -41 -22 10.8159 0.295
NP_442062.1_3 Forward -170 -151 6.29264 0.182
NP_442062.1_8 Forward -304 -294 4.99491 0.188
NP_441859.1_5 Forward -61 -42 2.65439 0.295
NP_441781.1_7 Forward -104 -85 0.687771 0.242
NP_441210.1_3 Forward -61 -42 14.0608 0.259
NP_441208.1_9 Forward -192 -178 9.2427 0.217
NP_441208.1_9 Forward -396 -382 5.80112 0.262
NP_441594.1_6 Reverse -229 -248 0.294447 0.289
NP_442367.1_1 Reverse -294 -313 -11.1119 0.264
NP_441558.1_5 Forward -312 -293 8.84924 0.138
NP_440407.1_6 Forward -50 -36 12.8809 0.252
NP_440447.1_5 Forward -241 -231 11.4848 0.291
NP_442706.1_5 Reverse -27 -46 14.1126 0.245
NP_442111.1_4 Reverse -60 -74 3.14618 0.253
NP_440747.1_10 Forward -307 -295 -11.8591 0.161
NP_442973.1_5 Forward -222 -203 10.0292 0.287
NP_442850.1_8 Forward -56 -37 12.7278 0.28
NP_441667.1_1 Reverse -28 -43 14.3987 0.284
NP_440470.1_5 Forward -36 -17 7.11373 0.279
NP_441014.1_10 Forward -305 -286 -1.08295 0.257
NP_441012.1_4 Reverse -45 -58 6.21414 0.284
NP_443018.1_3 Forward -399 -392 4.36568 0.254
NP_443018.1_3 Reverse -392 -399 4.07068 0.299
NP_440376.1_1 Reverse -295 -304 4.62128 0.154
NP_441588.1_4 Forward -308 -298 7.35486 0.178
NP_442687.1_7 Reverse -390 -400 8.23984 0.11
NP_442191.1_4 Forward -303 -289 10.7022 0.288
NP_441846.1_10 Reverse -226 -245 -22.2233 0.257
NP_442530.1_2 Reverse -126 -136 11.1898 0.284
NP_442658.1_1 Reverse -248 -258 9.321 0.161
NP_440141.1_8 Forward -52 -33 6.88262 0.252
NP_442205.1_6 Forward -337 -319 12.9988 0.21
NP_440184.1_1 Reverse -96 -115 4.21601 0.227
NP_442937.1_5 Reverse -296 -315 12.1925 0.116
NP_442937.1_5 Forward -399 -380 8.45592 0.22
NP_442911.1_2 Reverse -45 -64 -9.63698 0.26
NP_442064.1_4 Forward -245 -226 4.52188 0.287
NP_443055.1_6 Reverse -35 -53 4.04996 0.189
NP_440602.1_8 Forward -400 -386 15.2409 0.126
NP_442853.1_5 Reverse -248 -267 7.76679 0.27
NP_441099.1_6 Forward -397 -378 12.4875 0.282
NP_441646.1_1 Forward -252 -233 5.60432 0.177
NP_442438.1_10 Reverse -175 -189 3.53951 0.161
NP_442431.1_7 Forward -353 -334 14.2574 0.175
NP_440206.1_4 Forward -308 -289 4.32522 0.257
NP_441041.1_4 Reverse -295 -314 -3.73712 0.125
NP_441041.1_4 Forward -400 -381 -3.93378 0.128
NP_441041.1_4 Forward -297 -278 -10.9153 0.238
NP_443063.1_7 Reverse -294 -310 7.63002 0.276
NP_439966.1_7 Reverse -389 -399 6.0761 0.195
NP_441079.1_1 Reverse -179 -198 13.8641 0.298
NP_441079.1_7 Reverse -312 -331 -6.78612 0.284
NP_440498.1_1 Reverse -382 -400 -3.71743 0.272
NP_443030.1_4 Reverse -288 -307 -6.58872 0.288
NP_442215.1_2 Reverse -286 -302 2.41848 0.116
NP_442215.1_2 Forward -29 -13 -7.21796 0.289
NP_440566.1_6 Forward -352 -333 13.5691 0.18
NP_442554.1_8 Forward -309 -299 3.42162 0.226
NP_442554.1_9 Reverse -252 -271 14.7897 0.246
NP_442313.1_6 Forward -243 -224 5.30933 0.252
NP_442142.1_4 Forward -307 -294 5.23026 0.197
NP_442301.1_2 Reverse -378 -397 8.55343 0.224
NP_442408.2_1 Forward -303 -284 0.491109 0.202
NP_441371.1_3 Reverse -176 -194 6.31233 0.277
NP_440620.1_4 Reverse -27 -41 14.3354 0.272
NP_441448.1_1 Forward -321 -302 15.6341 0.158
NP_441448.1_1 Reverse -44 -63 9.14423 0.198
NP_441448.1_1 Reverse -347 -366 8.16093 0.21
NP_441448.1_1 Forward -54 -35 5.50599 0.261
NP_441468.1_1 Forward -399 -392 4.46401 0.224
NP_441956.1_2 Forward -375 -356 17.9932 0.236
NP_441876.1_9 Reverse -187 -197 11.9759 0.269
NP_441826.1_2 Forward -310 -296 7.57108 0.0865
NP_441637.1_9 Forward -71 -53 4.44404 0.245
NP_442719.1_2 Forward -71 -53 -2.34152 0.186
NP_442719.1_2 Reverse -28 -46 -7.74969 0.239
NP_442719.1_2 Reverse -18 -36 -8.24135 0.246
NP_443058.1_7 Forward -305 -286 2.75272 0.28
NP_442808.1_1 Reverse -235 -245 3.32285 0.244
NP_440145.1_3 Forward -314 -295 -1.27885 0.15
NP_442542.1_2 Reverse -53 -66 7.09911 0.193
NP_442903.1_2 Reverse -151 -170 4.63094 0.21
NP_441937.1_5 Reverse -44 -63 2.16274 0.278
NP_441114.1_3 Reverse -296 -305 7.66954 0.231
NP_440558.1_2 Forward -313 -294 16.7157 0.0626
NP_440558.1_2 Forward -268 -249 -7.4737 0.294
NP_440558.1_5 Reverse -295 -309 15.0442 0.278
NP_442789.1_4 Reverse -350 -369 -6.49039 0.285
NP_441878.1_6 Reverse -294 -304 -6.70647 0.194
NP_441878.1_6 Reverse -225 -235 -7.88644 0.278
NP_441557.1_8 Forward -244 -234 12.4676 0.236
NP_441739.1_2 Reverse -26 -42 5.76105 0.227
NP_440101.1_10 Reverse -295 -314 7.17762 0.195
NP_442397.1_9 Reverse -288 -307 5.60432 0.246
NP_441574.1_1 Forward -397 -378 9.3409 0.11
NP_441574.1_1 Forward -192 -173 -2.95047 0.234
NP_442645.1_2 Forward -312 -293 -9.24366 0.138
NP_442594.1_8 Forward -46 -27 1.67108 0.298
NP_440151.1_2 Forward -235 -217 13.883 0.277
NP_442590.1_10 Reverse -288 -307 12.6841 0.145
NP_442998.1_10 Reverse -57 -64 10.2655 0.0946
NP_440899.1_1 Forward -81 -62 6.26042 0.287
NP_440299.1_1 Forward -68 -55 3.46031 0.243
NP_440299.1_1 Forward -308 -295 2.08368 0.299
NP_440299.1_6 Forward -314 -295 7.57094 0.237
NP_440256.1_1 Forward -307 -288 -6.49039 0.213
NP_441559.1_8 Forward -240 -226 4.12949 0.132
NP_441559.1_8 Reverse -290 -304 1.08123 0.156
NP_442452.1_3 Forward -360 -341 13.8641 0.0972
NP_442866.1_1 Reverse -289 -308 -3.73712 0.221
NP_440787.1_5 Reverse -10 -24 10.226 0.256
NP_441494.1_6 Forward -315 -302 5.52582 0.3
NP_442993.1_1 Reverse -334 -350 -13.2161 0.288
NP_442386.1_9 Reverse -390 -399 6.9808 0.219
NP_440570.1_5 Forward -238 -219 -3.54046 0.29
NP_441340.1_5 Reverse -392 -399 3.97235 0.274
NP_440586.1_8 Reverse -302 -309 5.8403 0.283
NP_440684.1_9 Forward -61 -47 7.17775 0.275
NP_440027.1_8 Reverse -222 -241 8.06178 0.249
NP_439943.1_1 Reverse -295 -314 6.39097 0.0987
NP_440316.1_10 Forward -53 -43 11.4848 0.214
NP_440364.1_6 Reverse -294 -307 14.7683 0.275
NP_441877.1_5 Forward -192 -173 -1.37718 0.285
NP_442244.1_6 Forward -253 -234 2.94938 0.291
NP_440163.1_10 Reverse -171 -181 9.12481 0.247
NP_440282.1_10 Reverse -45 -64 -10.0303 0.29
NP_442910.1_1 Forward -95 -76 -6.39206 0.254
NP_441335.1_8 Forward -47 -28 14.3558 0.16
NP_440297.1_9 Forward -303 -293 3.91327 0.253
NP_440894.1_2 Reverse -27 -46 -3.3438 0.296
NP_440894.1_10 Reverse -283 -302 8.35759 0.178
NP_440999.1_2 Reverse -227 -246 11.0125 0.223
NP_440888.1_2 Forward -235 -221 7.07881 0.208
NP_440888.1_2 Forward -304 -290 5.40719 0.28
NP_440491.1_1 Reverse -216 -235 10.7178 0.184
NP_441949.1_5 Reverse -94 -113 10.8728 0.28
NP_442818.1_3 Forward -41 -24 3.0871 0.234
NP_442845.1_2 Reverse -295 -309 6.09611 0.217
NP_442845.1_2 Reverse -288 -302 6.09611 0.217
NP_442337.1_8 Forward -172 -153 0.0977854 0.258
NP_443062.1_1 Reverse -43 -61 4.45062 0.26
NP_442204.1_9 Forward -359 -341 16.7429 0.235
NP_441560.1_1 Forward -237 -218 27.7288 0.00161
NP_440454.1_2 Reverse -150 -164 11.6616 0.272
NP_442872.1_1 Reverse -374 -393 -8.94866 0.241
NP_442428.1_5 Forward -399 -392 4.759 0.223
NP_440818.1_6 Forward -233 -214 11.3075 0.228
NP_441032.1_7 Forward -238 -219 17.5024 0.114
NP_442120.1_10 Reverse -289 -308 -7.76869 0.222
NP_440992.1_4 Forward -38 -19 15.7324 0.191
NP_442219.1_8 Forward -314 -295 12.1291 0.165
NP_441884.1_9 Forward -64 -45 -21.3384 0.242
NP_441004.1_1 Forward -93 -74 -17.0118 0.288
NP_441004.1_3 Forward -400 -381 5.80098 0.224
NP_441034.1_2 Forward -330 -311 15.6875 0.237
NP_443054.1_2 Forward -306 -292 0.982901 0.251
NP_441668.1_4 Forward -313 -294 -1.18052 0.27
NP_442515.1_1 Forward -65 -51 -3.34366 0.29
NP_440593.1_3 Forward -302 -283 -6.58872 0.278
NP_439950.1_1 Forward -289 -280 12.5861 0.279
NP_442006.1_2 Forward -53 -36 -18.4474 0.291
NP_441003.1_9 Forward -79 -60 8.25926 0.224
NP_442038.1_1 Reverse -347 -366 8.16093 0.134
NP_441078.1_4 Reverse -295 -304 -1.37691 0.254
NP_441078.1_4 Reverse -55 -64 -1.37691 0.254
NP_442729.1_5 Reverse -300 -310 7.84651 0.261
NP_442729.1_8 Forward -68 -55 7.00078 0.168
NP_441663.1_8 Forward -94 -75 -2.36049 0.266
NP_442348.1_2 Forward -121 -112 9.53783 0.28
NP_442348.1_2 Reverse -294 -303 9.14451 0.28
NP_442443.1_1 Reverse -350 -369 -1.18052 0.231
NP_441432.1_8 Reverse -294 -303 3.7363 0.243
NP_441432.1_8 Forward -344 -335 3.04799 0.268
NP_442320.1_8 Reverse -385 -399 -5.80194 0.249
NP_440131.1_2 Reverse -243 -262 5.30933 0.279
NP_441057.1_4 Forward -395 -377 -4.20908 0.299
NP_442400.1_10 Reverse -103 -116 8.84703 0.278
NP_442489.1_7 Reverse -295 -304 -1.37691 0.195
NP_442489.1_7 Forward -304 -295 -1.6719 0.235
NP_441830.1_2 Forward -244 -225 -3.63879 0.275
NP_441659.2_8 Reverse -334 -344 0.668351 0.26
NP_442346.1_5 Reverse -300 -310 12.8614 0.0349
NP_441629.1_1 Reverse -287 -306 5.50599 0.298
NP_440459.1_2 Reverse -292 -309 13.5102 0.131
NP_440459.1_2 Reverse -286 -303 7.61033 0.285
NP_440847.1_3 Reverse -36 -50 13.5686 0.213
NP_442498.1_7 Forward -383 -366 18.812 0.111
NP_441895.1_10 Forward -50 -31 -27.4349 0.282
NP_441895.1_10 Forward -40 -21 -27.8282 0.299
NP_440224.1_4 Reverse -294 -313 5.50599 0.225
NP_441044.1_4 Forward -267 -249 1.49411 0.272
NP_442199.1_5 Forward -318 -299 -5.01543 0.235
NP_442140.1_3 Reverse -44 -54 5.87989 0.194
NP_441609.1_1 Forward -43 -24 -1.7705 0.272
NP_442254.1_1 Reverse -162 -181 -5.50708 0.282
NP_440590.1_4 Forward -309 -296 -3.22564 0.255
NP_441239.1_9 Reverse -248 -260 5.84051 0.206
NP_441239.1_9 Forward -312 -300 4.16888 0.26
NP_441892.1_1 Reverse -292 -309 -0.944468 0.193
NP_440740.1_2 Forward -396 -377 11.7008 0.236
NP_440833.1_6 Reverse -34 -48 17.6985 0.134
NP_440833.1_6 Reverse -25 -39 9.53707 0.261
NP_442216.1_4 Reverse -38 -46 8.1805 0.255
NP_440546.1_4 Reverse -301 -311 10.9186 0.101
NP_442402.1_4 Reverse -298 -317 4.22689 0.147
NP_441084.1_6 Forward -312 -298 16.8098 0.0523
NP_440653.1_10 Forward -309 -290 4.12936 0.252
NP_442273.1_10 Forward -356 -338 8.57394 0.224
NP_442456.1_5 Forward -204 -186 10.7372 0.26
NP_441252.1_6 Forward -39 -32 11.6422 0.288
NP_440548.1_10 Forward -370 -351 9.63589 0.169
NP_441408.2_7 Forward -312 -293 4.32602 0.191
NP_440914.1_1 Forward -303 -293 9.39583 0.186
NP_442470.1_4 Reverse -253 -272 15.7316 0.284
NP_442533.1_1 Forward -43 -24 -8.65367 0.211
NP_442533.1_6 Reverse -301 -310 4.62128 0.179
NP_442533.1_6 Reverse -78 -87 2.85133 0.236
NP_442541.1_10 Forward -235 -221 1.5723 0.283
NP_442322.1_4 Reverse -327 -344 -6.74666 0.277
NP_443016.1_1 Reverse -37 -56 -7.17871 0.27
NP_441482.1_7 Forward -310 -296 -11.4068 0.262
NP_442269.1_10 Forward -252 -233 1.47442 0.291
NP_441028.1_6 Reverse -186 -196 10.9926 0.193
NP_442202.1_4 Reverse -50 -64 13.2231 0.259
NP_441527.1_4 Reverse -97 -116 -10.4568 0.27
NP_441527.1_7 Reverse -32 -51 7.66846 0.29
NP_440007.1_9 Forward -307 -293 2.5562 0.277
NP_440608.1_6 Reverse -377 -396 3.83357 0.282
NP_439903.1_6 Forward -313 -294 0.686995 0.258
NP_442588.1_1 Forward -400 -381 6.4893 0.265
NP_441286.1_1 Forward -65 -53 2.10393 0.0737
NP_441705.1_3 Forward -51 -32 0.58944 0.249
NP_441930.1_2 Reverse -294 -304 11.9764 0.271
NP_440886.1_7 Reverse -390 -400 7.15773 0.103
NP_441463.1_3 Reverse -381 -400 6.58763 0.0604
NP_441836.1_2 Forward -316 -297 -0.590531 0.213
NP_442084.1_6 Forward -101 -83 7.00065 0.221
NP_442698.1_10 Forward -278 -259 -1.47551 0.299
NP_440293.1_3 Reverse -293 -312 -2.85214 0.241
NP_441237.1_9 Reverse -295 -305 10.5998 0.224
NP_439910.1_2 Reverse -383 -400 -22.5773 0.267
NP_442867.1_8 Forward -233 -214 5.30933 0.276
NP_440987.1_7 Reverse -99 -113 13.8643 0.232
NP_442297.1_4 Reverse -232 -251 13.5023 0.239
NP_441984.1_3 Forward -314 -296 14.9655 0.124
NP_442509.1_9 Forward -88 -78 12.5659 0.0871
NP_442509.1_9 Forward -201 -191 9.91099 0.192
NP_442514.1_10 Forward -316 -297 6.68596 0.273
NP_441159.1_4 Forward -321 -302 6.4893 0.212
NP_441885.1_5 Reverse -55 -65 0.176696 0.177
NP_440628.1_3 Forward -285 -271 15.4376 0.262
NP_442341.1_7 Forward -298 -284 3.93283 0.208
NP_441173.1_9 Reverse -22 -30 9.75379 0.284
NP_442395.2_9 Forward -280 -264 14.2182 0.226
NP_440191.1_4 Reverse -309 -319 14.9903 0.254
NP_442638.1_3 Forward -49 -30 11.6973 0.298
NP_440149.1_8 Forward -189 -170 -6.29373 0.246
NP_441105.1_3 Reverse -221 -240 -2.95047 0.171
NP_441105.1_3 Reverse -290 -309 -3.54046 0.181
NP_440216.1_9 Forward -308 -299 7.37455 0.286
NP_442015.1_10 Reverse -284 -297 2.96921 0.187
NP_441045.1_2 Forward -36 -17 16.5191 0.118
NP_440416.1_9 Reverse -218 -237 -16.3235 0.212
NP_440416.1_9 Forward -252 -233 -18.3884 0.256
NP_443052.1_9 Forward -239 -220 -5.9004 0.274
NP_443052.1_9 Forward -368 -349 -7.37537 0.297
NP_440885.1_6 Reverse -52 -71 6.63086 0.241
NP_442403.1_8 Forward -68 -49 0.786102 0.241
NP_440261.1_5 Forward -63 -50 -10.8955 0.221
NP_440988.1_10 Forward -230 -216 5.28608 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGCGGTGGCGGTTTTACTGATTGGTGATGCAGCCCCCAACTTTGCAACCAGGTTAAAGGCAGTGGGTTATGAGAATTACGAAATAGTGGAAACCATGGCCAATGCCGTTCAGCGAGGATTAGAGTTAGCAAGTAAAAACAATGCCAGTGCAGTCTTGCTTTCCCCGGCCTGTGCCAGTTTCGACCAATATAATAGCTTTGAGGAACGGGGAGAAGATTTCCGTGCCTGTTGTTTAGGATTGGTTTAGCTTAGTTGTATTTGGTTAATGATGAGCTTACCCGGCCTTGTTTTTAAATCTCTTTACCCTACCTAGAGGAACGGCCGAACTAATGTTATGGCGATATTCCCGACCATGGGGAATTTGGGGAAGTTTGGTGAACAGCTAGTGTTTGAGTGAAGT

CDS

ATGAGTATGGGCCCCATTTCTGAATTGTTAACTGTGTCCTATCCCATTGCGGAAACTTTCCATTCCCTACAGGGGGAGGGAGCTTGGGCTGGCGGCAATGCCTTTTTTATTCGCCTTGGGGGTTGTGATGTTCATTGCCCTTGGTGTGACCAAAAGGAAACCTGGCCTACCCAACACCATCCCCGACAAACAGTGACAGAACTTGTGCAACAGGCAGTTACGGCTAAACCGAGCTTTGTGGTGATTACGGGGGGAGAACCCCTCATGCACGACCTACAACCCCTCTGTAAAACCCTGAAAAACCAGGGTTTACGTCTGCATTTGGAAACGTCCGGCGCTTACCCACTGACAGGTCAATTTGACTGGATTACCCTGTCCCCCAAACCCTATAAGCTTCCCCAGGCAGCAATTTATCCCCTGGCCAACGAATTGAAAGTGATTATCAGTCAGGATGAGGATTTTGACTGGGCGGAAATGGAAGCTAGGAAAATTAGCCCCGGTACTCCGCTCTATTTACAAGCTGAATGGGAAACGGAAGCAATGAATGAAAAAATCTTTGCCTATATCCTCACCCATTCCCAATGGCGCTTGAGCCTGCAAACTCATAAATATTTGGGCGTGCGCTAG

Protein

MSMGPISELLTVSYPIAETFHSLQGEGAWAGGNAFFIRLGGCDVHCPWCDQKETWPTQHHPRQTVTELVQQAVTAKPSFVVITGGEPLMHDLQPLCKTLKNQGLRLHLETSGAYPLTGQFDWITLSPKPYKLPQAAIYPLANELKVIISQDEDFDWAEMEARKISPGTPLYLQAEWETEAMNEKIFAYILTHSQWRLSLQTHKYLGVR