Your browser is old and dusty. Try Google Chrome!

Details for sll2003

ORF sll2003
Accession NP_441044.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -146 -160 9.5377 0.0722
NP_441061.1_2 Forward -153 -139 -1.8687 0.274
NP_441061.1_2 Forward -68 -54 -2.06536 0.281
NP_440795.1_7 Forward -153 -146 14.6904 0.0123
NP_440795.1_7 Reverse -146 -153 14.6904 0.0123
NP_441418.1_6 Forward -154 -135 -9.63698 0.0288
NP_441418.1_6 Forward -364 -345 -29.0082 0.215
NP_442291.1_5 Reverse -144 -160 11.2683 0.0402
NP_442291.1_5 Forward -155 -139 5.95839 0.0727
NP_441453.1_1 Reverse -348 -366 3.75497 0.263
NP_441453.1_4 Reverse -145 -153 16.539 0.00633
NP_441453.1_4 Forward -154 -146 16.539 0.00633
NP_441453.1_4 Forward -364 -356 6.80426 0.121
NP_441453.1_4 Reverse -355 -363 6.11594 0.121
NP_442151.1_6 Reverse -192 -206 9.2427 0.155
NP_441818.1_1 Reverse -146 -157 15.4961 0.0264
NP_441818.1_1 Reverse -356 -367 14.4145 0.0502
NP_441818.1_1 Forward -153 -142 9.30127 0.246
NP_440226.1_1 Forward -154 -135 7.57094 0.103
NP_440226.1_1 Reverse -355 -374 3.53937 0.221
NP_440226.1_1 Reverse -145 -164 1.96607 0.282
NP_441630.1_3 Forward -162 -143 4.81767 0.157
NP_441098.1_8 Reverse -271 -290 5.11266 0.284
NP_440348.1_3 Forward -80 -61 14.2574 0.282
NP_441976.1_2 Reverse -361 -380 13.6666 0.257
NP_442744.1_9 Reverse -54 -68 14.3866 0.266
NP_442287.1_3 Reverse -137 -154 19.0159 0.0701
NP_442173.1_1 Forward -153 -145 15.4574 0.00633
NP_442173.1_1 Reverse -146 -154 15.4574 0.00633
NP_442173.1_1 Reverse -356 -364 12.0158 0.0316
NP_442173.1_1 Forward -68 -60 5.72262 0.203
NP_442173.1_1 Forward -363 -355 4.83764 0.241
NP_442752.1_4 Forward -364 -357 13.8055 0.0199
NP_442752.1_4 Forward -154 -147 13.8055 0.0199
NP_442752.1_4 Reverse -145 -152 13.8055 0.0199
NP_443027.1_4 Reverse -143 -153 11.8781 0.0872
NP_443027.1_4 Forward -156 -146 11.0914 0.107
NP_441812.1_3 Forward -155 -141 8.55439 0.251
NP_442975.1_10 Reverse -141 -155 13.4703 0.0459
NP_442975.1_10 Forward -205 -191 5.50552 0.219
NP_440784.1_7 Forward -153 -146 15.9687 0.0123
NP_440784.1_7 Reverse -146 -153 15.9687 0.0123
NP_440784.1_7 Forward -363 -356 6.23397 0.241
NP_440784.1_7 Reverse -356 -363 6.13563 0.241
NP_442000.2_6 Forward -171 -152 19.469 0.0799
NP_440061.1_9 Reverse -143 -157 18.3868 0.00917
NP_440061.1_9 Reverse -353 -367 10.3237 0.126
NP_440061.1_9 Forward -156 -142 5.30886 0.29
NP_440928.1_4 Forward -304 -285 10.0284 0.204
NP_440110.1_6 Reverse -140 -159 14.1591 0.205
NP_441499.1_5 Reverse -259 -273 15.4376 0.275
NP_442062.1_8 Forward -154 -144 19.4496 0.000558
NP_442062.1_8 Reverse -145 -155 17.3846 0.00193
NP_442062.1_8 Forward -62 -52 2.83163 0.293
NP_442826.1_1 Reverse -263 -282 4.12936 0.222
NP_441900.1_1 Forward -151 -132 9.88101 0.273
NP_442974.1_6 Reverse -354 -373 17.9932 0.293
NP_440304.1_4 Reverse -260 -270 2.14332 0.299
NP_440304.1_4 Forward -156 -146 1.84832 0.299
NP_440304.1_4 Reverse -143 -153 1.84832 0.299
NP_442242.1_4 Forward -153 -146 14.3954 0.0124
NP_442242.1_4 Reverse -146 -153 14.3954 0.0124
NP_442242.1_4 Reverse -193 -200 10.0689 0.174
NP_440044.1_8 Forward -153 -134 -1.57384 0.248
NP_441035.1_3 Forward -274 -255 1.27776 0.241
NP_441581.1_6 Reverse -136 -155 9.38943 0.291
NP_442602.1_3 Forward -147 -128 8.75091 0.0877
NP_441935.1_1 Forward -153 -134 7.57094 0.24
NP_441619.1_8 Forward -160 -146 8.84875 0.237
NP_440132.1_1 Forward -366 -348 12.9005 0.189
NP_441082.1_10 Reverse -247 -260 9.85238 0.237
NP_442726.1_1 Forward -159 -140 19.5673 0.0708
NP_441925.1_5 Reverse -296 -310 16.2242 0.132
NP_441083.1_5 Reverse -145 -155 20.3345 0.00053
NP_441083.1_5 Reverse -355 -365 17.7779 0.00336
NP_441083.1_5 Forward -154 -144 11.3864 0.0159
NP_441083.1_5 Forward -364 -354 -1.00328 0.289
NP_441149.1_7 Reverse -217 -236 0.982764 0.276
NP_441434.1_7 Forward -152 -138 5.1128 0.225
NP_441738.1_2 Reverse -357 -364 15.28 0.0102
NP_441738.1_2 Forward -152 -145 15.28 0.0102
NP_441738.1_2 Reverse -147 -154 15.28 0.0102
NP_441558.1_5 Forward -366 -347 11.0125 0.0879
NP_441558.1_5 Reverse -353 -372 6.98095 0.198
NP_440209.1_1 Reverse -145 -153 18.1123 0.00295
NP_440209.1_1 Forward -154 -146 18.1123 0.00295
NP_440209.1_1 Forward -364 -356 8.57422 0.0425
NP_440209.1_1 Reverse -355 -363 5.52596 0.0821
NP_440209.1_2 Reverse -221 -237 13.1366 0.17
NP_442889.1_8 Reverse -142 -156 14.8469 0.0473
NP_441713.1_1 Forward -370 -351 -16.6185 0.285
NP_442111.1_4 Forward -155 -141 3.53951 0.24
NP_440851.1_3 Reverse -298 -317 4.03102 0.245
NP_440851.1_6 Forward -149 -132 7.11867 0.263
NP_440906.1_5 Forward -153 -146 15.8704 0.0124
NP_440906.1_5 Reverse -146 -153 15.8704 0.0124
NP_440906.1_5 Forward -200 -193 9.47889 0.116
NP_440906.1_5 Forward -363 -356 6.23397 0.234
NP_440906.1_5 Reverse -356 -363 6.13563 0.241
NP_440747.1_10 Forward -157 -145 16.7552 0.0019
NP_440747.1_10 Reverse -142 -154 7.31547 0.00577
NP_440747.1_10 Forward -367 -355 -2.61596 0.0556
NP_441130.1_10 Forward -156 -142 15.5359 0.0312
NP_441130.1_10 Reverse -143 -157 9.43936 0.125
NP_441486.1_1 Reverse -142 -156 4.91614 0.0399
NP_441486.1_1 Reverse -189 -203 -0.492064 0.156
NP_441486.1_1 Forward -204 -190 -4.03198 0.186
NP_441486.1_1 Forward -157 -143 -4.13031 0.189
NP_441486.1_1 Forward -65 -51 -5.01529 0.218
NP_440403.1_4 Reverse -136 -155 4.916 0.111
NP_440403.1_10 Forward -154 -135 5.50599 0.242
NP_441014.1_8 Reverse -348 -367 -9.24366 0.293
NP_441014.1_10 Forward -155 -136 13.175 0.104
NP_441014.1_10 Reverse -191 -210 1.27698 0.23
NP_441014.1_10 Forward -58 -39 -1.18128 0.257
NP_443018.1_3 Forward -153 -146 14.8871 0.0123
NP_443018.1_3 Reverse -146 -153 14.8871 0.0123
NP_443018.1_3 Reverse -356 -363 11.7405 0.0655
NP_443018.1_3 Forward -363 -356 5.44732 0.193
NP_441634.1_8 Forward -156 -142 14.8476 0.0248
NP_441634.1_8 Forward -366 -352 -4.52363 0.295
NP_440376.1_1 Forward -154 -145 19.4693 0.000692
NP_440376.1_1 Reverse -145 -154 19.4693 0.000692
NP_440376.1_1 Forward -364 -355 5.99792 0.111
NP_440376.1_1 Forward -62 -53 4.32629 0.163
NP_440376.1_1 Forward -69 -60 2.75299 0.215
NP_440376.1_1 Forward -342 -333 1.1797 0.255
NP_440376.1_1 Reverse -355 -364 -0.196935 0.285
NP_441588.1_4 Forward -152 -142 7.05986 0.178
NP_441588.1_4 Reverse -147 -157 6.46988 0.193
NP_442687.1_7 Reverse -144 -154 15.8113 0.0125
NP_442687.1_7 Forward -155 -145 8.92815 0.0994
NP_442687.1_7 Reverse -52 -62 7.05986 0.142
NP_442687.1_7 Forward -42 -32 4.0116 0.271
NP_442485.1_3 Reverse -134 -153 8.35759 0.13
NP_442485.1_3 Forward -156 -137 -5.50708 0.291
NP_441846.1_10 Reverse -7 -26 -23.2067 0.279
NP_442958.1_3 Forward -375 -356 1.96607 0.267
NP_442958.1_3 Forward -165 -146 -1.86883 0.293
NP_441422.1_7 Reverse -143 -160 -3.5994 0.235
NP_441746.1_2 Forward -167 -148 14.4541 0.248
NP_442296.1_9 Reverse -146 -165 -0.885524 0.197
NP_442658.1_1 Reverse -143 -153 17.0891 0.00615
NP_442658.1_1 Forward -156 -146 7.94438 0.199
NP_440141.1_8 Reverse -45 -64 6.4893 0.26
NP_442496.1_5 Reverse -229 -247 4.44404 0.289
NP_440656.1_8 Reverse -134 -153 -9.047 0.273
NP_441414.1_9 Reverse -145 -164 12.5858 0.0155
NP_441414.1_9 Reverse -355 -374 -3.93378 0.143
NP_442937.1_5 Reverse -140 -159 7.37428 0.254
NP_441958.1_5 Forward -155 -145 12.2714 0.00183
NP_441958.1_5 Reverse -144 -154 12.2714 0.00183
NP_441958.1_5 Reverse -354 -364 1.55333 0.095
NP_441958.1_5 Forward -365 -355 0.865012 0.12
NP_441958.1_5 Forward -70 -60 -0.609952 0.215
NP_441127.1_1 Reverse -17 -31 8.25939 0.3
NP_442486.1_4 Reverse -147 -166 7.27595 0.273
NP_442836.1_5 Forward -160 -141 14.1591 0.0588
NP_442836.1_5 Forward -370 -351 6.58763 0.174
NP_439905.1_1 Reverse -356 -369 17.6205 0.0361
NP_439905.1_1 Reverse -146 -159 9.65572 0.216
NP_440984.1_7 Forward -159 -145 11.3077 0.122
NP_440984.1_7 Reverse -140 -154 5.89945 0.235
NP_439990.1_5 Forward -159 -146 10.2457 0.128
NP_439990.1_5 Forward -206 -193 7.6891 0.186
NP_442911.1_2 Forward -164 -145 -3.24547 0.11
NP_440153.1_5 Forward -153 -139 0.392915 0.299
NP_441591.1_10 Forward -366 -347 4.916 0.297
NP_441591.1_10 Forward -156 -137 4.32602 0.297
NP_443055.1_3 Reverse -136 -155 21.3401 0.0162
NP_443055.1_6 Reverse -137 -155 6.90155 0.164
NP_443055.1_6 Forward -138 -120 1.69003 0.225
NP_440993.1_7 Reverse -27 -41 16.4362 0.275
NP_440934.1_1 Forward -168 -149 26.4505 0.00301
NP_440602.1_8 Forward -69 -55 13.2743 0.174
NP_440138.1_6 Reverse -146 -165 13.2733 0.109
NP_439975.1_1 Forward -273 -254 18.9765 0.0758
NP_441099.1_5 Forward -164 -145 5.30933 0.0469
NP_441099.1_5 Forward -183 -164 -9.44032 0.223
NP_442002.1_9 Reverse -144 -151 10.7572 0.185
NP_440809.1_9 Reverse -346 -364 -6.56903 0.225
NP_441294.1_7 Reverse -141 -155 18.8495 0.00443
NP_441294.1_7 Reverse -351 -365 17.6976 0.00714
NP_441646.1_1 Forward -161 -142 -1.27885 0.281
NP_441000.1_6 Forward -155 -141 14.8476 0.0396
NP_441000.1_6 Reverse -144 -158 -3.93365 0.225
NP_441000.1_6 Reverse -354 -368 -4.62196 0.248
NP_440484.1_1 Reverse -347 -366 10.815 0.214
NP_440147.1_4 Reverse -143 -156 17.6205 0.00602
NP_440147.1_4 Forward -156 -143 15.0639 0.0197
NP_440147.1_4 Reverse -353 -366 1.29759 0.233
NP_440147.1_4 Reverse -363 -376 0.412608 0.255
NP_441550.1_8 Forward -156 -146 15.1225 0.0132
NP_441550.1_8 Forward -366 -356 13.8442 0.0207
NP_441550.1_8 Reverse -353 -363 10.6976 0.0648
NP_441550.1_8 Reverse -143 -153 8.82935 0.112
NP_441916.1_7 Forward -154 -144 18.4663 0.00144
NP_441916.1_7 Reverse -145 -155 10.3048 0.0261
NP_441041.1_4 Forward -154 -135 -12.8819 0.276
NP_441041.1_7 Reverse -142 -154 17.9128 0.00663
NP_441041.1_7 Forward -72 -60 10.0414 0.103
NP_441041.1_7 Reverse -352 -364 5.37687 0.26
NP_441041.1_7 Forward -377 -365 5.08534 0.278
NP_442396.1_5 Forward -158 -145 11.819 0.0913
NP_441725.1_4 Forward -159 -145 2.26061 0.287
NP_441725.1_5 Forward -153 -143 2.04498 0.115
NP_441725.1_5 Reverse -146 -156 2.04498 0.115
NP_439966.1_7 Reverse -143 -153 17.9741 0.00631
NP_439966.1_7 Forward -156 -146 15.3192 0.0152
NP_439966.1_7 Reverse -353 -363 5.97777 0.199
NP_439966.1_7 Forward -366 -356 5.58445 0.216
NP_439966.1_7 Reverse -58 -68 4.01116 0.295
NP_439966.1_9 Reverse -143 -152 0.884706 0.253
NP_440736.1_3 Forward -71 -52 6.29264 0.223
NP_440202.1_8 Reverse -136 -155 10.1954 0.297
NP_442941.1_3 Reverse -146 -156 19.2529 0.00262
NP_442941.1_3 Forward -153 -143 10.7964 0.0116
NP_442941.1_3 Reverse -356 -366 9.41981 0.0319
NP_442941.1_3 Reverse -193 -203 7.55152 0.0711
NP_440674.1_3 Forward -154 -135 2.26107 0.267
NP_440289.1_2 Reverse -142 -155 20.6688 0.00313
NP_440289.1_2 Forward -157 -144 -3.61896 0.267
NP_440289.1_4 Forward -249 -230 8.35759 0.297
NP_440983.1_9 Forward -163 -144 1.57275 0.292
NP_441678.1_9 Forward -375 -356 -2.0655 0.257
NP_442281.1_1 Reverse -140 -154 20.3534 0.00192
NP_442281.1_1 Reverse -55 -69 14.6503 0.0168
NP_442281.1_1 Forward -159 -145 7.86545 0.0907
NP_440177.1_9 Forward -162 -143 12.0942 0.238
NP_442256.1_2 Forward -156 -138 -8.53565 0.227
NP_440437.1_1 Reverse -349 -368 0.884433 0.162
NP_442012.1_2 Forward -366 -347 12.3892 0.134
NP_440375.1_8 Forward -153 -134 -0.197208 0.266
NP_442068.1_2 Forward -72 -53 7.27595 0.3
NP_441644.1_6 Reverse -145 -155 17.3841 0.00127
NP_441644.1_6 Reverse -355 -365 14.4342 0.0126
NP_441644.1_6 Forward -154 -144 10.1076 0.0628
NP_441644.1_6 Forward -364 -354 5.68278 0.18
NP_443049.1_6 Forward -365 -355 14.4711 0.114
NP_442215.1_2 Reverse -190 -206 -1.71142 0.187
NP_442215.1_2 Reverse -51 -67 -6.92296 0.281
NP_440253.1_2 Forward -154 -136 10.1472 0.0415
NP_440253.1_2 Forward -69 -51 -3.52077 0.294
NP_440929.1_8 Forward -154 -145 19.2726 0.000701
NP_440929.1_8 Reverse -145 -154 19.2726 0.000701
NP_440929.1_8 Reverse -355 -364 7.07956 0.0713
NP_441346.1_7 Forward -141 -122 10.2259 0.274
NP_442933.1_2 Forward -314 -296 9.16921 0.257
NP_442933.1_10 Forward -154 -145 17.601 0.00325
NP_442933.1_10 Reverse -145 -154 17.601 0.00325
NP_441751.2_8 Reverse -146 -160 14.0609 0.0132
NP_441751.2_8 Forward -153 -139 -3.93365 0.157
NP_441751.2_8 Reverse -356 -370 -6.98191 0.294
NP_442926.1_3 Reverse -146 -165 5.01433 0.245
NP_442554.1_8 Reverse -146 -156 16.2046 0.0065
NP_442554.1_8 Forward -153 -143 14.1397 0.0144
NP_442554.1_8 Reverse -356 -366 6.37155 0.12
NP_442554.1_8 Forward -363 -353 4.50326 0.184
NP_441762.1_7 Forward -155 -143 2.98891 0.0676
NP_441762.1_7 Reverse -144 -156 2.39892 0.0676
NP_441762.1_7 Forward -365 -353 -7.33585 0.287
NP_442142.1_4 Reverse -142 -155 13.8833 0.0324
NP_442142.1_4 Forward -157 -144 6.80355 0.154
NP_442142.1_4 Reverse -352 -365 4.44361 0.222
NP_442292.1_1 Reverse -146 -155 18.486 0.00229
NP_442292.1_1 Forward -153 -144 9.63616 0.0183
NP_442292.1_1 Reverse -356 -365 8.65285 0.0335
NP_442476.1_6 Reverse -146 -160 9.34103 0.0888
NP_442476.1_6 Reverse -356 -370 1.17956 0.228
NP_442381.1_8 Reverse -142 -161 1.76941 0.103
NP_442381.1_8 Forward -157 -138 -6.58872 0.161
NP_443009.1_5 Forward -155 -144 18.3477 0.00265
NP_443009.1_5 Forward -375 -364 5.26972 0.21
NP_441715.1_4 Forward -153 -143 18.8596 0.00741
NP_441715.1_4 Reverse -146 -156 17.3846 0.0106
NP_441715.1_4 Reverse -356 -366 7.55152 0.108
NP_441715.1_4 Reverse -193 -203 4.99491 0.24
NP_440357.1_3 Forward -125 -106 1.0811 0.275
NP_440881.1_4 Reverse -213 -232 1.76941 0.226
NP_440279.1_2 Forward -165 -146 10.7175 0.146
NP_441448.1_6 Reverse -359 -378 21.0414 0.0407
NP_440183.1_9 Forward -152 -133 -3.83545 0.194
NP_441468.1_1 Forward -153 -146 15.8704 0.0124
NP_441468.1_1 Reverse -146 -153 15.8704 0.0124
NP_441468.1_1 Forward -363 -356 6.13563 0.209
NP_441468.1_1 Reverse -356 -363 6.0373 0.223
NP_441020.2_6 Forward -156 -139 6.92201 0.249
NP_441673.1_1 Forward -154 -145 20.8459 0.000698
NP_441673.1_1 Reverse -145 -154 20.8459 0.000698
NP_441673.1_1 Forward -364 -355 1.37636 0.114
NP_441673.1_1 Reverse -355 -364 1.1797 0.163
NP_441673.1_1 Reverse -53 -62 -8.06341 0.254
NP_441731.1_3 Forward -162 -143 -6.58872 0.296
NP_442253.1_5 Reverse -126 -143 -6.15601 0.297
NP_440265.1_7 Forward -166 -152 16.3219 0.169
NP_441876.1_9 Forward -265 -255 11.3859 0.275
NP_441826.1_2 Forward -160 -146 -4.52363 0.296
NP_441637.1_9 Reverse -308 -326 5.72234 0.245
NP_442868.1_6 Forward -156 -146 19.2529 0.00563
NP_442868.1_6 Reverse -143 -153 10.3048 0.038
NP_442868.1_6 Forward -366 -356 9.51814 0.0447
NP_442719.1_2 Forward -145 -127 -0.374908 0.162
NP_441612.1_2 Reverse -145 -155 8.54929 0.21
NP_442808.1_1 Reverse -144 -154 18.4657 0.00201
NP_442808.1_1 Reverse -354 -364 9.71433 0.0481
NP_442808.1_1 Forward -155 -145 8.63269 0.0481
NP_441176.1_3 Reverse -342 -361 12.9791 0.276
NP_440145.1_3 Reverse -135 -154 -1.86883 0.156
NP_440145.1_4 Reverse -61 -71 16.5975 0.123
NP_442542.1_2 Reverse -143 -156 15.6539 0.0793
NP_442542.1_9 Reverse -138 -152 13.5686 0.108
NP_442050.1_5 Forward -156 -146 14.3359 0.0206
NP_442050.1_5 Reverse -143 -153 6.96107 0.27
NP_440601.1_8 Forward -164 -145 17.3761 0.148
NP_440601.1_8 Forward -148 -129 16.606 0.175
NP_440346.1_6 Forward -284 -274 15.4106 0.221
NP_441114.1_3 Reverse -131 -140 8.35786 0.231
NP_441518.1_3 Reverse -135 -154 2.16274 0.0598
NP_441518.1_3 Forward -211 -192 -15.8318 0.299
NP_441878.1_6 Forward -155 -145 10.4031 0.0176
NP_441878.1_6 Reverse -144 -154 10.4031 0.0176
NP_441878.1_6 Forward -139 -129 -7.49312 0.231
NP_441036.1_8 Reverse -144 -154 17.7779 0.000554
NP_441036.1_8 Forward -155 -145 8.33817 0.174
NP_441557.1_5 Forward -154 -145 19.9609 0.000699
NP_441557.1_5 Reverse -145 -154 19.9609 0.000699
NP_441557.1_5 Forward -364 -355 1.08137 0.0794
NP_441557.1_5 Reverse -355 -364 0.589713 0.134
NP_441445.1_1 Reverse -136 -155 6.4893 0.148
NP_441445.1_1 Forward -210 -191 0.0977854 0.283
NP_441445.1_1 Forward -373 -354 -0.295539 0.289
NP_442066.2_9 Forward -158 -145 20.0788 0.00699
NP_442066.2_9 Reverse -141 -154 8.77074 0.185
NP_441433.1_8 Reverse -270 -289 -2.65548 0.27
NP_441739.1_2 Forward -270 -254 4.08943 0.247
NP_441458.1_10 Reverse -136 -155 1.0811 0.298
NP_442469.1_8 Reverse -224 -238 15.8309 0.23
NP_442183.1_1 Reverse -145 -159 11.5043 0.0702
NP_442183.1_1 Forward -154 -140 10.6193 0.0821
NP_442183.1_1 Forward -69 -55 10.4227 0.0845
NP_440190.1_5 Reverse -43 -61 12.3105 0.282
NP_442135.1_5 Reverse -136 -154 16.1446 0.24
NP_441574.1_1 Reverse -224 -243 -7.86702 0.297
NP_442347.1_2 Reverse -146 -155 12.4878 0.056
NP_442347.1_2 Forward -153 -144 11.1111 0.056
NP_442347.1_2 Reverse -356 -365 10.3245 0.058
NP_442347.1_2 Reverse -349 -358 4.71961 0.266
NP_442347.1_2 Forward -200 -191 3.83464 0.284
NP_442645.1_2 Forward -162 -143 -14.6519 0.177
NP_442645.1_2 Forward -372 -353 -21.9284 0.29
NP_441037.1_4 Reverse -143 -153 6.92787 0.237
NP_442594.1_8 Reverse -234 -253 5.99764 0.236
NP_442317.1_6 Forward -159 -140 6.98095 0.231
NP_441633.1_3 Forward -156 -143 10.8357 0.0286
NP_441633.1_3 Reverse -143 -156 5.72248 0.0481
NP_440136.1_2 Forward -153 -146 15.9687 0.0123
NP_440136.1_2 Reverse -146 -153 15.9687 0.0123
NP_440136.1_2 Forward -363 -356 6.23397 0.171
NP_440136.1_2 Reverse -356 -363 6.13563 0.193
NP_442590.1_10 Reverse -348 -367 8.35759 0.208
NP_442998.1_5 Forward -273 -263 11.9764 0.176
NP_442998.1_10 Reverse -357 -364 15.5754 0.0102
NP_442998.1_10 Forward -152 -145 15.5754 0.0102
NP_442998.1_10 Reverse -147 -154 15.5754 0.0102
NP_440899.1_1 Reverse -224 -243 6.65079 0.267
NP_440299.1_1 Forward -158 -145 10.9334 0.0529
NP_441799.1_1 Forward -158 -144 16.1252 0.0153
NP_441799.1_1 Reverse -141 -155 10.0287 0.0797
NP_441799.1_1 Reverse -351 -365 9.04542 0.1
NP_441799.1_1 Forward -368 -354 6.78381 0.162
NP_441799.1_1 Reverse -49 -63 6.48882 0.17
NP_441799.1_1 Forward -378 -364 3.73557 0.284
NP_441007.1_10 Forward -159 -146 8.27909 0.115
NP_442201.1_10 Forward -165 -146 -13.0786 0.27
NP_442201.1_10 Reverse -134 -153 -14.6519 0.285
NP_440256.1_1 Forward -157 -138 16.2241 0.0061
NP_440256.1_1 Reverse -142 -161 -9.63698 0.284
NP_442961.1_4 Reverse -187 -206 3.83436 0.288
NP_440087.1_1 Forward -373 -354 -6.49039 0.253
NP_440087.1_1 Forward -163 -144 -8.85033 0.285
NP_441559.1_8 Reverse -360 -374 4.52282 0.117
NP_441559.1_8 Reverse -257 -271 -5.90027 0.271
NP_441559.1_8 Reverse -140 -154 -5.90027 0.271
NP_441559.1_8 Reverse -361 -375 -6.88358 0.281
NP_440915.1_6 Reverse -141 -155 3.63784 0.101
NP_440915.1_6 Reverse -160 -174 1.27789 0.142
NP_440915.1_6 Forward -368 -354 0.687908 0.155
NP_440915.1_6 Forward -158 -144 0.687908 0.155
NP_442855.1_3 Forward -344 -325 12.8808 0.237
NP_442785.1_7 Reverse -353 -367 9.2427 0.27
NP_442069.1_10 Reverse -146 -164 17.7187 0.0593
NP_442866.1_1 Forward -156 -137 -6.09707 0.249
NP_440306.1_3 Reverse -24 -43 4.81767 0.295
NP_442993.1_1 Forward -69 -53 0.451859 0.0636
NP_442993.1_1 Forward -154 -138 -7.70961 0.146
NP_442993.1_1 Forward -41 -25 -11.2495 0.24
NP_442386.1_9 Reverse -144 -153 15.7322 0.0144
NP_442386.1_9 Forward -155 -146 13.8639 0.0289
NP_442386.1_9 Reverse -354 -363 4.52254 0.297
NP_442386.1_10 Reverse -251 -264 4.54251 0.262
NP_441340.1_5 Forward -153 -146 15.6737 0.0124
NP_441340.1_5 Reverse -146 -153 15.6737 0.0124
NP_441340.1_5 Forward -363 -356 13.5105 0.0314
NP_441340.1_5 Reverse -356 -363 5.84064 0.208
NP_442186.1_10 Reverse -52 -71 19.5664 0.112
NP_441947.1_4 Reverse -134 -153 11.2092 0.267
NP_442791.1_5 Reverse -137 -156 -10.0303 0.279
NP_440168.1_9 Forward -156 -137 -5.40875 0.296
NP_440161.1_3 Forward -156 -137 15.2408 0.117
NP_440586.1_8 Forward -153 -146 13.2151 0.026
NP_440586.1_8 Reverse -146 -153 13.2151 0.026
NP_440586.1_8 Reverse -356 -363 9.47853 0.146
NP_440586.1_8 Reverse -193 -200 9.3802 0.156
NP_440586.1_8 Forward -363 -356 5.74197 0.283
NP_442251.1_6 Forward -153 -146 15.2804 0.0124
NP_442251.1_6 Reverse -146 -153 15.2804 0.0124
NP_440192.1_4 Reverse -224 -243 14.1516 0.169
NP_440684.1_9 Forward -160 -146 12.9793 0.168
NP_441262.1_3 Reverse -145 -152 14.7888 0.0223
NP_441262.1_3 Forward -364 -357 14.7888 0.0223
NP_441262.1_3 Forward -154 -147 14.7888 0.0223
NP_441262.1_3 Reverse -192 -199 5.15232 0.265
NP_443051.1_1 Reverse -144 -153 10.4228 0.00754
NP_443051.1_1 Forward -155 -146 10.4228 0.00754
NP_443051.1_1 Forward -365 -356 7.47288 0.0571
NP_443051.1_1 Reverse -354 -363 0.29472 0.195
NP_439984.1_3 Forward -161 -147 18.9768 0.0523
NP_439984.1_3 Forward -371 -357 16.0269 0.133
NP_439937.1_9 Forward -272 -255 -6.45167 0.157
NP_440408.1_7 Reverse -1 -20 8.75091 0.269
NP_440439.1_1 Reverse -142 -155 3.06754 0.121
NP_440439.1_1 Forward -157 -144 1.88757 0.139
NP_440439.1_1 Forward -367 -354 0.707601 0.179
NP_439943.1_7 Forward -226 -207 3.6377 0.29
NP_439943.1_7 Reverse -360 -379 3.24438 0.29
NP_440372.1_2 Forward -153 -146 16.3621 0.0124
NP_440372.1_2 Reverse -146 -153 16.3621 0.0124
NP_440372.1_2 Forward -363 -356 13.8055 0.0214
NP_440372.1_2 Reverse -356 -363 6.52896 0.188
NP_441138.1_5 Reverse -310 -323 8.84703 0.238
NP_441138.1_5 Reverse -307 -320 3.02202 0.297
NP_441789.1_7 Reverse -322 -341 -4.03287 0.28
NP_440316.1_10 Reverse -6 -16 5.78156 0.281
NP_440139.1_1 Reverse -139 -158 4.12856 0.19
NP_440267.1_2 Reverse -140 -154 12.2903 0.125
NP_442384.1_10 Reverse -145 -158 19.2922 0.00338
NP_442384.1_10 Reverse -355 -368 8.47575 0.0656
NP_442384.1_10 Forward -154 -141 2.87088 0.21
NP_442384.1_10 Forward -135 -122 0.60927 0.286
NP_442114.1_4 Forward -154 -143 9.20345 0.17
NP_441980.1_8 Reverse -160 -179 7.96426 0.258
NP_441877.1_7 Reverse -140 -159 4.03023 0.218
NP_441018.1_7 Reverse -361 -380 6.88262 0.281
NP_442790.1_4 Forward -163 -144 7.86593 0.0729
NP_442790.1_4 Reverse -136 -155 -6.1954 0.144
NP_442790.1_4 Forward -373 -354 -14.5535 0.278
NP_442262.1_10 Forward -153 -146 14.1988 0.0123
NP_442262.1_10 Reverse -146 -153 14.1988 0.0123
NP_442262.1_10 Reverse -356 -363 13.2155 0.0213
NP_441689.1_5 Forward -156 -146 5.78111 0.197
NP_440344.1_10 Reverse -138 -155 8.10198 0.0114
NP_440344.1_10 Reverse -348 -365 -2.3211 0.0643
NP_440344.1_10 Forward -208 -191 -10.8759 0.194
NP_440344.1_10 Forward -76 -59 -13.9242 0.298
NP_440282.1_10 Reverse -147 -166 -6.68705 0.25
NP_440531.1_6 Reverse -137 -156 8.45592 0.0844
NP_440531.1_6 Forward -162 -143 4.52268 0.124
NP_440531.1_6 Forward -129 -110 3.44104 0.145
NP_441965.1_10 Reverse -142 -158 9.00665 0.123
NP_442693.1_7 Reverse -144 -163 13.9625 0.202
NP_440297.1_9 Forward -153 -143 -0.118297 0.282
NP_440297.1_9 Reverse -146 -156 -0.118297 0.282
NP_442187.1_3 Forward -365 -355 15.6147 0.105
NP_441592.1_4 Reverse -145 -164 -0.885524 0.247
NP_440999.1_9 Reverse -141 -155 11.406 0.0448
NP_440999.1_9 Reverse -361 -375 2.5562 0.148
NP_440888.1_2 Reverse -145 -159 14.1586 0.02
NP_440888.1_2 Forward -154 -140 13.8636 0.0231
NP_440888.1_2 Reverse -355 -369 10.5204 0.0919
NP_440600.1_4 Forward -162 -144 6.50899 0.0974
NP_440600.1_4 Reverse -137 -155 0.21581 0.142
NP_440822.1_4 Forward -227 -209 19.6347 0.255
NP_440179.1_6 Reverse -366 -385 8.55425 0.202
NP_442033.1_10 Forward -376 -357 -9.73531 0.221
NP_441543.1_2 Forward -153 -144 18.486 0.00236
NP_441543.1_2 Reverse -146 -155 16.9127 0.00359
NP_441543.1_2 Reverse -356 -365 7.07956 0.131
NP_441543.1_2 Reverse -193 -202 4.42462 0.246
NP_442845.1_2 Forward -160 -146 7.9644 0.195
NP_441469.1_8 Reverse -144 -153 16.126 0.00797
NP_441469.1_8 Forward -155 -146 6.48957 0.227
NP_443064.1_6 Reverse -145 -155 12.5669 0.0796
NP_442578.1_7 Forward -153 -146 14.5921 0.026
NP_442578.1_7 Reverse -146 -153 14.5921 0.026
NP_442578.1_7 Forward -363 -356 6.0373 0.18
NP_440710.1_1 Reverse -137 -155 -0.374176 0.163
NP_441462.1_2 Forward -364 -354 16.2046 0.00406
NP_441462.1_2 Forward -154 -144 11.5831 0.00406
NP_441462.1_2 Reverse -145 -155 11.5831 0.00406
NP_441929.1_6 Reverse -212 -231 4.62101 0.294
NP_443062.1_1 Reverse -145 -163 13.5188 0.0616
NP_443062.1_1 Forward -154 -136 10.3986 0.117
NP_443062.1_6 Forward -162 -143 0.491109 0.294
NP_442204.1_1 Forward -368 -357 -0.0396598 0.285
NP_441560.1_10 Reverse -137 -156 6.19431 0.292
NP_442487.1_5 Reverse -364 -383 4.32522 0.25
NP_440516.1_2 Forward -160 -142 -2.53746 0.299
NP_440516.1_8 Forward -364 -355 18.9776 0.00442
NP_440516.1_8 Forward -154 -145 16.9127 0.00442
NP_440516.1_8 Reverse -145 -154 16.9127 0.00442
NP_440516.1_8 Reverse -355 -364 5.01461 0.118
NP_442428.1_5 Forward -153 -146 15.8704 0.0124
NP_442428.1_5 Reverse -146 -153 15.8704 0.0124
NP_442428.1_5 Forward -363 -356 6.13563 0.209
NP_442428.1_5 Reverse -356 -363 6.0373 0.212
NP_442120.1_10 Reverse -54 -73 -6.09707 0.203
NP_440673.1_3 Forward -152 -145 12.4288 0.0426
NP_440673.1_3 Reverse -357 -364 12.4288 0.0426
NP_440673.1_3 Reverse -147 -154 12.4288 0.0426
NP_440673.1_3 Forward -14 -7 6.72562 0.277
NP_441052.1_2 Reverse -145 -155 19.9412 0.00106
NP_441052.1_2 Reverse -355 -365 10.6981 0.0285
NP_441052.1_2 Forward -154 -144 10.5014 0.0285
NP_442219.1_9 Reverse -146 -155 17.7976 0.00718
NP_442219.1_9 Forward -153 -144 8.35786 0.0681
NP_442219.1_9 Reverse -356 -365 7.96454 0.0696
NP_440436.1_4 Forward -153 -144 18.1905 0.00233
NP_440436.1_4 Reverse -146 -155 17.2072 0.00233
NP_440436.1_4 Reverse -356 -365 7.57079 0.124
NP_440436.1_4 Reverse -193 -202 4.42421 0.265
NP_441884.1_9 Reverse -142 -161 -16.2252 0.138
NP_441884.1_9 Reverse -57 -76 -21.9284 0.272
NP_440314.1_9 Reverse -146 -165 3.24438 0.0849
NP_440314.1_9 Reverse -356 -375 -9.24366 0.262
NP_441719.1_4 Forward -153 -146 16.3621 0.0124
NP_441719.1_4 Reverse -146 -153 16.3621 0.0124
NP_441719.1_4 Forward -363 -356 6.82395 0.0855
NP_441719.1_4 Reverse -356 -363 6.52896 0.188
NP_441733.1_10 Forward -157 -144 7.09911 0.156
NP_441004.1_1 Forward -144 -125 -13.6686 0.26
NP_442813.1_4 Reverse -267 -286 5.50599 0.197
NP_442813.1_4 Reverse -266 -285 -8.06369 0.299
NP_442139.1_7 Forward -183 -164 11.4058 0.19
NP_440129.1_10 Reverse -138 -152 1.76955 0.297
NP_443054.1_2 Forward -156 -142 10.6193 0.0761
NP_443054.1_2 Reverse -58 -72 2.65453 0.242
NP_442586.1_2 Reverse -336 -355 12.2908 0.154
NP_441851.1_10 Reverse -144 -154 16.008 0.00552
NP_441851.1_10 Forward -155 -145 15.8113 0.00552
NP_442622.1_8 Reverse -145 -163 -8.83064 0.138
NP_442622.1_8 Forward -154 -136 -9.32229 0.145
NP_442011.1_1 Reverse -144 -163 4.22769 0.232
NP_442856.1_7 Reverse -136 -155 -3.3438 0.243
NP_441668.1_4 Forward -164 -145 -1.96717 0.285
NP_442515.1_1 Reverse -144 -158 11.6026 0.0393
NP_442515.1_1 Forward -155 -141 3.04785 0.125
NP_442515.1_1 Forward -325 -311 -1.47537 0.255
NP_441396.1_5 Reverse -276 -285 7.47288 0.252
NP_440593.1_3 Forward -250 -231 -5.31042 0.259
NP_440165.1_5 Forward -155 -136 -3.54046 0.22
NP_440165.1_5 Reverse -144 -163 -7.96535 0.286
NP_441046.1_2 Forward -375 -356 4.71934 0.228
NP_441349.1_10 Forward -164 -145 3.44104 0.0669
NP_441349.1_10 Reverse -135 -154 -8.752 0.278
NP_440432.1_9 Forward -153 -138 16.8928 0.00961
NP_442843.1_1 Reverse -146 -165 3.93269 0.153
NP_442843.1_1 Reverse -219 -238 -10.4236 0.278
NP_442843.1_1 Forward -153 -134 -10.6203 0.279
NP_439960.1_10 Forward -167 -149 -4.60241 0.293
NP_440474.1_8 Forward -153 -139 7.86545 0.196
NP_442450.1_5 Forward -342 -332 7.64985 0.13
NP_440588.1_2 Forward -163 -144 6.29264 0.0584
NP_440588.1_2 Forward -117 -98 0.58944 0.146
NP_442006.1_2 Reverse -136 -153 -17.1691 0.27
NP_442006.1_2 Reverse -275 -292 -17.6607 0.279
NP_441570.1_1 Forward -154 -136 8.57394 0.0134
NP_441570.1_1 Reverse -192 -210 -11.0923 0.187
NP_441570.1_1 Reverse -145 -163 -13.9439 0.225
NP_441570.1_1 Forward -364 -346 -16.5988 0.249
NP_440078.1_10 Forward -178 -159 5.70265 0.224
NP_441078.1_4 Forward -154 -145 19.6659 0.0007
NP_441078.1_4 Reverse -145 -154 19.6659 0.0007
NP_441078.1_4 Forward -364 -355 0.196389 0.205
NP_441078.1_4 Reverse -355 -364 -0.000272808 0.205
NP_442729.1_8 Forward -158 -145 10.639 0.125
NP_441663.1_8 Reverse -139 -158 2.45773 0.203
NP_442348.1_2 Reverse -261 -270 13.5694 0.179
NP_442443.1_1 Forward -129 -110 -5.50708 0.282
NP_440526.1_3 Forward -153 -142 2.02482 0.267
NP_440526.1_3 Reverse -146 -157 1.04151 0.267
NP_441432.1_8 Forward -155 -146 16.8143 0.00595
NP_441432.1_8 Forward -365 -356 14.0611 0.0258
NP_441432.1_8 Reverse -6 -15 9.24284 0.0755
NP_441432.1_8 Reverse -144 -153 8.25953 0.0755
NP_441432.1_9 Forward -58 -45 9.66489 0.269
NP_442320.1_8 Reverse -139 -153 4.91614 0.0442
NP_442320.1_8 Forward -160 -146 -4.81863 0.188
NP_442344.1_7 Forward -153 -134 -5.70374 0.168
NP_441732.1_2 Reverse -351 -367 -16.8544 0.207
NP_440321.1_1 Reverse -243 -260 11.5436 0.28
NP_442815.1_2 Reverse -15 -33 12.1139 0.144
NP_440760.1_1 Reverse -145 -164 -3.44213 0.0342
NP_442797.1_2 Reverse -140 -158 13.5317 0.239
NP_442353.1_4 Reverse -139 -158 5.50519 0.183
NP_440913.1_1 Forward -156 -138 10.2456 0.175
NP_441072.1_2 Reverse -134 -153 8.25926 0.24
NP_442489.1_7 Forward -154 -145 20.1576 0.000695
NP_442489.1_7 Reverse -145 -154 20.1576 0.000695
NP_442489.1_7 Forward -364 -355 0.688044 0.152
NP_442489.1_7 Reverse -355 -364 0.688044 0.152
NP_442489.1_7 Forward -62 -53 -1.77023 0.247
NP_442489.1_7 Forward -69 -60 -1.86856 0.259
NP_442079.1_7 Reverse -146 -165 0.982764 0.266
NP_440559.1_1 Reverse -146 -155 17.4043 0.00658
NP_440559.1_1 Forward -153 -144 8.75118 0.0586
NP_440559.1_1 Reverse -356 -365 7.76787 0.0918
NP_441659.2_8 Reverse -145 -155 18.1713 0.00133
NP_441659.2_8 Forward -154 -144 11.9764 0.0147
NP_441659.2_8 Reverse -355 -365 5.48657 0.106
NP_441659.2_8 Forward -364 -354 1.84832 0.224
NP_442849.1_1 Reverse -23 -37 7.76774 0.282
NP_441800.1_7 Forward -298 -280 -3.02911 0.268
NP_440779.1_5 Forward -154 -137 -5.76269 0.152
NP_442346.1_5 Forward -155 -145 16.6963 0.00248
NP_442346.1_5 Reverse -144 -154 9.02648 0.118
NP_440025.1_3 Forward -142 -128 11.2885 0.29
NP_440831.1_3 Forward -147 -128 7.35791 0.256
NP_440831.1_3 Forward -163 -144 6.77545 0.27
NP_442857.1_5 Reverse -30 -49 10.0292 0.291
NP_441653.1_1 Reverse -295 -309 18.9775 0.155
NP_441653.1_2 Reverse -134 -153 3.91615 0.264
NP_440010.1_6 Forward -165 -146 8.06259 0.213
NP_442551.1_4 Reverse -127 -142 -0.80675 0.245
NP_440847.1_3 Forward -292 -278 11.5037 0.263
NP_442603.1_7 Reverse -145 -159 14.6503 0.0613
NP_442603.1_7 Reverse -355 -369 12.8803 0.0937
NP_441888.1_7 Reverse -140 -154 12.0943 0.0743
NP_441888.1_7 Reverse -360 -374 9.73436 0.137
NP_441888.1_7 Forward -159 -145 2.75286 0.225
NP_440946.1_6 Forward -238 -219 1.67108 0.294
NP_441948.1_4 Reverse -138 -156 6.50899 0.0633
NP_441833.1_4 Forward -153 -146 15.9687 0.0124
NP_441833.1_4 Reverse -146 -153 15.9687 0.0124
NP_441833.1_4 Reverse -356 -363 6.52896 0.0924
NP_441833.1_4 Forward -363 -356 6.23397 0.163
NP_441833.1_4 Forward -200 -193 4.46401 0.256
NP_440751.1_3 Forward -236 -217 7.17681 0.287
NP_441329.1_1 Forward -45 -26 6.63627 0.252
NP_441895.1_2 Reverse -2 -21 -26.5499 0.24
NP_441112.1_6 Reverse -135 -154 5.70265 0.172
NP_442162.1_9 Forward -153 -146 16.2637 0.0124
NP_442162.1_9 Reverse -146 -153 16.2637 0.0124
NP_442162.1_9 Forward -363 -356 12.9205 0.0282
NP_442162.1_9 Reverse -356 -363 12.9205 0.0282
NP_442140.1_3 Forward -153 -143 14.238 0.0486
NP_442140.1_3 Reverse -146 -156 10.3048 0.0902
NP_442140.1_3 Reverse -356 -366 8.23984 0.122
NP_441609.1_1 Reverse -263 -282 2.55606 0.189
NP_440875.1_9 Forward -152 -142 16.6457 0.0145
NP_440875.1_9 Reverse -159 -169 8.37203 0.233
NP_441813.1_5 Reverse -143 -153 19.4496 0.00647
NP_441813.1_5 Forward -156 -146 18.1713 0.00743
NP_441813.1_5 Forward -366 -356 8.4365 0.0432
NP_441813.1_5 Reverse -353 -363 5.48657 0.123
NP_440590.1_4 Forward -153 -140 4.8375 0.0585
NP_440590.1_4 Reverse -356 -369 3.95252 0.0658
NP_440590.1_4 Reverse -146 -159 2.67422 0.0835
NP_440590.1_4 Reverse -193 -206 -4.40561 0.261
NP_440590.1_4 Forward -172 -159 -6.07724 0.299
NP_440567.1_1 Reverse -146 -160 2.65453 0.167
NP_440567.1_1 Forward -153 -139 -0.393733 0.281
NP_440567.1_1 Forward -363 -349 -0.492064 0.287
NP_442497.1_10 Forward -153 -144 10.4228 0.0087
NP_442497.1_10 Reverse -146 -155 10.4228 0.0087
NP_442497.1_10 Reverse -356 -365 0.589713 0.153
NP_442497.1_10 Forward -363 -354 -1.18024 0.256
NP_440821.1_4 Reverse -143 -153 10.2065 0.0163
NP_440821.1_4 Forward -156 -146 9.41981 0.0286
NP_440821.1_4 Forward -366 -356 -0.314959 0.251
NP_441239.1_9 Reverse -143 -155 14.1986 0.0288
NP_441239.1_9 Reverse -353 -365 9.57708 0.102
NP_441239.1_9 Forward -156 -144 7.80712 0.148
NP_442691.1_7 Reverse -354 -373 6.48849 0.286
NP_441892.1_1 Reverse -136 -153 3.57876 0.123
NP_441892.1_1 Reverse -120 -137 -5.95935 0.294
NP_441017.1_8 Reverse -259 -274 6.56807 0.297
NP_440876.1_5 Reverse -147 -166 10.7175 0.244
NP_441617.1_6 Forward -121 -102 4.32602 0.155
NP_441617.1_6 Reverse -292 -311 -5.60541 0.274
NP_442138.1_10 Forward -154 -135 21.7306 0.00921
NP_440546.1_4 Forward -364 -354 15.6695 0.0459
NP_440546.1_4 Forward -154 -144 11.8882 0.0679
NP_440546.1_4 Reverse -145 -155 10.046 0.109
NP_441230.1_5 Reverse -124 -143 -0.4922 0.287
NP_440462.1_6 Reverse -143 -153 17.2863 0.00752
NP_440462.1_6 Forward -156 -146 9.61647 0.0429
NP_440462.1_6 Reverse -353 -363 6.56821 0.109
NP_440868.1_4 Forward -368 -356 17.0502 0.0124
NP_440868.1_4 Reverse -141 -153 10.3637 0.0388
NP_440868.1_4 Forward -158 -146 9.97041 0.0405
NP_440868.1_6 Forward -141 -122 17.8957 0.105
NP_441204.1_1 Reverse -136 -155 9.0459 0.25
NP_441582.1_5 Forward -64 -45 8.84842 0.164
NP_440638.2_8 Reverse -275 -292 12.4285 0.215
NP_442402.1_10 Forward -289 -279 14.3359 0.18
NP_442402.1_10 Forward -81 -71 12.5659 0.206
NP_441848.1_4 Forward -278 -262 8.41009 0.288
NP_441848.1_7 Forward -237 -218 9.63507 0.196
NP_440696.1_3 Forward -154 -136 5.03403 0.198
NP_442039.1_4 Forward -153 -146 15.1821 0.0124
NP_442039.1_4 Reverse -146 -153 15.1821 0.0124
NP_442039.1_4 Forward -363 -356 11.6422 0.0747
NP_442039.1_4 Forward -68 -61 7.02061 0.269
NP_441926.1_3 Forward -69 -53 4.18844 0.197
NP_440825.1_6 Reverse -283 -302 9.0459 0.285
NP_441053.1_3 Reverse -3 -22 -1.18052 0.278
NP_442786.1_2 Forward -308 -289 14.6576 0.133
NP_442837.1_3 Forward -153 -146 15.7721 0.0124
NP_442837.1_3 Reverse -146 -153 15.7721 0.0124
NP_442837.1_3 Forward -363 -356 6.0373 0.25
NP_442837.1_3 Reverse -356 -363 6.0373 0.25
NP_440160.1_5 Reverse -359 -369 15.5158 0.267
NP_440160.1_5 Reverse -149 -159 14.5325 0.291
NP_442053.1_1 Forward -154 -145 18.3876 0.0007
NP_442053.1_1 Reverse -145 -154 18.3876 0.0007
NP_442053.1_1 Reverse -355 -364 14.4544 0.0114
NP_442053.1_1 Forward -364 -355 7.86621 0.0863
NP_440505.1_3 Forward -156 -146 18.3679 0.00213
NP_440505.1_3 Forward -366 -356 16.7946 0.00614
NP_440505.1_3 Reverse -143 -153 15.9097 0.00857
NP_441252.1_6 Forward -141 -134 14.3954 0.168
NP_442532.1_4 Forward -204 -186 7.86797 0.289
NP_440914.1_1 Reverse -145 -155 17.5935 0.000537
NP_440914.1_1 Reverse -355 -365 13.1043 0.0386
NP_440914.1_1 Forward -364 -354 10.8597 0.118
NP_440914.1_1 Reverse -60 -70 9.98138 0.164
NP_440914.1_1 Forward -154 -144 8.6151 0.186
NP_441011.1_8 Forward -153 -144 16.9127 0.00602
NP_441011.1_8 Forward -363 -354 11.5045 0.0778
NP_441011.1_8 Reverse -146 -155 8.25953 0.144
NP_442101.1_6 Reverse -288 -307 17.699 0.133
NP_442533.1_1 Reverse -243 -262 -15.5368 0.256
NP_442533.1_6 Forward -154 -145 17.2076 0.00137
NP_442533.1_6 Reverse -145 -154 17.2076 0.00137
NP_442533.1_6 Reverse -355 -364 4.42462 0.179
NP_442232.1_3 Forward -382 -363 -6.1954 0.18
NP_442232.1_3 Forward -162 -143 -13.3736 0.282
NP_441219.1_6 Reverse -135 -153 10.5406 0.252
NP_441482.1_7 Forward -160 -146 -4.7203 0.156
NP_441482.1_7 Forward -380 -366 -11.3085 0.254
NP_441482.1_7 Reverse -139 -153 -12.1934 0.29
NP_439944.1_9 Reverse -146 -156 10.5014 0.0887
NP_439944.1_9 Reverse -193 -203 7.45319 0.141
NP_442269.1_10 Forward -165 -146 8.25926 0.194
NP_441028.1_6 Reverse -266 -276 4.89613 0.275
NP_441028.1_6 Forward -288 -278 4.10949 0.278
NP_440116.1_8 Forward -363 -344 -7.96535 0.242
NP_440115.1_6 Forward -367 -357 15.0247 0.0505
NP_440115.1_6 Forward -157 -147 6.76487 0.167
NP_440007.1_9 Forward -205 -191 8.75105 0.171
NP_440007.1_9 Forward -368 -354 2.5562 0.277
NP_440608.1_5 Forward -304 -290 18.1551 0.191
NP_441602.1_3 Forward -159 -140 -4.81876 0.274
NP_441972.1_5 Reverse -146 -165 -10.227 0.3
NP_441106.1_1 Reverse -144 -153 18.191 0.0028
NP_441106.1_1 Forward -155 -146 9.63616 0.0311
NP_439903.1_7 Reverse -272 -291 2.85105 0.281
NP_442306.1_10 Forward -159 -140 -20.0601 0.202
NP_441286.1_1 Reverse -191 -203 7.80712 0.0258
NP_441286.1_1 Forward -155 -143 6.03717 0.0258
NP_441286.1_1 Reverse -144 -156 3.38223 0.0467
NP_441286.1_1 Forward -365 -353 -4.48425 0.161
NP_441385.1_1 Reverse -254 -269 17.6795 0.224
NP_441385.1_1 Reverse -10 -25 15.3195 0.28
NP_440670.1_8 Forward -154 -145 18.3876 0.000699
NP_440670.1_8 Reverse -145 -154 18.3876 0.000699
NP_440670.1_8 Forward -364 -355 8.75118 0.0606
NP_440670.1_8 Reverse -355 -364 6.19458 0.124
NP_440670.1_8 Forward -69 -60 5.11294 0.171
NP_440670.1_8 Forward -201 -192 4.62128 0.189
NP_441705.1_3 Forward -380 -361 -3.83545 0.291
NP_440886.1_7 Reverse -144 -154 17.7774 0.0011
NP_440886.1_7 Reverse -59 -69 12.0743 0.0805
NP_440886.1_7 Forward -155 -145 7.94438 0.0805
NP_440886.1_7 Reverse -354 -364 6.76441 0.114
NP_442072.1_1 Reverse -359 -377 3.3624 0.289
NP_442072.1_9 Forward -365 -347 -22.597 0.246
NP_440513.1_4 Reverse -145 -164 8.65258 0.295
NP_440907.2_8 Forward -153 -143 7.94438 0.117
NP_441905.1_3 Reverse -53 -71 17.9146 0.193
NP_441021.1_1 Reverse -146 -165 1.17943 0.0848
NP_441463.1_2 Reverse -294 -312 -0.686551 0.29
NP_441463.1_3 Reverse -135 -154 7.57094 0.052
NP_441463.1_3 Forward -164 -145 -0.590531 0.133
NP_441626.1_2 Forward -153 -146 15.7721 0.0124
NP_441626.1_2 Reverse -146 -153 15.7721 0.0124
NP_441626.1_2 Forward -363 -356 12.2322 0.0511
NP_441626.1_2 Reverse -356 -363 5.93897 0.231
NP_442365.1_7 Forward -158 -139 2.0644 0.168
NP_442794.1_1 Forward -158 -146 7.31547 0.142
NP_442794.1_1 Forward -205 -193 6.62715 0.169
NP_440387.1_1 Reverse -145 -161 6.45005 0.0282
NP_441431.1_2 Reverse -142 -156 8.25877 0.221
NP_441431.1_2 Forward -264 -250 7.17714 0.247
NP_441431.1_2 Forward -367 -353 6.0955 0.28
NP_441488.1_7 Forward -160 -141 5.70265 0.155
NP_441836.1_2 Reverse -139 -158 -1.96717 0.224
NP_441993.1_1 Forward -137 -118 0.484826 0.298
NP_440114.1_10 Forward -154 -140 15.7325 0.0234
NP_440114.1_10 Forward -364 -350 13.0776 0.0662
NP_440114.1_10 Reverse -145 -159 5.80112 0.292
NP_442090.1_10 Reverse -253 -266 12.3107 0.18
NP_442323.1_7 Forward -238 -219 2.06362 0.273
NP_441510.2_6 Reverse -135 -154 12.88 0.267
NP_440287.1_6 Forward -373 -354 0.982764 0.286
NP_441272.1_7 Reverse -275 -285 13.2547 0.271
NP_440293.1_3 Forward -146 -127 -1.27885 0.239
NP_440766.1_4 Forward -73 -59 7.86607 0.0871
NP_439910.1_2 Reverse -137 -154 -21.3973 0.183
NP_442867.1_8 Forward -152 -133 7.17762 0.244
NP_440457.1_1 Forward -368 -356 3.38223 0.196
NP_440457.1_1 Reverse -141 -153 -0.649339 0.271
NP_440457.1_1 Forward -158 -146 -0.74767 0.273
NP_441984.1_3 Reverse -365 -383 6.80398 0.264
NP_440473.1_9 Reverse -134 -153 -0.000545616 0.128
NP_442509.1_5 Reverse -137 -154 16.2627 0.164
NP_442509.1_9 Forward -154 -144 16.2041 0.00739
NP_442509.1_9 Reverse -145 -155 8.14104 0.192
NP_442514.1_5 Reverse -369 -388 -7.6711 0.279
NP_440734.1_9 Reverse -135 -154 17.6007 0.0988
NP_440554.1_4 Forward -153 -143 16.4996 0.0189
NP_440554.1_4 Reverse -146 -156 8.92815 0.0646
NP_440554.1_4 Reverse -356 -366 5.97822 0.128
NP_441885.1_5 Reverse -145 -155 20.9245 0.000538
NP_441885.1_5 Forward -154 -144 11.4848 0.00668
NP_441885.1_5 Reverse -355 -365 1.25834 0.11
NP_441885.1_5 Forward -364 -354 -0.0199663 0.186
NP_440478.1_10 Reverse -143 -157 16.4209 0.107
NP_442703.1_9 Forward -313 -295 3.3624 0.292
NP_442341.1_7 Reverse -59 -73 9.34103 0.0751
NP_442341.1_7 Reverse -144 -158 6.78443 0.118
NP_442341.1_7 Forward -155 -141 3.14618 0.234
NP_442341.1_9 Forward -366 -352 8.94708 0.162
NP_441173.1_9 Forward -287 -279 11.3271 0.226
NP_442395.2_4 Reverse -144 -163 9.14342 0.12
NP_440423.1_6 Reverse -137 -156 3.34271 0.0831
NP_440423.1_6 Forward -162 -143 -7.27704 0.138
NP_443000.1_7 Forward -156 -146 19.9412 0.00223
NP_443000.1_7 Reverse -143 -153 11.5831 0.0344
NP_443000.1_7 Forward -366 -356 10.2065 0.0355
NP_443000.1_7 Forward -203 -193 4.50326 0.188
NP_440552.1_8 Forward -40 -23 11.8931 0.236
NP_441842.1_1 Reverse -357 -370 10.7368 0.291
NP_441842.1_10 Forward -76 -62 7.27608 0.264
NP_440275.1_3 Reverse -143 -153 15.418 0.0178
NP_440275.1_3 Forward -156 -146 15.123 0.0182
NP_440275.1_3 Forward -366 -356 12.5664 0.0316
NP_440091.1_1 Reverse -141 -153 10.7571 0.0429
NP_443010.1_10 Reverse -142 -159 2.57753 0.273
NP_442495.1_4 Forward -387 -377 10.9931 0.295
NP_440149.1_8 Forward -374 -355 -7.76869 0.292
NP_441105.1_3 Forward -165 -146 -8.55534 0.274
NP_440216.1_1 Forward -154 -140 16.1259 0.00307
NP_440216.1_1 Reverse -145 -159 -0.885388 0.0286
NP_440216.1_1 Reverse -355 -369 -11.6035 0.203
NP_440216.1_1 Forward -364 -350 -11.9968 0.236
NP_440172.1_1 Reverse -145 -155 15.0247 0.00945
NP_440172.1_1 Reverse -60 -70 9.51814 0.0586
NP_440172.1_1 Forward -364 -354 8.82982 0.0586
NP_440172.1_1 Forward -154 -144 8.73149 0.0586
NP_440172.1_1 Reverse -355 -365 2.24165 0.279
NP_440172.1_1 Forward -62 -52 1.84832 0.294
NP_440167.1_3 Reverse -135 -154 9.3409 0.258
NP_442015.1_10 Reverse -141 -154 3.16588 0.185
NP_442015.1_10 Forward -158 -145 2.67422 0.187
NP_441045.1_2 Reverse -163 -182 23.8939 0.0139
NP_441226.1_7 Forward -153 -146 14.4934 0.0123
NP_441226.1_7 Reverse -146 -153 14.4934 0.0123
NP_441226.1_7 Forward -363 -356 12.7234 0.0312
NP_441226.1_7 Reverse -356 -363 11.5435 0.0757
NP_441757.1_3 Forward -365 -346 -0.4922 0.225
NP_441111.1_7 Forward -153 -145 18.7023 0.00294
NP_441111.1_7 Reverse -146 -154 18.7023 0.00294
NP_441111.1_7 Reverse -356 -364 8.86921 0.0589
NP_441766.1_2 Forward -154 -145 17.5026 0.00297
NP_441766.1_2 Reverse -145 -154 17.5026 0.00297
NP_441766.1_2 Reverse -355 -364 14.7494 0.00772
NP_442252.1_3 Reverse -138 -156 9.95058 0.224
NP_442179.1_1 Reverse -361 -380 12.7825 0.226
NP_440416.1_1 Forward -154 -135 -5.70374 0.155
NP_440416.1_9 Forward -161 -142 -16.7168 0.22
NP_440416.1_9 Forward -381 -362 -18.4868 0.259
NP_443052.1_8 Reverse -135 -154 10.7175 0.0166
NP_442403.1_9 Forward -166 -147 20.1573 0.0643
NP_440591.1_9 Forward -161 -143 12.1139 0.0935
NP_440261.1_5 Reverse -356 -369 2.96921 0.0655
NP_440261.1_5 Reverse -146 -159 -2.53732 0.0924
NP_440261.1_5 Forward -153 -140 -12.1738 0.272
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAAAATAGGTCTTATTCGCTAGGCCGGGAAATTGCTGGCGATCGGGTATCAGGTTCACAGGGTCAGCCATTAGTGGGGAAACATCAACAAAATACCTTAACAAAAACCTCAACTTCCCCCAAGAACATGGGAAAATGCCCCCCAAGTCCAACAGTTACCATGCCCCAAGATTCCGCCCTTGAACTTTCCTGCCCTCAATGATGATCGCAAATATTTACTGCTGCTTACCGGAGCGGCCCTGATTCTGGCGATCGCCGGTTTGGGCAATGTACCCCTGCGGGATTTTGACGAAGGTTATTACGCTACTACAGCTCAGGATACTTTCCTCAGAGGAGATTGGCGTTTTCCCACCTATTTAGGGCAACCTTTTTTATCCAAACCTCCCCTCATTGCCTGGTTG

CDS

GTGATGGGCAGTTACCATCTGCTGGGCATCAGTGAATTTAGCTCCCGTTTACCGTTGGCCCTGGGGTCAGCCCTGGCGGTGCCGTTGTTATATCTGCTAGGTAAGGAAATTTTTTCTTCCCCTAGAGCGGCCCTGTGGAGTAGTTCGATATTGTTAACCCTGCTTCCCACTGCCCGTTTGGGTCGTTTAACCATGTTGGACGGGGTAATCAACGCCTGTTTGCTTTGGTCATTACTTTGCTTACTGCGGGGGCGGAAAAATCCCCATTGGTTGGGGGGCATAGGTATAGGTTTGGGGTTAATTGCCTTGGCTAAGGGTTTACTGGTGCTGGCCCTGGCACTGTTGTTGGGCATTGTAATTTTCTGGCTGGGGGAAGGGCGAATTTTTCAACGCTGGCAATTCTGGTTGGGGCTATTGATCGGTTTTGCCCCAGTGCTGTGGTGGTACCAACTCCAATTTGCCGAGTACGGGGAAACCTTTTGGCAAATTCATTTTGAGTTTCATAGTTTTGAGCGGGTTACCCAGGAATTAGAGGGCAATACGGGGCCCCCTTGGTATTACCTGTTGGAGATTGTTAAATACACTGCCCCCTGGCTATTTTTCCTCATTCCCGCTGCGGTAATGACTGTTCAACAATGGCGACAGGACTGGGCTAAGGTTGCCATTACCTTTGGCTTCGGCTTCTTGCTGATTATTTCCGCCATGGGCACTAAGTTACCCTGGTATGTACTCCCCTGTTATCCCTTTTTCGCTCTGATGGGGGGATATTATTTAGCAGATTTGGAAGGTCGCCCACGTTATCCCCGGCTAATTGGTTACCTCCTTGCTCTCACCGCTGTGGTGGGCCTGGTGGGGGGATTGTACGCTGGTTTCATCGAGCAAAAACCGGTGATTATCATCATGGGGCTAGTGCTATTTGTTGGTGTAGGTTGGAGTGCCAAACAATATTTGCACTCTTCCCCTAAATTTGCCAAAACCCTGGTGATGGGGCTGTATGTAACCTTGCTATTTCTTTTTTCCAGTCCCCTCTGGAATTGGGAAGTGAATGAAGCCTTTGCCGTTAAGCCCGTGGGGCGGTTAATTAAACAAAGCACCCCAGTTAATACCCTAATTTACACTTCCTTTGCCTACAGTCGTCCCAGTTTGGATTTCTATGGTGATCGCCAGGTGATTGCGGTGGATGATGACCAGTTACGAACTAAGGCGAAGGAAGGAAATTATTTATTGCTCGACCAAAATGCCCAAGGCAGACTAGCTTTAGCCAATTTACAAAAGCGGGGACAGACGAGAGAATTCACCCTATTTTTTAGCCCTACCGTTGGTAAACCTTAA

Protein

MMGSYHLLGISEFSSRLPLALGSALAVPLLYLLGKEIFSSPRAALWSSSILLTLLPTARLGRLTMLDGVINACLLWSLLCLLRGRKNPHWLGGIGIGLGLIALAKGLLVLALALLLGIVIFWLGEGRIFQRWQFWLGLLIGFAPVLWWYQLQFAEYGETFWQIHFEFHSFERVTQELEGNTGPPWYYLLEIVKYTAPWLFFLIPAAVMTVQQWRQDWAKVAITFGFGFLLIISAMGTKLPWYVLPCYPFFALMGGYYLADLEGRPRYPRLIGYLLALTAVVGLVGGLYAGFIEQKPVIIIMGLVLFVGVGWSAKQYLHSSPKFAKTLVMGLYVTLLFLFSSPLWNWEVNEAFAVKPVGRLIKQSTPVNTLIYTSFAYSRPSLDFYGDRQVIAVDDDQLRTKAKEGNYLLLDQNAQGRLALANLQKRGQTREFTLFFSPTVGKP