Your browser is old and dusty. Try Google Chrome!

Details for sll2002

ORF sll2002
Accession NP_441046.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -106 -120 21.7307 0.00612
NP_441061.1_2 Reverse -162 -176 -0.983719 0.246
NP_440557.1_1 Reverse -58 -77 12.9791 0.0759
NP_440795.1_7 Forward -113 -106 11.3472 0.0978
NP_441418.1_6 Reverse -105 -124 -29.5982 0.23
NP_441480.1_1 Reverse -307 -326 17.0107 0.0775
NP_442291.1_5 Reverse -104 -120 4.58176 0.0889
NP_442291.1_5 Forward -115 -99 3.00846 0.116
NP_441453.1_4 Reverse -105 -113 13.5891 0.0246
NP_441453.1_4 Forward -114 -106 7.19758 0.0757
NP_441453.1_7 Forward -387 -380 12.9205 0.23
NP_441453.1_7 Forward -261 -254 12.9205 0.23
NP_441453.1_7 Reverse -130 -137 12.9205 0.23
NP_441453.1_7 Reverse -65 -72 12.9205 0.23
NP_442877.1_3 Reverse -94 -113 11.7 0.227
NP_442151.1_6 Reverse -105 -119 7.86607 0.188
NP_441818.1_1 Reverse -106 -117 16.4794 0.0156
NP_441818.1_1 Forward -113 -102 8.80962 0.277
NP_441818.1_9 Forward -211 -192 -6.1954 0.26
NP_441818.1_9 Reverse -316 -335 -9.93197 0.291
NP_441818.1_9 Reverse -342 -361 -11.0136 0.3
NP_440226.1_1 Forward -114 -95 11.5042 0.0529
NP_441465.1_8 Forward -125 -107 10.6389 0.193
NP_440348.1_6 Forward -241 -222 9.53756 0.158
NP_440150.1_2 Reverse -368 -387 5.70185 0.267
NP_442655.1_10 Forward -384 -365 -13.9635 0.266
NP_442173.1_1 Forward -113 -105 6.01761 0.2
NP_442173.1_1 Reverse -106 -114 5.62429 0.206
NP_442752.1_4 Forward -114 -107 10.8555 0.0846
NP_443027.1_4 Forward -116 -106 10.3048 0.134
NP_443027.1_4 Reverse -345 -355 7.45319 0.24
NP_443027.1_4 Reverse -103 -113 7.35486 0.24
NP_441812.1_3 Forward -33 -19 10.816 0.216
NP_442975.1_10 Forward -118 -104 3.73557 0.252
NP_440784.1_7 Reverse -106 -113 12.4288 0.0475
NP_440784.1_7 Forward -113 -106 6.23397 0.241
NP_440061.1_3 Forward -105 -86 11.3075 0.235
NP_440061.1_9 Forward -116 -102 10.5204 0.124
NP_440110.1_8 Forward -377 -358 -3.24547 0.29
NP_441054.1_4 Forward -232 -214 5.72234 0.127
NP_441476.1_5 Forward -386 -367 -6.29373 0.273
NP_441476.1_5 Reverse -342 -361 -7.27704 0.285
NP_440878.1_4 Forward -42 -24 11.3272 0.288
NP_442062.1_8 Reverse -105 -115 14.0414 0.0168
NP_442062.1_8 Forward -114 -104 8.1415 0.0801
NP_440304.1_4 Forward -116 -106 9.22315 0.06
NP_440304.1_4 Forward -68 -58 5.09324 0.229
NP_440044.1_8 Reverse -106 -125 -0.295539 0.217
NP_440044.1_8 Forward -113 -94 -1.7705 0.251
NP_440044.1_8 Reverse -180 -199 -3.83545 0.292
NP_442762.1_10 Forward -96 -77 -17.1101 0.293
NP_442207.1_4 Forward -221 -202 7.66927 0.285
NP_440916.1_1 Reverse -239 -253 9.63603 0.235
NP_441200.1_4 Reverse -89 -108 6.98095 0.272
NP_441208.1_9 Reverse -272 -286 5.21113 0.275
NP_441594.1_6 Forward -123 -104 4.22769 0.222
NP_442196.1_10 Forward -320 -301 9.53756 0.296
NP_440370.1_8 Forward -271 -252 18.3873 0.264
NP_440370.1_10 Reverse -152 -171 12.7825 0.137
NP_442110.1_7 Reverse -105 -119 0.196253 0.266
NP_441082.1_10 Forward -261 -248 17.1289 0.137
NP_440769.1_8 Forward -243 -224 13.7658 0.15
NP_441083.1_5 Forward -114 -104 10.5998 0.0192
NP_441083.1_5 Reverse -105 -115 10.5014 0.0197
NP_441434.1_7 Forward -112 -98 4.03116 0.225
NP_441738.1_2 Forward -391 -384 6.72528 0.236
NP_441558.1_5 Forward -116 -97 16.4207 0.0303
NP_441558.1_5 Reverse -159 -178 6.58763 0.21
NP_441558.1_5 Forward -172 -153 6.09597 0.229
NP_441558.1_5 Reverse -177 -196 5.70265 0.242
NP_440209.1_1 Forward -114 -106 8.37755 0.0576
NP_440209.1_1 Reverse -105 -113 8.27922 0.0687
NP_442889.1_8 Reverse -102 -116 12.782 0.0599
NP_441770.1_4 Forward -187 -168 -11.5053 0.29
NP_441770.1_5 Reverse -91 -110 2.26107 0.238
NP_440178.1_2 Forward -94 -81 16.0472 0.24
NP_440178.1_7 Forward -115 -96 -13.4719 0.136
NP_442570.1_3 Reverse -103 -122 -3.93378 0.225
NP_442570.1_3 Reverse -312 -331 -5.80207 0.25
NP_442461.1_4 Reverse -101 -120 7.86593 0.256
NP_442445.1_2 Reverse -338 -357 13.2741 0.288
NP_441792.1_5 Forward -336 -320 12.0549 0.19
NP_441716.1_1 Reverse -105 -119 9.83269 0.105
NP_441716.1_1 Reverse -111 -125 6.3911 0.198
NP_441163.1_1 Reverse -116 -133 8.29791 0.232
NP_440906.1_5 Forward -113 -106 6.23397 0.234
NP_440906.1_5 Reverse -106 -113 6.0373 0.262
NP_440747.1_10 Reverse -102 -114 7.02048 0.0108
NP_440747.1_10 Forward -117 -105 -2.22263 0.026
NP_441130.1_10 Forward -116 -102 13.7659 0.0599
NP_441486.1_1 Reverse -102 -116 10.0294 0.0231
NP_441486.1_1 Forward -117 -103 4.52282 0.0432
NP_441486.1_1 Reverse -210 -224 -3.54032 0.179
NP_440403.1_10 Forward -123 -104 9.63589 0.186
NP_440842.1_5 Forward -335 -316 17.8245 0.269
NP_441014.1_8 Reverse -189 -208 -9.63698 0.299
NP_441014.1_10 Reverse -104 -123 5.30853 0.188
NP_441014.1_10 Forward -115 -96 3.34192 0.215
NP_442848.1_1 Forward -120 -106 6.29277 0.0791
NP_442848.1_1 Reverse -99 -113 -3.34366 0.265
NP_441012.1_4 Reverse -107 -120 5.91914 0.286
NP_443018.1_3 Forward -113 -106 13.8055 0.024
NP_443018.1_3 Reverse -106 -113 13.6088 0.0352
NP_443018.1_3 Forward -187 -180 10.2655 0.107
NP_443018.1_3 Forward -169 -162 4.07068 0.299
NP_441634.1_8 Reverse -103 -117 3.73617 0.143
NP_441634.1_8 Forward -116 -102 2.65453 0.166
NP_441634.1_8 Forward -224 -210 -0.590395 0.262
NP_440376.1_1 Forward -114 -105 16.2243 0.00412
NP_440376.1_1 Reverse -105 -114 9.63616 0.0385
NP_440376.1_1 Reverse -342 -351 0.884706 0.259
NP_440376.1_1 Forward -131 -122 0.589713 0.267
NP_441588.1_4 Reverse -181 -191 8.04317 0.161
NP_441588.1_4 Forward -112 -102 7.74818 0.17
NP_442687.1_7 Reverse -104 -114 7.35486 0.134
NP_442687.1_7 Reverse -37 -47 6.8632 0.151
NP_442485.1_3 Reverse -119 -138 -0.4922 0.253
NP_442485.1_3 Forward -125 -106 -3.83545 0.277
NP_441846.1_10 Forward -216 -197 -22.3217 0.259
NP_440642.1_10 Reverse -62 -76 3.34225 0.275
NP_441422.1_7 Reverse -358 -375 -9.00761 0.289
NP_441950.1_7 Reverse -319 -338 3.44104 0.167
NP_441950.1_7 Reverse -323 -342 -7.76869 0.283
NP_441763.1_5 Reverse -359 -378 -6.1954 0.274
NP_442658.1_1 Forward -172 -162 8.14104 0.199
NP_442658.1_1 Forward -116 -106 5.87944 0.246
NP_440141.1_8 Forward -378 -359 4.62101 0.286
NP_442782.1_2 Forward -381 -367 5.60446 0.239
NP_439959.1_2 Forward -379 -360 21.6323 0.134
NP_442937.1_5 Reverse -100 -119 15.4374 0.0581
NP_441958.1_5 Forward -115 -105 2.53664 0.0409
NP_441958.1_5 Reverse -104 -114 2.43831 0.0422
NP_442836.1_5 Forward -120 -101 4.32602 0.212
NP_440203.1_5 Reverse -375 -385 14.3359 0.0886
NP_440203.1_5 Forward -391 -381 13.6475 0.112
NP_440203.1_5 Reverse -108 -118 8.43603 0.299
NP_439905.1_1 Reverse -361 -374 13.4906 0.165
NP_439905.1_1 Reverse -112 -125 6.60746 0.283
NP_439905.1_2 Reverse -367 -381 8.25939 0.27
NP_443001.1_7 Forward -317 -298 2.26107 0.279
NP_440984.1_7 Forward -58 -44 4.71948 0.292
NP_442690.1_1 Forward -245 -226 -11.6036 0.232
NP_442911.1_2 Reverse -186 -205 -6.09707 0.175
NP_442911.1_2 Reverse -151 -170 -10.9153 0.292
NP_442911.1_2 Forward -124 -105 -11.1119 0.299
NP_442064.1_4 Reverse -362 -381 7.57013 0.242
NP_442064.1_4 Forward -124 -105 5.70185 0.267
NP_443055.1_3 Forward -123 -104 12.4595 0.213
NP_443055.1_6 Reverse -97 -115 5.52492 0.179
NP_443055.1_6 Forward -359 -341 1.49337 0.23
NP_443055.1_6 Reverse -171 -189 -1.55487 0.28
NP_440138.1_6 Forward -119 -100 7.17681 0.215
NP_441099.1_5 Reverse -337 -356 -9.93197 0.237
NP_442567.1_1 Reverse -295 -314 16.0274 0.283
NP_441294.1_7 Reverse -101 -115 14.338 0.0446
NP_441646.1_1 Forward -121 -102 -0.0988766 0.259
NP_441646.1_1 Reverse -98 -117 -0.4922 0.266
NP_442438.1_10 Forward -119 -105 3.34284 0.163
NP_442438.1_10 Reverse -342 -356 1.86788 0.188
NP_442431.1_10 Forward -381 -363 2.87075 0.228
NP_441000.1_6 Forward -115 -101 -4.62196 0.248
NP_442771.1_1 Reverse -69 -87 8.57394 0.0379
NP_442771.1_1 Forward -361 -343 -6.66736 0.168
NP_440147.1_4 Reverse -103 -116 6.4108 0.0939
NP_440147.1_4 Forward -116 -103 0.0192843 0.268
NP_441550.1_8 Reverse -103 -113 11.9759 0.0397
NP_441550.1_8 Reverse -36 -46 6.76441 0.192
NP_441550.1_8 Reverse -281 -291 5.19112 0.26
NP_441916.1_7 Forward -114 -104 7.55152 0.0639
NP_440206.1_4 Reverse -368 -387 -1.18128 0.29
NP_441041.1_1 Forward -387 -368 7.7676 0.267
NP_441041.1_4 Forward -381 -362 3.73603 0.0627
NP_441041.1_4 Forward -114 -95 -5.11376 0.148
NP_441041.1_4 Forward -222 -203 -6.88371 0.176
NP_441041.1_4 Forward -211 -192 -11.8003 0.252
NP_441547.1_2 Forward -125 -107 5.32902 0.223
NP_441725.1_5 Reverse -106 -116 8.73149 0.0585
NP_441725.1_5 Reverse -58 -68 0.0783647 0.215
NP_441725.1_5 Reverse -214 -224 -0.904945 0.274
NP_439966.1_7 Reverse -103 -113 11.6809 0.059
NP_439966.1_7 Forward -116 -106 6.0761 0.195
NP_440736.1_5 Forward -378 -359 16.4207 0.235
NP_442941.1_3 Reverse -106 -116 10.1081 0.024
NP_442941.1_3 Forward -113 -103 9.51814 0.0306
NP_440289.1_2 Forward -117 -104 3.75586 0.0741
NP_440289.1_2 Reverse -102 -115 2.77255 0.0883
NP_440289.1_2 Forward -173 -160 0.904263 0.144
NP_440260.1_8 Forward -41 -23 -7.65067 0.298
NP_441514.1_6 Reverse -383 -390 12.8221 0.252
NP_441678.1_9 Forward -267 -248 3.14605 0.218
NP_441678.1_9 Forward -268 -249 0.58944 0.225
NP_442281.1_1 Forward -119 -105 14.6503 0.0168
NP_442281.1_1 Reverse -100 -114 12.8803 0.033
NP_442281.1_1 Reverse -156 -170 6.29216 0.13
NP_442575.1_1 Reverse -185 -204 -1.27885 0.257
NP_442575.1_8 Reverse -373 -392 -1.7705 0.232
NP_440437.1_1 Forward -346 -327 -5.31042 0.28
NP_442012.1_1 Reverse -366 -385 0.196116 0.244
NP_441556.1_6 Reverse -53 -71 13.8196 0.296
NP_441644.1_6 Forward -114 -104 15.7125 0.0048
NP_441644.1_6 Reverse -105 -115 15.6142 0.00525
NP_441644.1_6 Reverse -111 -121 4.69947 0.228
NP_442644.1_6 Forward -346 -327 16.5191 0.123
NP_442215.1_2 Reverse -103 -119 5.27008 0.0796
NP_442215.1_2 Reverse -370 -386 4.18844 0.0866
NP_442215.1_2 Forward -123 -107 -1.3181 0.183
NP_442215.1_2 Reverse -80 -96 -4.95634 0.242
NP_442215.1_2 Forward -353 -337 -5.05468 0.244
NP_442029.1_6 Forward -387 -368 6.68596 0.234
NP_440929.1_8 Forward -114 -105 9.53783 0.0296
NP_440929.1_8 Reverse -105 -114 9.4395 0.0326
NP_440929.1_8 Forward -351 -342 2.06468 0.268
NP_442933.1_10 Forward -114 -105 14.2577 0.0126
NP_442933.1_10 Reverse -105 -114 7.76787 0.11
NP_441751.2_8 Reverse -106 -120 5.60446 0.0419
NP_441751.2_8 Forward -113 -99 -6.98191 0.294
NP_442554.1_8 Forward -113 -103 15.123 0.00944
NP_442554.1_8 Reverse -106 -116 14.828 0.0108
NP_442554.1_8 Forward -169 -159 9.91146 0.053
NP_442554.1_8 Reverse -162 -172 5.09324 0.161
NP_442554.1_8 Reverse -343 -353 2.83163 0.253
NP_441762.1_7 Reverse -160 -172 -6.15587 0.276
NP_441762.1_7 Forward -382 -370 -6.2542 0.284
NP_442142.1_4 Forward -117 -104 12.9 0.0406
NP_442142.1_4 Reverse -102 -115 12.0151 0.0494
NP_442142.1_4 Reverse -369 -382 7.68852 0.132
NP_442142.1_4 Reverse -108 -121 4.64028 0.214
NP_442142.1_4 Reverse -176 -189 4.54195 0.217
NP_442292.1_1 Reverse -106 -115 15.536 0.0107
NP_442292.1_1 Forward -113 -104 8.75118 0.0306
NP_441525.1_1 Forward -124 -111 19.6855 0.0967
NP_443009.1_2 Reverse -163 -182 2.26107 0.216
NP_443009.1_5 Forward -67 -56 7.72798 0.122
NP_443009.1_5 Reverse -104 -115 6.94134 0.144
NP_443009.1_5 Reverse -349 -360 5.46638 0.202
NP_442301.1_2 Forward -341 -322 3.9319 0.284
NP_441715.1_4 Forward -113 -103 7.94484 0.107
NP_441715.1_4 Reverse -106 -116 4.99491 0.24
NP_440620.1_4 Reverse -225 -239 16.1498 0.236
NP_440279.1_2 Reverse -100 -119 10.2259 0.151
NP_440015.1_9 Reverse -71 -89 -0.669169 0.264
NP_441448.1_1 Reverse -361 -380 3.34271 0.297
NP_441448.1_2 Reverse -368 -387 4.32522 0.168
NP_440379.1_5 Reverse -369 -388 -10.7186 0.283
NP_441468.1_1 Forward -113 -106 13.8055 0.0242
NP_441468.1_1 Forward -169 -162 10.9539 0.0726
NP_441468.1_1 Forward -31 -24 6.72562 0.126
NP_441468.1_1 Reverse -106 -113 6.0373 0.223
NP_441020.2_6 Forward -172 -155 7.512 0.229
NP_441673.1_1 Forward -114 -105 11.1111 0.0121
NP_441673.1_1 Reverse -105 -114 11.0128 0.018
NP_441956.1_1 Forward -135 -116 19.1824 0.136
NP_441876.1_9 Reverse -292 -302 10.206 0.299
NP_441172.1_1 Reverse -190 -208 3.26407 0.195
NP_441826.1_2 Forward -120 -106 12.4876 0.0272
NP_441826.1_2 Reverse -105 -119 0.982901 0.167
NP_441826.1_2 Reverse -99 -113 -4.22864 0.293
NP_442490.1_9 Reverse -316 -335 -5.99873 0.273
NP_442868.1_6 Reverse -103 -113 9.61647 0.0429
NP_442868.1_6 Forward -116 -106 0.176696 0.247
NP_442719.1_2 Forward -26 -8 -11.7812 0.296
NP_441612.1_2 Forward -114 -104 8.54929 0.21
NP_442227.1_2 Reverse -169 -188 -1.47551 0.262
NP_442808.1_1 Reverse -104 -114 6.0761 0.131
NP_442808.1_1 Reverse -371 -381 5.68278 0.144
NP_442808.1_1 Reverse -267 -277 5.19112 0.168
NP_440145.1_3 Reverse -95 -114 8.84924 0.0446
NP_442820.1_9 Reverse -289 -307 6.80398 0.259
NP_442718.1_2 Forward -381 -362 1.17943 0.203
NP_442542.1_2 Reverse -36 -49 5.23083 0.276
NP_442113.1_10 Reverse -365 -384 -6.09707 0.255
NP_442113.1_10 Reverse -206 -225 -9.44032 0.295
NP_442050.1_5 Forward -116 -106 6.76441 0.282
NP_441114.1_3 Reverse -374 -383 17.1093 0.113
NP_440558.1_2 Reverse -108 -127 1.17943 0.183
NP_440558.1_2 Reverse -369 -388 -2.75381 0.229
NP_440558.1_2 Reverse -347 -366 -4.13045 0.243
NP_442724.1_1 Reverse -226 -236 16.893 0.259
NP_441878.1_6 Forward -115 -105 11.3864 0.0176
NP_441878.1_6 Reverse -104 -114 9.41981 0.0266
NP_441878.1_6 Reverse -160 -170 -0.41329 0.177
NP_441878.1_6 Forward -223 -213 -7.0998 0.204
NP_441878.1_6 Forward -382 -372 -7.49312 0.231
NP_441878.1_6 Forward -360 -350 -7.49312 0.231
NP_441557.1_5 Forward -114 -105 10.2261 0.0144
NP_441557.1_5 Reverse -105 -114 10.1278 0.0188
NP_441557.1_6 Reverse -129 -148 17.3057 0.0957
NP_441445.1_1 Reverse -96 -115 7.96426 0.124
NP_441445.1_1 Forward -123 -104 5.01433 0.181
NP_441445.1_8 Forward -386 -367 -11.2103 0.277
NP_442267.1_4 Forward -93 -74 1.0811 0.272
NP_441433.1_8 Reverse -373 -392 5.99764 0.174
NP_440101.1_3 Reverse -331 -350 4.71934 0.212
NP_441458.1_10 Forward -123 -104 2.65439 0.269
NP_442830.1_1 Forward -376 -357 12.7825 0.28
NP_442183.1_1 Reverse -105 -119 8.65272 0.112
NP_442183.1_9 Forward -208 -198 11.3864 0.206
NP_441407.1_5 Reverse -230 -249 3.93269 0.26
NP_441819.1_5 Forward -245 -226 14.2756 0.195
NP_441574.1_1 Reverse -93 -112 -7.76869 0.293
NP_441574.1_1 Forward -200 -181 -7.86702 0.297
NP_442170.1_5 Forward -249 -230 -2.26216 0.255
NP_442347.1_2 Forward -355 -346 7.07956 0.134
NP_442645.1_2 Reverse -97 -116 -4.03212 0.0531
NP_441037.1_4 Forward -172 -162 10.7287 0.187
NP_441633.1_3 Reverse -103 -116 -5.78224 0.236
NP_440136.1_2 Forward -113 -106 6.52896 0.116
NP_440136.1_2 Reverse -106 -113 6.13563 0.193
NP_442998.1_5 Forward -300 -290 8.4365 0.263
NP_442998.1_10 Forward -112 -105 6.23397 0.157
NP_442998.1_10 Reverse -107 -114 6.13563 0.181
NP_440299.1_1 Forward -118 -105 4.54195 0.207
NP_440299.1_1 Reverse -157 -170 3.36198 0.247
NP_440299.1_6 Reverse -150 -169 12.4875 0.201
NP_441799.1_1 Reverse -101 -115 11.5037 0.0575
NP_440640.1_6 Forward -234 -215 7.37428 0.174
NP_441007.1_5 Forward -187 -168 9.43923 0.228
NP_441007.1_10 Forward -119 -106 -0.570702 0.287
NP_441435.1_6 Reverse -106 -125 4.71934 0.252
NP_440256.1_1 Reverse -102 -121 4.52268 0.0435
NP_440256.1_1 Forward -117 -98 -4.22878 0.15
NP_440256.1_1 Reverse -312 -331 -6.58872 0.215
NP_440256.1_1 Forward -385 -366 -7.4737 0.238
NP_441559.1_8 Reverse -368 -382 -5.01529 0.245
NP_441559.1_8 Reverse -253 -267 -5.80194 0.27
NP_440915.1_6 Forward -118 -104 3.8345 0.1
NP_440915.1_6 Forward -135 -121 -3.54032 0.298
NP_442158.1_4 Reverse -61 -71 11.4848 0.271
NP_442069.1_7 Reverse -367 -386 9.7334 0.291
NP_442866.1_1 Reverse -367 -386 -3.73712 0.221
NP_440657.1_3 Reverse -79 -96 1.61214 0.269
NP_441464.1_10 Reverse -318 -332 13.6676 0.199
NP_440306.1_8 Reverse -283 -302 5.80018 0.204
NP_441494.1_6 Reverse -345 -358 7.19745 0.267
NP_442993.1_1 Reverse -161 -177 -10.2662 0.214
NP_442993.1_1 Forward -114 -98 -10.9545 0.231
NP_442386.1_9 Reverse -104 -113 12.389 0.0646
NP_442386.1_9 Forward -115 -106 11.799 0.0835
NP_440570.1_5 Reverse -249 -268 -1.96717 0.277
NP_441750.1_1 Forward -387 -368 -9.14533 0.3
NP_441340.1_5 Reverse -106 -113 13.5105 0.0314
NP_441340.1_5 Forward -113 -106 6.23397 0.132
NP_442484.1_2 Forward -102 -83 2.26107 0.226
NP_440327.1_6 Reverse -316 -335 4.81767 0.266
NP_440161.1_3 Forward -68 -49 11.3075 0.217
NP_440161.1_3 Reverse -370 -389 7.86593 0.285
NP_442714.1_7 Reverse -112 -131 5.50599 0.174
NP_440586.1_1 Forward -88 -69 -6.09707 0.296
NP_440586.1_8 Reverse -106 -113 11.3468 0.0736
NP_440586.1_8 Forward -113 -106 9.47853 0.146
NP_440586.1_8 Forward -187 -180 9.08521 0.178
NP_440192.1_4 Reverse -367 -386 10.1738 0.248
NP_440684.1_9 Forward -120 -106 8.35772 0.233
NP_441262.1_3 Forward -114 -107 5.25066 0.215
NP_440027.1_8 Reverse -102 -121 9.63507 0.243
NP_443051.1_1 Forward -115 -106 0.688044 0.134
NP_443051.1_1 Reverse -104 -113 0.589713 0.143
NP_443051.1_9 Forward -271 -257 13.9626 0.265
NP_439937.1_9 Reverse -349 -366 -0.551837 0.122
NP_439937.1_9 Reverse -110 -127 -10.3849 0.227
NP_439937.1_9 Reverse -371 -388 -14.8098 0.287
NP_441595.1_2 Reverse -228 -241 9.32449 0.277
NP_440836.1_3 Reverse -313 -332 13.2741 0.242
NP_440408.1_7 Reverse -372 -391 9.53756 0.256
NP_439943.1_1 Reverse -277 -296 -9.34199 0.28
NP_440372.1_2 Forward -113 -106 6.62729 0.151
NP_440372.1_2 Reverse -106 -113 6.52896 0.188
NP_440171.1_3 Forward -385 -366 2.75272 0.285
NP_440316.1_10 Forward -382 -372 8.04317 0.24
NP_440316.1_10 Forward -278 -268 5.48657 0.295
NP_441803.1_2 Reverse -361 -380 -0.983855 0.293
NP_439977.1_5 Reverse -99 -118 8.16093 0.107
NP_439977.1_5 Reverse -366 -385 -0.000545616 0.217
NP_439977.1_5 Reverse -17 -36 -0.4922 0.227
NP_439977.1_7 Reverse -94 -113 11.7983 0.262
NP_440139.1_1 Reverse -99 -118 2.06362 0.24
NP_440267.1_2 Forward -323 -309 5.70218 0.259
NP_442887.1_5 Reverse -365 -384 0.786102 0.264
NP_442384.1_10 Forward -114 -101 3.75586 0.179
NP_442384.1_10 Forward -80 -67 1.49425 0.257
NP_442384.1_10 Reverse -105 -118 0.215946 0.297
NP_442035.1_7 Forward -395 -376 15.8856 0.276
NP_442035.1_8 Reverse -369 -383 11.7993 0.269
NP_441018.1_7 Reverse -317 -336 6.98095 0.278
NP_442790.1_4 Forward -123 -104 -10.817 0.218
NP_442262.1_10 Forward -113 -106 13.0188 0.0314
NP_442262.1_10 Reverse -106 -113 11.6422 0.092
NP_442262.1_10 Forward -169 -162 9.47889 0.187
NP_442262.1_10 Forward -187 -180 9.18389 0.211
NP_441689.1_5 Forward -116 -106 5.58445 0.23
NP_442244.1_6 Reverse -366 -385 18.3873 0.117
NP_440163.1_10 Forward -117 -107 13.353 0.13
NP_440344.1_10 Forward -121 -104 1.8088 0.0294
NP_440075.1_2 Forward -385 -366 4.916 0.288
NP_440531.1_6 Forward -122 -103 -1.27885 0.231
NP_441335.1_8 Forward -41 -22 11.9958 0.204
NP_440297.1_9 Reverse -106 -116 9.61647 0.0917
NP_440297.1_9 Reverse -214 -224 0.0783647 0.282
NP_440297.1_9 Forward -169 -159 -0.216628 0.282
NP_440297.1_9 Forward -113 -103 -0.41329 0.283
NP_442280.1_10 Reverse -369 -387 16.9477 0.0964
NP_441679.1_6 Forward -119 -100 6.29264 0.103
NP_440937.1_5 Reverse -366 -385 15.7324 0.249
NP_440999.1_9 Reverse -101 -115 -0.688726 0.214
NP_440999.1_9 Reverse -209 -223 -1.27871 0.232
NP_440999.1_9 Reverse -368 -382 -1.37704 0.236
NP_440888.1_2 Reverse -105 -119 17.6002 0.00354
NP_440888.1_2 Forward -114 -100 6.19383 0.243
NP_439969.1_3 Forward -175 -156 0.196116 0.268
NP_440237.1_5 Forward -239 -225 14.7486 0.17
NP_441543.1_2 Reverse -106 -115 14.651 0.0119
NP_441543.1_2 Forward -113 -104 7.37455 0.127
NP_441543.1_2 Reverse -162 -171 6.5879 0.143
NP_442845.1_2 Forward -120 -106 13.9626 0.088
NP_442845.1_2 Reverse -336 -350 6.09611 0.217
NP_442845.1_2 Forward -298 -284 5.21113 0.24
NP_442845.1_2 Reverse -17 -31 3.73617 0.279
NP_440089.1_1 Forward -180 -162 10.9339 0.3
NP_441178.1_6 Reverse -369 -388 3.04693 0.269
NP_441178.1_6 Reverse -203 -222 2.75194 0.27
NP_441918.1_7 Forward -115 -96 -2.75381 0.297
NP_441469.1_8 Forward -171 -162 13.0777 0.0846
NP_441469.1_8 Forward -115 -106 5.3096 0.277
NP_441469.1_8 Reverse -104 -113 5.21127 0.283
NP_442315.1_1 Forward -181 -163 10.4422 0.181
NP_443064.1_6 Forward -47 -37 10.143 0.173
NP_440071.1_1 Reverse -371 -388 9.77286 0.259
NP_441462.1_2 Forward -114 -104 1.84832 0.081
NP_441462.1_2 Reverse -105 -115 1.74999 0.0811
NP_441621.1_7 Reverse -159 -173 3.53951 0.108
NP_443062.1_1 Reverse -105 -123 13.4213 0.0627
NP_443062.1_1 Forward -114 -96 9.32598 0.136
NP_443062.1_6 Forward -122 -103 2.26107 0.258
NP_443062.1_6 Forward -74 -55 1.0811 0.28
NP_441601.1_4 Reverse -368 -387 -4.81876 0.293
NP_440519.1_8 Forward -375 -359 7.13836 0.206
NP_442204.1_1 Forward -118 -107 1.33697 0.274
NP_442204.1_1 Forward -385 -374 0.0586712 0.284
NP_442204.1_5 Forward -124 -105 2.26107 0.214
NP_441560.1_8 Reverse -345 -364 15.4082 0.111
NP_440504.1_5 Reverse -85 -103 7.78729 0.237
NP_440516.1_8 Forward -114 -105 7.17789 0.0754
NP_440516.1_8 Reverse -105 -114 7.07956 0.0867
NP_441785.1_1 Reverse -105 -119 17.974 0.06
NP_442428.1_5 Forward -113 -106 14.1988 0.0242
NP_442428.1_5 Reverse -106 -113 6.0373 0.212
NP_442428.1_5 Forward -169 -162 4.66067 0.244
NP_441443.1_7 Forward -384 -365 -0.688862 0.245
NP_442859.1_2 Forward -113 -94 6.68596 0.199
NP_442859.1_2 Forward -119 -100 2.0644 0.28
NP_442120.1_10 Forward -114 -95 -16.3235 0.3
NP_440673.1_3 Reverse -107 -114 11.6422 0.0724
NP_440673.1_3 Reverse -285 -292 10.9539 0.106
NP_440673.1_3 Reverse -374 -381 8.98723 0.203
NP_440673.1_3 Reverse -352 -359 6.72562 0.277
NP_441052.1_2 Reverse -105 -115 16.893 0.00732
NP_441052.1_2 Forward -114 -104 16.7946 0.00777
NP_442219.1_9 Forward -113 -104 8.06287 0.0696
NP_442219.1_9 Reverse -106 -115 7.96454 0.0696
NP_440436.1_4 Reverse -106 -115 14.2573 0.0147
NP_440436.1_4 Reverse -112 -121 7.76745 0.124
NP_440436.1_4 Forward -113 -104 7.66912 0.124
NP_440436.1_4 Reverse -373 -382 6.48915 0.157
NP_440436.1_4 Reverse -162 -171 5.60418 0.188
NP_442864.1_2 Reverse -355 -374 10.1275 0.278
NP_440314.1_9 Reverse -141 -160 -5.01543 0.216
NP_442414.1_8 Reverse -355 -374 7.7676 0.292
NP_442907.1_9 Reverse -106 -125 -7.08038 0.293
NP_441719.1_4 Forward -113 -106 6.62729 0.151
NP_441719.1_4 Reverse -106 -113 6.52896 0.188
NP_441733.1_10 Reverse -158 -171 5.62415 0.21
NP_441004.1_1 Forward -387 -368 9.53756 0.0574
NP_441004.1_1 Reverse -322 -341 -10.522 0.221
NP_441004.1_1 Reverse -316 -335 -13.6686 0.26
NP_441004.1_1 Reverse -330 -349 -17.9951 0.296
NP_441004.1_2 Reverse -298 -317 -0.885524 0.259
NP_441004.1_4 Reverse -325 -335 10.5998 0.254
NP_441004.1_5 Forward -385 -371 8.94771 0.266
NP_442813.1_4 Forward -139 -120 -7.76869 0.299
NP_442366.1_3 Reverse -104 -122 4.44404 0.0975
NP_442366.1_3 Forward -122 -104 0.412472 0.172
NP_442366.1_3 Reverse -371 -389 -4.99573 0.28
NP_441115.1_4 Reverse -56 -74 7.58986 0.279
NP_442694.1_4 Forward -132 -123 16.126 0.164
NP_442694.1_4 Reverse -314 -323 12.5861 0.249
NP_442854.1_6 Reverse -105 -124 2.94938 0.272
NP_443054.1_2 Reverse -120 -134 13.9626 0.0722
NP_443054.1_2 Forward -116 -102 3.14618 0.24
NP_443054.1_2 Forward -224 -210 0.88457 0.252
NP_441851.1_10 Forward -115 -105 14.3364 0.0179
NP_441851.1_10 Reverse -104 -114 5.97822 0.19
NP_441851.1_10 Forward -171 -161 5.09324 0.227
NP_442208.1_5 Forward -374 -355 -6.29373 0.266
NP_442001.1_4 Reverse -41 -60 7.57013 0.29
NP_441501.1_6 Reverse -341 -360 15.7324 0.27
NP_441501.1_9 Reverse -260 -279 15.2399 0.236
NP_441668.1_4 Forward -124 -105 -2.75381 0.294
NP_442515.1_1 Forward -360 -346 3.04785 0.125
NP_442515.1_1 Forward -115 -101 0.786239 0.18
NP_441396.1_5 Reverse -320 -329 8.25953 0.224
NP_440593.1_3 Reverse -352 -371 -1.86883 0.218
NP_440165.1_5 Reverse -104 -123 -6.1954 0.231
NP_441046.1_2 Reverse -94 -113 7.17762 0.221
NP_442689.1_8 Forward -241 -224 -8.31929 0.294
NP_441349.1_10 Forward -124 -105 10.6192 0.0232
NP_441349.1_10 Forward -130 -111 -9.53865 0.294
NP_441409.1_6 Forward -120 -101 -10.3253 0.203
NP_440432.1_9 Forward -46 -31 -3.26502 0.179
NP_440432.1_9 Forward -113 -98 -5.32998 0.245
NP_442843.1_1 Forward -187 -168 -3.24547 0.222
NP_442843.1_1 Forward -387 -368 -7.17871 0.245
NP_439960.1_8 Forward -222 -203 9.43923 0.287
NP_440588.1_2 Forward -89 -70 -5.70374 0.259
NP_440943.1_5 Reverse -306 -320 19.7641 0.147
NP_441003.1_9 Forward -123 -104 3.34271 0.294
NP_441003.1_9 Reverse -369 -388 3.14605 0.298
NP_442038.1_1 Forward -241 -222 11.2092 0.118
NP_441570.1_1 Reverse -105 -123 -0.669169 0.0498
NP_441570.1_1 Forward -114 -96 -11.7806 0.203
NP_441570.1_1 Forward -375 -357 -12.2722 0.211
NP_441078.1_4 Forward -114 -105 17.4043 0.00223
NP_441078.1_4 Reverse -105 -114 10.3245 0.0119
NP_441078.1_4 Forward -170 -161 -2.06522 0.295
NP_442729.1_5 Forward -382 -372 9.7148 0.235
NP_441539.1_4 Reverse -164 -182 27.9451 0.00284
NP_440707.1_9 Forward -377 -358 0.0977854 0.293
NP_440526.1_3 Reverse -106 -117 10.1862 0.0646
NP_440526.1_3 Forward -355 -344 3.10645 0.267
NP_440526.1_3 Reverse -162 -173 2.71313 0.267
NP_440526.1_3 Forward -113 -102 0.54986 0.275
NP_441432.1_8 Forward -115 -106 14.0611 0.0258
NP_441432.1_8 Reverse -104 -113 8.94785 0.0755
NP_441432.1_8 Reverse -341 -350 8.55452 0.0755
NP_441432.1_8 Forward -27 -18 6.98123 0.112
NP_441432.1_8 Forward -121 -112 5.3096 0.17
NP_442320.1_8 Forward -120 -106 2.2612 0.0779
NP_442320.1_8 Reverse -99 -113 -3.83532 0.134
NP_441732.1_2 Reverse -255 -271 -8.20127 0.124
NP_441732.1_2 Forward -118 -102 -15.5761 0.151
NP_442343.1_8 Forward -305 -289 18.1507 0.293
NP_440760.1_1 Forward -114 -95 -12.7836 0.0947
NP_442797.1_1 Forward -335 -316 -5.60541 0.288
NP_440199.1_10 Forward -117 -107 14.0414 0.0895
NP_440199.1_10 Reverse -102 -112 8.82982 0.229
NP_441945.1_10 Forward -388 -369 10.7175 0.247
NP_441057.1_4 Forward -183 -165 1.29745 0.253
NP_442353.1_4 Reverse -112 -131 6.09517 0.18
NP_442353.1_6 Forward -377 -358 10.8159 0.298
NP_440913.1_1 Forward -116 -98 6.70565 0.221
NP_440913.1_1 Reverse -55 -73 3.95239 0.285
NP_441072.1_2 Forward -303 -284 8.06259 0.24
NP_442400.1_10 Reverse -226 -239 18.0143 0.112
NP_440713.1_4 Forward -386 -367 3.73603 0.239
NP_442489.1_7 Forward -114 -105 17.896 0.00138
NP_442489.1_7 Reverse -105 -114 10.3245 0.0193
NP_442489.1_7 Forward -170 -161 -1.57357 0.213
NP_440386.1_3 Forward -181 -162 -5.31042 0.252
NP_440559.1_1 Reverse -106 -115 7.76787 0.0918
NP_440559.1_1 Forward -113 -104 7.66954 0.0999
NP_441659.2_8 Reverse -105 -115 16.1063 0.00375
NP_441659.2_8 Forward -114 -104 8.4365 0.043
NP_442913.1_10 Reverse -96 -115 -4.13045 0.227
NP_439956.1_8 Forward -211 -192 9.0459 0.289
NP_440708.1_6 Forward -101 -82 -11.1119 0.296
NP_441800.1_3 Forward -261 -243 8.18062 0.286
NP_441800.1_7 Reverse -364 -382 7.29564 0.121
NP_441800.1_7 Forward -339 -321 -0.472507 0.228
NP_442776.1_1 Reverse -247 -266 4.03102 0.278
NP_442346.1_5 Forward -115 -105 15.9097 0.00378
NP_442346.1_5 Reverse -104 -114 15.5163 0.00546
NP_442346.1_5 Forward -360 -350 9.7148 0.118
NP_442346.1_5 Reverse -70 -80 5.09324 0.262
NP_442346.1_5 Forward -382 -372 4.60159 0.281
NP_440352.1_5 Forward -78 -59 11.1957 0.267
NP_440545.1_3 Reverse -157 -174 0.137172 0.144
NP_440545.1_3 Forward -385 -368 -6.84433 0.289
NP_440545.1_5 Reverse -322 -339 3.57876 0.289
NP_441629.1_3 Reverse -359 -378 -2.65624 0.272
NP_440743.1_8 Forward -113 -94 17.7965 0.215
NP_440459.1_2 Forward -96 -79 7.61033 0.285
NP_441653.1_2 Reverse -94 -113 12.8065 0.0959
NP_440010.1_4 Forward -124 -105 0.883656 0.243
NP_442027.1_5 Forward -269 -250 9.93088 0.289
NP_442603.1_7 Reverse -105 -119 6.68548 0.232
NP_441050.1_5 Forward -363 -345 -2.83245 0.284
NP_439970.1_3 Reverse -112 -131 11.9958 0.104
NP_441047.1_2 Forward -282 -263 2.75272 0.239
NP_440170.1_5 Forward -124 -105 14.1591 0.0882
NP_441833.1_4 Forward -113 -106 6.23397 0.163
NP_441833.1_4 Reverse -106 -113 6.13563 0.198
NP_442799.1_2 Reverse -245 -264 -0.0988766 0.276
NP_441329.1_3 Reverse -229 -239 14.8103 0.25
NP_441329.1_6 Reverse -222 -241 -3.10391 0.296
NP_441895.1_2 Forward -387 -368 -26.5499 0.24
NP_442162.1_9 Forward -113 -106 6.62729 0.142
NP_442162.1_9 Reverse -106 -113 6.43063 0.208
NP_440671.1_4 Forward -120 -106 17.9942 0.0156
NP_440671.1_4 Forward -381 -367 9.34103 0.184
NP_442140.1_3 Forward -113 -103 9.32148 0.109
NP_442140.1_3 Forward -380 -370 7.15819 0.149
NP_442140.1_3 Forward -169 -159 5.09324 0.227
NP_442140.1_3 Reverse -162 -172 3.81494 0.278
NP_440875.1_9 Forward -112 -102 7.496 0.262
NP_441813.1_5 Reverse -103 -113 8.33817 0.047
NP_441813.1_5 Forward -116 -106 6.17489 0.1
NP_440590.1_4 Forward -113 -100 1.49425 0.122
NP_440590.1_4 Reverse -106 -119 -4.50394 0.262
NP_440590.1_4 Reverse -162 -175 -5.68391 0.286
NP_440567.1_1 Reverse -106 -120 0.196253 0.254
NP_442497.1_10 Forward -113 -104 0.688044 0.141
NP_442497.1_10 Reverse -106 -115 0.589713 0.153
NP_440821.1_4 Forward -116 -106 8.53483 0.0468
NP_440821.1_4 Reverse -103 -113 -0.41329 0.257
NP_440821.1_4 Forward -172 -162 -0.511621 0.269
NP_440821.1_4 Reverse -159 -169 -0.708283 0.287
NP_441239.1_9 Forward -172 -160 10.8554 0.0714
NP_441239.1_9 Reverse -159 -171 7.80712 0.148
NP_441239.1_9 Reverse -103 -115 5.84051 0.206
NP_441239.1_9 Forward -353 -341 4.75886 0.243
NP_441239.1_9 Forward -116 -104 3.87389 0.272
NP_441239.1_9 Reverse -80 -92 3.77555 0.276
NP_441239.1_9 Reverse -97 -109 3.08724 0.296
NP_440400.1_1 Reverse -363 -382 4.32522 0.22
NP_440400.1_1 Reverse -187 -206 0.392004 0.277
NP_441892.1_1 Forward -123 -106 7.217 0.0915
NP_442270.1_9 Forward -386 -367 -11.1119 0.266
NP_441017.1_6 Forward -118 -104 17.6985 0.046
NP_441541.1_1 Reverse -6 -24 -4.8681 0.285
NP_441541.1_1 Reverse -5 -23 -5.15458 0.293
NP_440833.1_6 Reverse -223 -237 8.65209 0.272
NP_440833.1_6 Reverse -370 -384 7.47213 0.278
NP_441526.1_6 Reverse -339 -358 4.12936 0.271
NP_442138.1_10 Reverse -105 -124 -3.14714 0.228
NP_442138.1_10 Forward -114 -95 -6.39206 0.284
NP_442052.1_6 Reverse -109 -127 15.5546 0.289
NP_440546.1_4 Forward -114 -104 9.46426 0.136
NP_440546.1_4 Reverse -105 -115 8.39772 0.192
NP_440546.1_6 Forward -376 -357 7.07928 0.278
NP_441230.1_5 Reverse -100 -119 -0.885524 0.292
NP_441672.1_10 Forward -213 -194 17.994 0.163
NP_442402.1_4 Reverse -109 -128 -6.88445 0.267
NP_441848.1_4 Forward -27 -11 8.50558 0.288
NP_442923.1_4 Forward -387 -368 -6.49039 0.297
NP_442039.1_4 Forward -113 -106 6.3323 0.289
NP_441811.1_1 Forward -360 -341 6.58763 0.28
NP_441811.1_8 Forward -362 -348 8.84938 0.228
NP_441811.1_8 Reverse -344 -358 5.89945 0.289
NP_441926.1_3 Forward -114 -98 3.89344 0.206
NP_442837.1_3 Forward -113 -106 6.0373 0.25
NP_442837.1_3 Reverse -106 -113 5.93897 0.265
NP_440160.1_9 Forward -284 -265 9.3409 0.241
NP_442053.1_1 Forward -114 -105 8.65285 0.0741
NP_442053.1_1 Reverse -105 -114 8.55452 0.0784
NP_440505.1_3 Reverse -103 -113 9.02648 0.128
NP_440505.1_3 Forward -116 -106 7.25653 0.16
NP_442360.1_5 Forward -387 -377 12.6647 0.298
NP_440914.1_1 Forward -114 -104 16.4224 0.0016
NP_440914.1_1 Forward -120 -110 11.6404 0.0843
NP_440914.1_1 Reverse -105 -115 8.12715 0.207
NP_440914.1_1 Forward -292 -282 6.85846 0.263
NP_441011.1_8 Forward -276 -267 5.50626 0.256
NP_442101.1_10 Reverse -63 -82 -7.17871 0.209
NP_442533.1_1 Reverse -316 -335 -15.7335 0.257
NP_442533.1_6 Reverse -105 -114 17.5026 0.00137
NP_442533.1_6 Forward -114 -105 16.2243 0.00404
NP_442533.1_6 Forward -91 -82 1.86802 0.284
NP_442533.1_6 Reverse -247 -256 1.37636 0.3
NP_441089.1_5 Forward -270 -251 17.404 0.251
NP_442541.1_10 Reverse -17 -31 5.60385 0.248
NP_442541.1_10 Forward -114 -100 2.8506 0.254
NP_442232.1_1 Reverse -241 -260 6.09597 0.286
NP_442322.1_4 Reverse -357 -374 -7.5333 0.284
NP_441482.1_7 Reverse -99 -113 -10.6202 0.211
NP_441482.1_7 Forward -120 -106 -10.8168 0.216
NP_439944.1_9 Reverse -106 -116 9.41981 0.1
NP_439944.1_9 Forward -113 -103 8.04317 0.121
NP_442202.1_4 Reverse -367 -381 13.8049 0.251
NP_442202.1_10 Reverse -160 -174 4.03116 0.278
NP_441527.1_4 Forward -298 -279 -9.02441 0.254
NP_440007.1_9 Reverse -338 -352 12.9793 0.163
NP_440007.1_9 Forward -118 -104 11.6026 0.163
NP_440007.1_9 Forward -379 -365 0.982901 0.29
NP_441972.1_5 Forward -113 -94 -8.16202 0.258
NP_441972.1_5 Forward -125 -106 -8.35868 0.263
NP_441106.1_1 Forward -115 -106 6.48957 0.0895
NP_441106.1_1 Forward -171 -162 5.3096 0.162
NP_440429.1_2 Reverse -180 -199 11.0125 0.258
NP_441216.1_4 Reverse -368 -387 13.6675 0.196
NP_439903.1_6 Reverse -102 -121 5.11187 0.186
NP_439903.1_6 Reverse -237 -256 -0.689632 0.284
NP_442588.1_6 Forward -141 -122 12.8808 0.127
NP_441286.1_1 Reverse -104 -116 11.5437 0.0125
NP_441286.1_1 Forward -115 -103 3.18557 0.0485
NP_442674.1_3 Forward -122 -103 9.43841 0.174
NP_440670.1_8 Forward -114 -105 8.84951 0.0606
NP_440670.1_8 Reverse -105 -114 8.55452 0.066
NP_440886.1_7 Reverse -104 -114 7.64939 0.0865
NP_440828.1_4 Reverse -160 -179 -4.1312 0.246
NP_442614.1_2 Reverse -88 -102 8.75105 0.248
NP_442717.1_2 Forward -240 -221 -5.9004 0.282
NP_442072.1_9 Forward -115 -97 -21.9087 0.215
NP_442072.1_9 Reverse -160 -178 -22.597 0.246
NP_442213.1_5 Forward -98 -79 12.7825 0.118
NP_441403.1_4 Forward -238 -220 5.62401 0.293
NP_442022.1_4 Forward -103 -84 7.17762 0.268
NP_442264.1_2 Reverse -101 -118 12.1336 0.171
NP_442264.1_2 Forward -124 -107 7.31533 0.242
NP_441021.1_1 Forward -113 -94 -6.1954 0.177
NP_441021.1_8 Forward -220 -202 1.98577 0.253
NP_440841.1_4 Forward -116 -97 -6.1954 0.215
NP_441463.1_3 Reverse -359 -378 -4.6221 0.209
NP_441463.1_3 Reverse -362 -381 -5.9004 0.235
NP_442842.1_4 Reverse -58 -77 6.88262 0.223
NP_442893.1_4 Forward -245 -226 1.96529 0.196
NP_441626.1_2 Forward -113 -106 6.52896 0.137
NP_441626.1_2 Reverse -106 -113 5.93897 0.231
NP_442238.1_1 Forward -381 -362 9.0459 0.122
NP_442794.1_1 Forward -118 -106 7.61046 0.136
NP_442794.1_6 Reverse -25 -39 13.7659 0.246
NP_442615.1_1 Reverse -96 -114 -4.01242 0.174
NP_442467.1_4 Forward -351 -332 5.89931 0.287
NP_441962.1_4 Reverse -100 -119 -3.73712 0.151
NP_440387.1_1 Reverse -105 -121 -2.5964 0.148
NP_441431.1_2 Reverse -369 -383 7.86545 0.231
NP_441521.1_7 Forward -222 -203 15.4374 0.261
NP_441836.1_1 Forward -125 -106 13.0577 0.232
NP_441836.1_2 Forward -126 -107 -4.03212 0.251
NP_441993.1_1 Forward -120 -101 9.25599 0.136
NP_440814.1_8 Forward -222 -203 0.294447 0.269
NP_440114.1_10 Forward -114 -100 11.111 0.125
NP_442323.1_7 Forward -72 -53 5.01354 0.21
NP_440492.1_9 Forward -324 -310 14.0211 0.294
NP_441510.2_7 Forward -120 -106 12.5853 0.28
NP_441510.2_7 Forward -356 -342 9.83206 0.281
NP_440293.1_3 Reverse -313 -332 -5.21209 0.274
NP_440293.1_9 Forward -37 -23 13.8567 0.211
NP_440293.1_10 Reverse -333 -352 -0.983855 0.27
NP_440766.1_5 Forward -23 -11 7.08284 0.29
NP_441237.1_9 Reverse -373 -383 9.7148 0.272
NP_442743.1_1 Forward -334 -315 4.32522 0.295
NP_439910.1_2 Reverse -97 -114 -14.0225 0.177
NP_442867.1_8 Reverse -80 -99 8.06259 0.24
NP_440457.1_1 Forward -226 -214 4.66053 0.156
NP_440457.1_1 Forward -118 -106 4.46387 0.161
NP_440457.1_1 Forward -204 -192 -0.74767 0.273
NP_440457.1_1 Forward -209 -197 -0.944332 0.285
NP_440801.1_10 Forward -386 -367 4.32602 0.291
NP_440142.1_7 Forward -282 -263 8.35759 0.233
NP_441984.1_3 Reverse -118 -136 9.45892 0.21
NP_441984.1_3 Forward -355 -337 9.0656 0.217
NP_441984.1_3 Reverse -53 -71 5.03403 0.295
NP_440473.1_9 Forward -125 -106 -6.29373 0.228
NP_440473.1_9 Forward -181 -162 -7.67036 0.238
NP_441496.1_1 Forward -154 -140 13.9534 0.271
NP_440524.1_2 Reverse -368 -387 -1.27885 0.27
NP_442514.1_5 Reverse -75 -94 15.7316 0.0252
NP_442514.1_5 Reverse -371 -390 -9.73604 0.298
NP_440554.1_4 Reverse -106 -116 4.10993 0.201
NP_440554.1_4 Reverse -284 -294 1.94665 0.282
NP_442862.1_3 Forward -240 -223 4.26707 0.29
NP_441885.1_5 Reverse -105 -115 11.6814 0.00668
NP_441885.1_5 Forward -114 -104 11.1898 0.00775
NP_442341.1_7 Reverse -104 -118 17.7975 0.0111
NP_442341.1_7 Reverse -160 -174 4.03116 0.204
NP_442341.1_9 Reverse -103 -117 10.3237 0.135
NP_440423.1_6 Forward -122 -103 -15.8318 0.229
NP_443000.1_7 Reverse -103 -113 10.1081 0.0376
NP_443000.1_7 Forward -116 -106 7.35486 0.0859
NP_440507.2_3 Forward -123 -104 8.35677 0.253
NP_440727.1_2 Reverse -342 -361 -1.86883 0.295
NP_440275.1_3 Forward -202 -192 6.27322 0.118
NP_440275.1_3 Reverse -103 -113 5.28991 0.158
NP_440091.1_1 Forward -360 -348 0.530633 0.247
NP_440091.1_1 Forward -118 -106 -0.846001 0.293
NP_440091.1_1 Reverse -101 -113 -0.944332 0.3
NP_441902.1_3 Forward -365 -355 12.3986 0.253
NP_440679.1_10 Forward -177 -158 -8.35868 0.18
NP_440679.1_10 Forward -385 -366 -21.7317 0.297
NP_440175.1_7 Forward -102 -84 8.58238 0.293
NP_442234.1_7 Reverse -199 -218 11.7992 0.246
NP_442495.1_4 Reverse -128 -138 13.943 0.183
NP_442495.1_4 Reverse -376 -386 11.4848 0.271
NP_440149.1_8 Reverse -99 -118 -3.24547 0.185
NP_441105.1_3 Forward -125 -106 3.83436 0.086
NP_441105.1_3 Reverse -100 -119 -3.73712 0.185
NP_441105.1_3 Forward -119 -100 -5.99873 0.227
NP_441105.1_3 Reverse -94 -113 -8.16202 0.267
NP_442373.1_2 Forward -378 -359 -2.26216 0.198
NP_440216.1_1 Forward -114 -100 -1.77037 0.0383
NP_440216.1_9 Reverse -181 -190 7.37455 0.286
NP_440216.1_9 Forward -71 -62 5.99792 0.289
NP_440172.1_1 Forward -114 -104 12.2714 0.0315
NP_440172.1_1 Reverse -105 -115 5.38824 0.145
NP_440172.1_1 Forward -66 -56 4.0116 0.208
NP_440172.1_6 Forward -126 -107 5.01433 0.288
NP_442290.1_8 Reverse -160 -174 17.5025 0.214
NP_442015.1_10 Forward -118 -105 7.78743 0.0782
NP_441226.1_7 Reverse -106 -113 14.1984 0.024
NP_441226.1_7 Forward -350 -343 8.29857 0.205
NP_441757.1_6 Forward -308 -289 6.78429 0.254
NP_441111.1_7 Forward -113 -105 8.96754 0.0463
NP_441111.1_7 Reverse -106 -114 8.86921 0.0589
NP_441766.1_2 Forward -114 -105 7.76787 0.0714
NP_441766.1_2 Reverse -105 -114 7.66954 0.0723
NP_441766.1_2 Reverse -161 -170 2.55633 0.257
NP_440416.1_9 Forward -389 -370 -14.3569 0.176
NP_440416.1_9 Reverse -104 -123 -14.4552 0.176
NP_443052.1_8 Reverse -151 -170 -7.96535 0.166
NP_443052.1_9 Reverse -359 -378 0.392778 0.2
NP_443052.1_9 Forward -335 -316 -2.95047 0.244
NP_440591.1_9 Forward -121 -103 10.9339 0.11
NP_442154.1_1 Forward -187 -169 -7.06068 0.141
NP_442154.1_1 Reverse -317 -335 -15.7138 0.224
NP_442154.1_1 Forward -380 -362 -16.2055 0.236
NP_442154.1_1 Forward -181 -163 -17.1888 0.249
NP_440261.1_5 Forward -169 -156 -3.02898 0.108
NP_440988.1_10 Reverse -109 -123 8.28727 0.205
NP_440988.1_10 Forward -116 -102 7.7064 0.215
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTTCAGTTACATTCCCCTGGGCAATGGTGGCGGCATTGAGGGGCAATGATCCCAACGCCATTAGACCGACACCCCAACCAAAAGCCATTAACCAACGGGCTGGGAAGAAGCGATGAGAAGAACGGCTAAGGCGGGTAAATCCTTGGGGCTGGGAAATCATATTTTGGTCAAATTTTAGGGCGGTGGAAGATGGATGGCGGTGTGACCGGATTAGCCATGGAGAGGTTAGCGGAGATGGCACCGTGTTTCCAGGATATCTTAAGCCCAGGGGCTTTTGGCTGACAATGGCGATGGCCAGTTCTTTCTCTTGGCCGGGGCAGGATGATAACCCAAGGACAATTGCTTGATAGGATAGCGATTAGCCCTTTTGGGCTGGCTTTGACAAATATTTAATTAATAT

CDS

ATGGGCGTTACCTGGGAATTGGATTTTTATTCACGGCCGTTGTTGGACGACGAGGAAAAAAAGGTGTGGGAAGTACTAATTTGTGAGTCTCCCCAATCCGTGCAGCAGTTACCAGGAGATTTGTTCCGCTACAGCCAATATTGTCCCAGTTCTACCGTTAATTCCGTTTGGCTCCGGCAGGCCATCGAAGCGGCGATCGCCGAGGCGGGTCAGATGCCTCAAAAGATCCGCTTTTTCCGGCGGCAGATGAATAACATGATCAGCAAAGCCTGTGAAGAAGCTGGTATTCCCCCGGCCCCCAGTCGTCGCACCTATGTACTGGAACAATGGTTAGGCGATCGCCTGGAGAATTTTTATCCCCAACAACCGGGCTATGACCCGAAGTTAGCTTCGTCCACATCCGTACAATATCCAGAACTTAATGCCATTGCCTTGCCCGATGCAGTGAGAGGCGATCGAGGGGACCAGTGGGCCTTGGTGAGTTTGGCCGCGGCTGATTTTAATGATTTACCGGATTGGGAGATTAGCTTTGGGGAAAGTTTTCCCCTCTCCTCGTACAATCTTTCCCCCGACAGTCGCATTCCTGGTTTGATTCTCTTTTCCCCCAGGGCTTTACCCTTTGCCGCTTGGTTATCGGGGTTGGAATTGGGCTATTTGCAATACAACACTGACCCCCGCCCTATTATGCGGTTGGAAACCGGAGCCAGTGATAGTTGGATTGTGGCCAACGTCACCGATAAAACCAGTGAACAGGAAGCTCAGGGCTTTGAACAGACAAAAAAATTGGCCCAGGGCATTCACTTTTTAGCCATCCAAACCAGCCCTGACAGTGAAACCTTTGCTGGTTTTTGGTTATTGCAGGAAACTGGACAAGTTTAG

Protein

MGVTWELDFYSRPLLDDEEKKVWEVLICESPQSVQQLPGDLFRYSQYCPSSTVNSVWLRQAIEAAIAEAGQMPQKIRFFRRQMNNMISKACEEAGIPPAPSRRTYVLEQWLGDRLENFYPQQPGYDPKLASSTSVQYPELNAIALPDAVRGDRGDQWALVSLAAADFNDLPDWEISFGESFPLSSYNLSPDSRIPGLILFSPRALPFAAWLSGLELGYLQYNTDPRPIMRLETGASDSWIVANVTDKTSEQEAQGFEQTKKLAQGIHFLAIQTSPDSETFAGFWLLQETGQV