Your browser is old and dusty. Try Google Chrome!

Details for sll1998

ORF sll1998
Accession NP_441365.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY100d: 1623697 - 1624643]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440259.1_4 Reverse -308 -322 10.7568 0.262
NP_441492.1_1 Forward -21 -2 11.1109 0.148
NP_441365.1_5 Forward -21 -2 37.5619 0.000000115
NP_440300.1_5 Reverse -30 -48 12.225 0.271
NP_440769.1_8 Reverse -286 -305 8.55425 0.23
NP_440447.1_5 Forward -121 -111 11.6814 0.291
NP_441716.1_2 Reverse -53 -72 3.35565 0.229
NP_441716.1_2 Forward -303 -284 -0.951026 0.277
NP_441077.1_6 Reverse -92 -108 5.21204 0.253
NP_441846.1_10 Forward -125 -106 -5.50708 0.19
NP_442530.1_2 Reverse -278 -288 11.0914 0.284
NP_442064.1_4 Reverse -76 -95 6.68515 0.246
NP_440138.1_1 Forward -210 -192 6.60656 0.253
NP_441654.1_6 Forward -231 -213 15.0897 0.229
NP_441000.1_1 Forward -22 -4 13.3937 0.184
NP_441550.1_7 Forward -294 -275 15.5152 0.241
NP_440345.1_3 Forward -286 -272 17.2957 0.161
NP_440345.1_3 Forward -287 -273 11.7571 0.247
NP_441369.1_1 Forward -56 -37 38.7419 0.000000157
NP_441369.1_2 Forward -26 -7 38.9385 0.0000000955
NP_441369.1_3 Forward -73 -59 28.5156 0.00021
NP_440736.1_4 Forward -329 -310 14.3549 0.122
NP_442288.1_5 Forward -58 -44 16.7159 0.12
NP_441556.1_6 Forward -54 -36 12.4797 0.296
NP_442247.1_5 Reverse -29 -43 14.4865 0.234
NP_442671.1_2 Forward -48 -29 24.6829 0.000359
NP_440891.1_8 Forward -307 -288 16.5696 0.233
NP_440891.1_8 Forward -172 -153 13.0204 0.294
NP_440096.1_5 Forward -125 -106 7.96426 0.259
NP_442970.1_1 Forward -46 -32 9.56081 0.269
NP_440775.1_4 Reverse -283 -302 12.3837 0.216
NP_440775.1_4 Forward -291 -272 10.4615 0.216
NP_441371.1_3 Reverse -142 -160 6.11567 0.277
NP_442076.1_5 Forward -52 -33 9.93088 0.186
NP_442808.1_1 Reverse -115 -125 3.71617 0.227
NP_440871.1_3 Reverse -52 -66 15.905 0.166
NP_440334.1_2 Forward -275 -262 15.5556 0.203
NP_441498.1_4 Forward -263 -244 17.8957 0.291
NP_442594.1_10 Reverse -234 -253 8.06178 0.288
NP_442998.1_5 Forward -25 -15 8.53483 0.261
NP_440899.1_8 Reverse -33 -52 -9.14533 0.258
NP_440087.1_1 Forward -359 -340 -5.60541 0.249
NP_441362.1_2 Forward -50 -31 5.55684 0.243
NP_441559.1_8 Reverse -112 -126 -5.11362 0.248
NP_441559.1_8 Reverse -111 -125 -6.58858 0.279
NP_440537.1_7 Forward -72 -53 16.6629 0.0599
NP_442386.1_9 Reverse -116 -125 9.63573 0.154
NP_441254.1_2 Reverse -144 -163 9.24257 0.211
NP_441912.1_3 Forward -130 -111 6.78429 0.27
NP_443051.1_5 Forward -248 -229 8.35759 0.235
NP_440372.1_3 Forward -45 -31 15.0039 0.165
NP_441877.1_9 Reverse -363 -380 2.59545 0.285
NP_440344.1_10 Forward -133 -116 -11.8592 0.231
NP_442280.1_10 Reverse -315 -333 4.87002 0.292
NP_442129.1_6 Forward -47 -28 13.9464 0.246
NP_441894.1_1 Forward -332 -313 -5.21209 0.258
NP_442067.1_3 Forward -310 -291 14.6508 0.224
NP_442454.1_2 Reverse -217 -236 8.45061 0.291
NP_442710.1_7 Forward -83 -64 -3.57057 0.263
NP_442710.1_7 Forward -49 -30 -7.22274 0.294
NP_441929.1_6 Forward -252 -233 15.3391 0.261
NP_440436.1_4 Forward -209 -200 4.52254 0.256
NP_442694.1_4 Forward -306 -297 11.0128 0.286
NP_442694.1_8 Reverse -32 -50 12.3105 0.191
NP_441982.1_6 Forward -266 -257 13.2493 0.274
NP_441982.1_6 Forward -281 -272 11.9124 0.288
NP_441982.1_10 Reverse -4 -23 8.55343 0.143
NP_442689.1_8 Reverse -32 -49 -8.61428 0.294
NP_441124.1_5 Forward -53 -43 12.7217 0.215
NP_441031.1_1 Forward -386 -367 9.32929 0.212
NP_439950.1_1 Forward -240 -231 17.4043 0.145
NP_439950.1_1 Forward -117 -108 12.4878 0.279
NP_441432.1_9 Reverse -247 -260 7.91967 0.298
NP_440760.1_7 Reverse -222 -241 5.70185 0.211
NP_440352.1_5 Forward -250 -231 13.1424 0.208
NP_441948.1_4 Forward -133 -115 -3.81576 0.207
NP_441329.1_3 Forward -300 -290 15.3887 0.25
NP_442568.1_5 Forward -328 -309 13.0775 0.177
NP_441541.1_1 Forward -36 -18 -3.43572 0.264
NP_442809.1_6 Forward -126 -107 1.0811 0.277
NP_440546.1_4 Forward -314 -304 7.33119 0.246
NP_441848.1_7 Forward -232 -213 2.9486 0.217
NP_441084.1_6 Forward -273 -259 9.05325 0.295
NP_442923.1_6 Reverse -94 -108 16.2452 0.183
NP_442679.1_1 Forward -329 -310 -4.03212 0.269
NP_441701.1_3 Forward -312 -295 6.03703 0.294
NP_441959.1_8 Forward -46 -33 8.61288 0.286
NP_441102.1_2 Forward -237 -218 5.01433 0.298
NP_442101.1_6 Forward -308 -289 11.0125 0.29
NP_440854.1_7 Reverse -244 -258 13.4746 0.292
NP_441028.1_6 Reverse -109 -119 4.40448 0.278
NP_441527.1_4 Forward -244 -225 -3.96334 0.178
NP_441527.1_4 Forward -330 -311 -6.25514 0.215
NP_441527.1_4 Forward -319 -300 -9.1199 0.255
NP_441527.1_4 Forward -333 -314 -11.2207 0.278
NP_441527.1_4 Forward -260 -241 -11.2207 0.278
NP_441527.1_7 Reverse -301 -320 6.88182 0.298
NP_442306.1_10 Reverse -196 -215 -21.9284 0.296
NP_439940.1_1 Forward -74 -55 31.957 0.00000438
NP_440326.1_9 Reverse -284 -303 11.8967 0.274
NP_441431.1_1 Reverse -31 -49 5.06306 0.245
NP_440054.1_4 Forward -279 -260 14.4541 0.135
NP_442703.1_8 Reverse -309 -327 10.7364 0.266
NP_441756.1_5 Reverse -112 -131 -4.03212 0.29
NP_440191.1_6 Reverse -31 -45 13.1895 0.294
NP_442451.1_7 Forward -51 -32 12.9791 0.113
NP_440258.1_3 Reverse -266 -285 -1.37718 0.18
NP_440216.1_9 Forward -331 -322 5.3096 0.298
NP_442371.1_1 Forward -242 -232 12.1726 0.258
NP_442116.1_6 Reverse -30 -47 7.50051 0.254
NP_441974.1_3 Reverse -212 -229 19.3089 0.136
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGACAAGCATGAGGAGTATGTTTAAAAGACTGAACTTACGAGGAGAGACAGTCGATATATCTACATTCTCAAAGGCAAGCAAAAAAAGGGATGTGGGAGTTTTTAGAGAAATAATATTTTCCTTAAAAAAGGAATTGTCGAAAAGGAAGGAAATTAAGCAGGGAGAATTAGAAATATTTCCTCTCGATTCAACCATTGTCAGCATAACTAGTAAGTTGATGTGGAACCTTGGATTTCATCAGGTAAAAGTATTCAGTGGGATTAACTTATCAACAGGGATTCCGGGGGGAATAGTAATTCACTTTGGACAAGGTCATGATAATAAATATAGTCATTTCAATTAACGATGAGAGAATTTAATGTAAAATTATGGAGTGTACAAAATGAACAGGTTTAAACA

CDS

ATGGCTTACAGTTTAGATTTGAGGCAAAGAGTAGTAGCTTATATAGAAGCTGGAGGAAAAATAACTGAGGCTTCCAAGATATATAAAATAGGAAAAGCCTCGATATACAGATGGTTAAATAGAGTAGATTTAAGCCCAACAAAAGTAGAGCGTCGCCATAGGAAATTAGACTGGGAAGCTCTAAAAAAAGACGTAGAAGAAAATCCCGATGCAAGATTGATAGACAGAGCCAAGAAATTTGGAGTGAGGCCGAGTGCCGTATATTACGCATTAAAGAAAATGAAAATAAACAGAAAAAAAAAAGAACTACGTTATCGAGAAAGAAACCGGGAGGAACGAGTTAAGTACTATAGAATGTTAAGAGAACTAATTAAGCTCTATGGTAGTCAAGCTATAGTTTACATAGATGAATCTGGATTCGAAGCAATCCAGGCTTGTATTTATGCCTGGTCAAAAAAAGGAAAAAAAGTTTATGGAGATAGACAAGGAAAAAGGGGAGTCAGAGAAAATCTAGTAGCAGGGAGAAGAAAAGGAAAAAAAGATTTGATTGCGCCGATGGTTTTTACCGGGAGTTTGAATGCAGAAGGCTTTGAAGGATGGTTAAAATTATATTTGCTATCCTCCCTCGACATTCCATCAATATTAATAATGGATAATGCTCCTATTCATCGTAAAACTGCCATTAAAGAATTGGCTAAAGAAGCAGGTCATGAAGTTCTTTTTTTGCCGAAATATTCTCCTGATTTAAATGATATTGAGCATGACTTTAGTGCCTTGAAACGAGCTAGAATGTACGCTCCTATTGACACGTCTCTTGATGAAATTATCCGTTCTTACTGTGGCGTTTAG

Protein

MAYSLDLRQRVVAYIEAGGKITEASKIYKIGKASIYRWLNRVDLSPTKVERRHRKLDWEALKKDVEENPDARLIDRAKKFGVRPSAVYYALKKMKINRKKKELRYRERNREERVKYYRMLRELIKLYGSQAIVYIDESGFEAIQACIYAWSKKGKKVYGDRQGKRGVRENLVAGRRKGKKDLIAPMVFTGSLNAEGFEGWLKLYLLSSLDIPSILIMDNAPIHRKTAIKELAKEAGHEVLFLPKYSPDLNDIEHDFSALKRARMYAPIDTSLDEIIRSYCGV