Your browser is old and dusty. Try Google Chrome!

Details for sll1980

ORF sll1980
Accession NP_441306.1
Symbol trxA
Category Detoxification
Definition thiol:disulfide interchange protein TrxA
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -210 -191 -29.0082 0.215
NP_441418.1_6 Reverse -149 -168 -30.1882 0.262
NP_442655.1_10 Forward -213 -194 -11.8986 0.261
NP_442173.1_1 Forward -157 -149 6.01761 0.2
NP_440061.1_9 Reverse -184 -198 9.14375 0.151
NP_440110.1_7 Forward -390 -371 11.9958 0.289
NP_441859.1_3 Reverse -307 -326 1.6703 0.278
NP_441208.1_9 Forward -182 -168 6.88276 0.229
NP_440370.1_10 Reverse -192 -211 8.65258 0.241
NP_441738.1_2 Forward -208 -201 8.1019 0.204
NP_441558.1_5 Forward -212 -193 5.99764 0.232
NP_442111.1_3 Forward -192 -179 13.5261 0.261
NP_442111.1_4 Reverse -208 -222 2.75286 0.266
NP_441130.1_10 Reverse -232 -246 4.52282 0.281
NP_442145.1_3 Forward -251 -232 7.27595 0.243
NP_442634.1_4 Forward -212 -198 -2.75368 0.156
NP_441857.1_5 Reverse -194 -212 3.65739 0.239
NP_442485.1_3 Reverse -271 -290 6.29264 0.163
NP_442530.1_2 Reverse -353 -363 12.3697 0.276
NP_441682.1_2 Forward -290 -271 2.3594 0.241
NP_442937.1_5 Forward -290 -271 8.35759 0.225
NP_442937.1_5 Forward -328 -309 5.99764 0.293
NP_441958.1_5 Forward -211 -201 0.471689 0.143
NP_441958.1_5 Forward -77 -67 -1.78992 0.252
NP_439990.1_5 Forward -62 -49 7.88576 0.185
NP_441338.2_5 Forward -198 -179 6.98095 0.275
NP_439975.1_3 Forward -200 -187 16.6372 0.201
NP_442002.1_1 Forward -262 -244 -9.61729 0.283
NP_442438.1_10 Reverse -196 -210 0.589577 0.221
NP_440147.1_4 Forward -78 -65 9.65572 0.038
NP_440147.1_4 Forward -212 -199 4.05085 0.173
NP_441041.1_4 Forward -158 -139 -6.09707 0.163
NP_442941.1_3 Reverse -202 -212 -0.118297 0.249
NP_440260.1_8 Reverse -257 -275 -6.4707 0.291
NP_442281.1_1 Reverse -196 -210 7.27547 0.104
NP_440437.1_1 Forward -332 -313 -5.80207 0.292
NP_441644.1_6 Reverse -282 -292 3.71617 0.267
NP_441644.1_6 Reverse -201 -211 3.12618 0.297
NP_442029.1_10 Reverse -236 -255 4.916 0.29
NP_442554.1_8 Forward -290 -280 4.20827 0.193
NP_442142.1_4 Reverse -273 -286 5.62358 0.187
NP_440919.1_7 Reverse -324 -342 4.29405 0.295
NP_440895.1_6 Forward -63 -50 13.294 0.202
NP_443009.1_2 Reverse -323 -342 0.982764 0.216
NP_443009.1_5 Forward -211 -200 8.31797 0.112
NP_443009.1_8 Forward -40 -21 13.5691 0.259
NP_441715.1_4 Reverse -202 -212 11.6814 0.0778
NP_440183.1_9 Forward -289 -270 -12.9802 0.26
NP_441015.1_10 Forward -215 -196 -5.11376 0.217
NP_441015.1_10 Forward -248 -229 -10.1286 0.283
NP_441330.1_1 Forward -215 -196 -6.1954 0.146
NP_442063.1_5 Forward -254 -235 9.73422 0.245
NP_442719.1_2 Forward -24 -6 -6.66806 0.226
NP_442050.1_5 Forward -212 -202 10.8943 0.126
NP_441036.1_3 Forward -344 -325 -5.40875 0.286
NP_441036.1_8 Forward -341 -331 7.74818 0.187
NP_441557.1_5 Forward -210 -201 -0.786921 0.239
NP_441445.1_8 Forward -290 -271 -2.36049 0.274
NP_442419.1_2 Reverse -196 -215 -4.72043 0.292
NP_441914.1_10 Reverse -20 -39 7.86512 0.293
NP_442594.1_8 Forward -191 -172 8.75091 0.202
NP_442594.1_8 Forward -182 -163 5.89931 0.236
NP_441633.1_3 Reverse -184 -197 -6.66722 0.265
NP_441633.1_3 Forward -212 -199 -6.76555 0.271
NP_442590.1_9 Forward -292 -273 4.32602 0.273
NP_442998.1_5 Forward -333 -323 11.8781 0.176
NP_440299.1_1 Reverse -197 -210 3.7553 0.232
NP_441799.1_1 Forward -214 -200 10.6187 0.0702
NP_441559.1_8 Reverse -72 -86 -5.60527 0.267
NP_441559.1_8 Reverse -197 -211 -6.29359 0.276
NP_440915.1_6 Reverse -197 -211 3.63784 0.101
NP_442158.1_4 Reverse -264 -274 10.8948 0.283
NP_442069.1_7 Reverse -271 -290 9.93006 0.291
NP_440243.1_1 Forward -188 -169 13.4162 0.246
NP_440695.1_6 Forward -86 -72 14.1927 0.217
NP_441939.1_4 Reverse -318 -337 13.2252 0.257
NP_441494.1_6 Reverse -196 -209 6.70579 0.276
NP_442386.1_9 Reverse -281 -290 8.2591 0.205
NP_443051.1_1 Forward -211 -202 0.0980582 0.226
NP_440451.1_10 Reverse -277 -296 9.7334 0.264
NP_439937.1_9 Reverse -343 -360 -14.9081 0.287
NP_440836.1_6 Reverse -74 -88 10.9143 0.227
NP_440210.1_10 Reverse -240 -259 11.7983 0.237
NP_442384.1_10 Reverse -67 -80 3.46087 0.19
NP_442384.1_10 Reverse -48 -61 0.510939 0.289
NP_442114.1_6 Reverse -93 -112 9.50036 0.277
NP_441980.1_4 Reverse -367 -386 3.14605 0.283
NP_440297.1_9 Forward -290 -280 -0.216628 0.282
NP_440999.1_9 Reverse -197 -211 7.57108 0.0846
NP_440888.1_2 Reverse -201 -215 7.07881 0.208
NP_440380.1_5 Forward -135 -116 0.491109 0.299
NP_441306.1_4 Forward -228 -209 19.0757 0.0975
NP_440220.1_4 Forward -298 -279 -1.8696 0.265
NP_441462.1_5 Forward -201 -182 2.16274 0.291
NP_441621.1_7 Forward -245 -231 -3.34366 0.188
NP_440889.1_1 Forward -400 -381 12.5858 0.212
NP_442204.1_1 Forward -310 -299 -0.0396598 0.285
NP_442487.1_6 Reverse -260 -279 14.1583 0.196
NP_440516.1_8 Reverse -149 -158 7.17789 0.0754
NP_440673.1_3 Reverse -69 -76 7.51227 0.252
NP_442219.1_8 Reverse -272 -291 7.68394 0.265
NP_442907.1_2 Reverse -235 -253 11.2289 0.181
NP_441004.1_1 Forward -185 -166 -15.2418 0.273
NP_440296.1_6 Forward -112 -94 12.7024 0.295
NP_442430.1_4 Reverse -199 -218 15.9291 0.163
NP_442622.1_1 Reverse -353 -372 -4.13045 0.219
NP_440593.1_3 Forward -362 -343 -2.85214 0.228
NP_441982.1_6 Forward -335 -326 10.48 0.296
NP_440165.1_5 Reverse -104 -123 -0.197208 0.165
NP_441046.1_2 Reverse -343 -362 -0.787193 0.287
NP_440432.1_9 Forward -165 -150 -2.67504 0.175
NP_439960.1_2 Forward -350 -331 13.5691 0.215
NP_441124.1_5 Reverse -73 -83 10.4299 0.289
NP_440431.1_3 Forward -223 -204 -9.047 0.24
NP_440588.1_3 Forward -190 -171 9.0459 0.291
NP_442006.1_2 Forward -345 -328 -5.86102 0.147
NP_442006.1_2 Forward -204 -187 -16.5791 0.256
NP_440078.1_2 Forward -192 -173 17.404 0.147
NP_442729.1_5 Forward -286 -276 7.84651 0.261
NP_442480.1_6 Forward -183 -165 18.8987 0.221
NP_442443.1_1 Reverse -369 -388 -3.93378 0.267
NP_442443.1_1 Forward -248 -229 -4.32711 0.271
NP_441432.1_8 Forward -77 -68 11.9961 0.0519
NP_441432.1_8 Forward -211 -202 8.06287 0.0877
NP_442320.1_8 Reverse -195 -209 -4.22864 0.151
NP_440629.1_4 Forward -344 -325 9.73422 0.244
NP_440629.1_5 Reverse -320 -339 7.66927 0.29
NP_440199.1_10 Reverse -216 -226 13.2547 0.108
NP_440199.1_10 Forward -323 -313 10.7964 0.171
NP_442489.1_7 Reverse -201 -210 -1.96689 0.28
NP_441040.1_2 Reverse -326 -345 -8.752 0.236
NP_442008.1_2 Forward -173 -154 5.40766 0.226
NP_441585.1_5 Forward -373 -354 -0.0996487 0.291
NP_441502.1_3 Forward -212 -193 8.55425 0.215
NP_442162.1_9 Forward -157 -150 5.93897 0.214
NP_442073.1_6 Reverse -339 -358 1.47442 0.25
NP_442199.1_5 Forward -218 -199 -0.983855 0.179
NP_441609.1_1 Reverse -324 -343 6.58763 0.179
NP_440594.1_8 Reverse -139 -152 7.2952 0.288
NP_442089.1_1 Reverse -270 -289 0.294447 0.261
NP_440567.1_1 Forward -209 -195 -0.0987402 0.264
NP_441239.1_9 Forward -212 -200 5.44718 0.221
NP_441727.1_3 Forward -298 -279 6.88262 0.24
NP_442772.1_4 Reverse -202 -221 -2.75381 0.229
NP_440833.1_6 Forward -19 -5 11.307 0.224
NP_440949.1_7 Forward -209 -190 8.16011 0.293
NP_442041.1_10 Reverse -340 -359 11.7008 0.248
NP_441230.1_5 Forward -163 -144 -0.197208 0.28
NP_440868.1_4 Forward -174 -162 -0.354346 0.263
NP_442402.1_4 Forward -325 -306 -7.17944 0.272
NP_440653.1_10 Forward -221 -202 2.26107 0.289
NP_439942.1_7 Reverse -295 -314 -0.4922 0.228
NP_442679.1_1 Forward -149 -130 -5.60541 0.293
NP_440505.1_3 Forward -212 -202 6.46988 0.18
NP_440505.1_3 Forward -78 -68 4.3066 0.3
NP_442360.1_5 Forward -92 -82 14.1397 0.242
NP_440207.2_8 Forward -204 -185 15.2408 0.284
NP_441527.1_4 Reverse -94 -113 -12.5576 0.291
NP_441059.1_2 Forward -211 -192 -7.27704 0.291
NP_441216.1_5 Reverse -190 -209 11.0117 0.298
NP_439903.1_6 Reverse -64 -83 3.63691 0.207
NP_439903.1_6 Reverse -242 -261 1.76863 0.24
NP_442588.1_6 Reverse -351 -370 -3.04881 0.296
NP_441647.1_8 Reverse -235 -254 11.11 0.285
NP_440886.1_7 Reverse -233 -243 6.37109 0.13
NP_442022.1_4 Reverse -23 -42 5.70265 0.279
NP_442238.1_7 Reverse -120 -139 8.16011 0.243
NP_442794.1_5 Reverse -198 -212 11.8976 0.275
NP_441962.1_4 Forward -200 -181 -13.9635 0.28
NP_440855.1_1 Reverse -186 -205 -0.983855 0.267
NP_441431.1_2 Reverse -118 -132 10.717 0.155
NP_441431.1_2 Reverse -198 -212 6.48882 0.269
NP_440114.1_10 Reverse -149 -163 11.111 0.125
NP_442930.1_1 Reverse -322 -332 9.41933 0.287
NP_442297.1_3 Reverse -188 -207 7.66846 0.292
NP_442509.1_9 Reverse -149 -159 7.35439 0.225
NP_442439.1_8 Forward -283 -264 8.16093 0.26
NP_440756.1_1 Forward -99 -80 15.2111 0.294
NP_440554.1_4 Forward -209 -199 3.22496 0.239
NP_442341.1_9 Reverse -147 -161 4.71887 0.294
NP_443000.1_7 Forward -59 -49 4.0116 0.225
NP_443000.1_7 Forward -212 -202 1.06167 0.274
NP_439962.1_4 Reverse -193 -212 -9.14533 0.299
NP_440216.1_9 Forward -310 -301 12.3894 0.241
NP_440216.1_9 Reverse -284 -293 6.98123 0.289
NP_440172.1_1 Forward -76 -66 4.0116 0.208
NP_440172.1_1 Reverse -201 -211 2.92996 0.258
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTTGCCTAGCTTGGCTGTATCTCCTGGACGACAAGCCAACTTTGGCCTTCAAAGCGGCCCAAAGGTCGGTGAAAATTGACGGTTATCATCCCCAGGCAAGGATTAACTATGCCTTGGCCATGTTGGCTAATAAAAAAACCGGTGTACGGGAACAGGTGGAGTTAGCGGCGCAAATGATGTCCTTTGATCAGGAAATCGCTGCGGGAGTGATGGAAAGTTTGGATGATGGTCTCGAGCGTAAGCCCGATTGGCGAGACATTGAACGGATTAAGAAATGGCTGACAGAATAGTTTGACTAATCGGTTTTAACTTTAGGCAAATTCAGGCAATCAGTTCAGTCCCTAGTGTTCGTTTGTTACCTTGGATAGAATTCCTAACTTCGTACAAATATCCCTAGACC

CDS

ATGACCCCGGCCAAAATTCGTAACGCCTTATTAGCCGTAGTGGCGATCGCCTTGAGTGCGGCCGTTTATCTCGGTTTCCAAACCCAAACCCAGGGTATATCCCTAGAAGCCCAAGCCCAGCGGGCCATTCCCCTGGCCACTGCCTTGGACAATGGTCGTCCCACCTTGGTGGAATTCTATGCTGACTGGTGTACTAGCTGCCAAGCCATGGCTCCGGACTTAGCAGAGTTGAAGAAAAACTATGGCGGTTCGGTGAACTTTGCCATGCTCAATGTGGACAACAATAAATGGTTGCCGGAAGTGTTGCGCTATCGGGTGGATGGCATTCCCCATTTTGTTTACCTAGATGACACCGGCACGGCGATCGCCGAGAGCATTGGAGAGCAACCGTTGAGGGTGTTGGAGCAAAATATCACTGCCCTGGTAGCCCACGAACCCATCCCCTACGCCAATGTAACTGGCCAAACTTCAGTGGTGGAAAACCGAACCATTGAAGCTGACCCCACCTCTCCCCGCAGTCACGGTAATCCCCGCCCCAGCTAG

Protein

MTPAKIRNALLAVVAIALSAAVYLGFQTQTQGISLEAQAQRAIPLATALDNGRPTLVEFYADWCTSCQAMAPDLAELKKNYGGSVNFAMLNVDNNKWLPEVLRYRVDGIPHFVYLDDTGTAIAESIGEQPLRVLEQNITALVAHEPIPYANVTGQTSVVENRTIEADPTSPRSHGNPRPS