Your browser is old and dusty. Try Google Chrome!

Details for sll1979

ORF sll1979
Accession NP_441307.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -284 -298 12.8809 0.201
NP_442711.1_1 Reverse -84 -98 11.8976 0.23
NP_441061.1_2 Reverse -285 -299 4.03116 0.157
NP_441061.1_2 Forward -114 -100 -0.393733 0.228
NP_441061.1_2 Reverse -95 -109 -0.787057 0.239
NP_440795.1_7 Forward -292 -285 14.6904 0.0123
NP_440795.1_7 Reverse -285 -292 14.6904 0.0123
NP_441418.1_6 Reverse -94 -113 -20.4534 0.114
NP_441418.1_6 Reverse -284 -303 -29.8932 0.245
NP_441418.1_6 Forward -115 -96 -30.0898 0.256
NP_442291.1_7 Forward -119 -105 10.7177 0.233
NP_441453.1_1 Forward -300 -282 4.44329 0.26
NP_441453.1_4 Reverse -284 -292 16.539 0.00633
NP_441453.1_4 Forward -293 -285 16.539 0.00633
NP_442151.1_6 Reverse -284 -298 15.9292 0.0192
NP_442151.1_6 Forward -293 -279 9.63603 0.142
NP_442151.1_6 Forward -103 -89 7.37441 0.2
NP_442151.1_6 Forward -115 -101 5.1128 0.294
NP_442838.1_7 Reverse -279 -298 -10.0303 0.232
NP_440226.1_1 Forward -293 -274 13.7658 0.0348
NP_441630.1_3 Reverse -276 -295 -0.4922 0.288
NP_442655.1_1 Reverse -279 -298 1.37609 0.238
NP_442173.1_1 Forward -292 -284 15.4574 0.00633
NP_442173.1_1 Reverse -285 -293 15.4574 0.00633
NP_442752.1_4 Forward -293 -286 13.8055 0.0199
NP_442752.1_4 Reverse -284 -291 13.8055 0.0199
NP_442752.1_4 Forward -158 -151 5.54565 0.194
NP_443027.1_4 Forward -295 -285 15.3197 0.0437
NP_443027.1_4 Reverse -282 -292 13.943 0.0452
NP_442975.1_10 Reverse -280 -294 21.3367 0.00107
NP_442975.1_10 Forward -297 -283 3.63724 0.252
NP_441225.1_1 Forward -291 -272 -1.67217 0.149
NP_440784.1_7 Forward -292 -285 15.9687 0.0123
NP_440784.1_7 Reverse -285 -292 15.9687 0.0123
NP_440784.1_7 Reverse -107 -114 7.51227 0.138
NP_442909.1_7 Reverse -150 -164 11.602 0.131
NP_440061.1_9 Reverse -147 -161 7.57046 0.202
NP_441476.1_5 Reverse -279 -298 -1.18052 0.2
NP_441476.1_5 Forward -120 -101 -3.3438 0.235
NP_441476.1_5 Forward -298 -279 -7.67036 0.29
NP_442062.1_8 Forward -293 -283 19.4496 0.000558
NP_442062.1_8 Reverse -284 -294 10.3048 0.0493
NP_440761.1_4 Reverse -279 -298 -13.7669 0.257
NP_441859.1_3 Reverse -283 -302 5.2102 0.206
NP_440304.1_4 Forward -295 -285 18.9579 0.00406
NP_440304.1_4 Reverse -282 -292 9.91146 0.051
NP_440304.1_4 Forward -250 -240 2.24165 0.299
NP_442242.1_4 Forward -292 -285 14.3954 0.0124
NP_442242.1_4 Reverse -285 -292 14.3954 0.0124
NP_440044.1_8 Reverse -285 -304 4.32602 0.116
NP_440044.1_8 Forward -292 -273 0.196116 0.203
NP_441781.1_7 Forward -311 -292 -2.65548 0.289
NP_441208.1_9 Forward -296 -282 16.8142 0.0647
NP_441208.1_9 Reverse -281 -295 7.76774 0.219
NP_441594.1_6 Forward -302 -283 5.60432 0.209
NP_440132.1_1 Reverse -282 -300 9.75391 0.234
NP_442110.1_7 Reverse -284 -298 19.6658 0.0138
NP_442110.1_7 Forward -293 -279 0.392915 0.261
NP_442110.1_7 Forward -115 -101 -0.000409212 0.27
NP_441925.1_4 Reverse -113 -132 -15.0459 0.263
NP_440856.1_4 Forward -300 -281 14.2574 0.0346
NP_440856.1_7 Reverse -91 -110 -1.57384 0.182
NP_441083.1_5 Forward -293 -283 11.3864 0.0159
NP_441083.1_5 Reverse -284 -294 11.2881 0.0159
NP_441083.1_5 Reverse -149 -159 6.17489 0.0894
NP_441083.1_5 Forward -103 -93 -1.10161 0.295
NP_442827.1_8 Reverse -276 -295 6.48849 0.106
NP_442827.1_8 Forward -166 -147 3.63691 0.144
NP_441434.1_1 Reverse -5 -19 17.0092 0.162
NP_441434.1_1 Forward -20 -6 9.94278 0.233
NP_441434.1_7 Forward -291 -277 12.4876 0.111
NP_441738.1_2 Forward -291 -284 15.28 0.0102
NP_441738.1_2 Reverse -286 -293 15.28 0.0102
NP_441558.1_5 Forward -295 -276 14.3558 0.0495
NP_440209.1_1 Reverse -284 -292 18.1123 0.00295
NP_440209.1_1 Forward -293 -285 18.1123 0.00295
NP_442889.1_8 Reverse -281 -295 3.63724 0.273
NP_440056.1_1 Reverse -101 -120 7.37428 0.297
NP_441713.1_1 Forward -299 -280 -7.17871 0.129
NP_440178.1_7 Forward -294 -275 5.89931 0.0166
NP_442445.1_1 Reverse -304 -323 14.9458 0.167
NP_441716.1_1 Forward -115 -101 5.50613 0.227
NP_442111.1_4 Reverse -283 -297 13.0776 0.0399
NP_441163.1_1 Reverse -328 -345 4.36469 0.289
NP_440343.1_3 Forward -366 -348 2.47668 0.298
NP_440906.1_5 Forward -292 -285 15.8704 0.0124
NP_440906.1_5 Reverse -285 -292 15.8704 0.0124
NP_440747.1_10 Forward -296 -284 7.80712 0.00223
NP_440747.1_10 Reverse -281 -293 -2.02597 0.0196
NP_440747.1_10 Reverse -103 -115 -11.8591 0.161
NP_441130.1_10 Forward -295 -281 10.521 0.112
NP_441130.1_10 Reverse -282 -296 9.73436 0.12
NP_441130.1_10 Reverse -147 -161 5.1128 0.247
NP_441854.1_10 Reverse -282 -301 8.65258 0.171
NP_442973.1_7 Forward -298 -279 18.879 0.149
NP_441486.1_1 Reverse -281 -295 -3.44199 0.178
NP_441880.2_10 Forward -292 -274 24.5036 0.00391
NP_442330.1_4 Reverse -282 -301 13.4822 0.286
NP_442634.1_4 Reverse -282 -296 14.3559 0.0195
NP_442634.1_4 Forward -295 -281 4.22782 0.0819
NP_441265.1_3 Forward -299 -285 3.93283 0.181
NP_441014.1_5 Reverse -378 -396 14.8671 0.2
NP_441014.1_10 Forward -337 -318 -0.00131823 0.246
NP_442848.1_1 Forward -299 -285 -2.85201 0.263
NP_442848.1_1 Reverse -278 -292 -3.04867 0.263
NP_441012.1_4 Forward -107 -94 5.72248 0.291
NP_443018.1_3 Forward -292 -285 14.8871 0.0123
NP_443018.1_3 Reverse -285 -292 14.8871 0.0123
NP_441316.1_7 Reverse -282 -297 13.7462 0.0486
NP_441634.1_8 Forward -295 -281 5.60446 0.114
NP_441634.1_8 Forward -111 -97 -4.62196 0.295
NP_440376.1_1 Forward -293 -284 19.4693 0.000692
NP_440376.1_1 Reverse -284 -293 19.4693 0.000692
NP_440376.1_1 Forward -158 -149 3.44131 0.203
NP_441588.1_4 Forward -291 -281 6.96153 0.178
NP_442687.1_7 Reverse -283 -293 15.8113 0.0125
NP_442687.1_7 Forward -294 -284 9.02648 0.0994
NP_442485.1_3 Reverse -101 -120 -4.81876 0.285
NP_440642.1_10 Forward -320 -306 3.8339 0.265
NP_441080.1_7 Reverse -258 -276 6.31156 0.293
NP_441422.1_7 Reverse -282 -299 8.00365 0.0992
NP_441422.1_7 Forward -240 -223 -7.82764 0.263
NP_441950.1_7 Forward -72 -53 -8.45701 0.287
NP_440360.1_10 Forward -107 -93 1.86788 0.282
NP_442658.1_1 Reverse -282 -292 18.7607 0.00222
NP_442658.1_1 Forward -295 -285 15.9091 0.00966
NP_440141.1_4 Reverse -97 -116 1.67108 0.296
NP_440617.1_6 Reverse -252 -271 8.25926 0.258
NP_442782.1_2 Reverse -284 -298 2.45787 0.275
NP_442205.1_9 Reverse -278 -294 -2.49807 0.271
NP_442205.1_9 Forward -164 -148 -2.79306 0.272
NP_441414.1_9 Forward -293 -274 -1.37718 0.0996
NP_441487.1_9 Forward -294 -275 1.57275 0.198
NP_442937.1_5 Reverse -101 -120 13.2741 0.095
NP_442937.1_5 Forward -143 -124 6.29264 0.282
NP_442937.1_5 Reverse -279 -298 6.09597 0.288
NP_441958.1_5 Forward -294 -284 21.2195 0.000805
NP_441958.1_5 Reverse -283 -293 12.2714 0.00183
NP_441958.1_5 Forward -159 -149 -1.19994 0.231
NP_440318.1_1 Reverse -94 -113 5.99764 0.218
NP_440203.1_5 Reverse -287 -297 12.7626 0.138
NP_440984.1_7 Reverse -279 -293 16.6175 0.0384
NP_439990.1_5 Forward -298 -285 9.95071 0.128
NP_439990.1_5 Reverse -101 -114 6.1158 0.255
NP_442911.1_2 Forward -303 -284 4.32602 0.0391
NP_442911.1_2 Reverse -274 -293 -1.7705 0.0897
NP_441580.1_6 Reverse -273 -292 -6.58872 0.235
NP_440153.1_5 Forward -292 -278 12.291 0.0656
NP_443055.1_8 Reverse -322 -340 15.5546 0.246
NP_440993.1_2 Forward -298 -282 15.5948 0.0631
NP_440993.1_2 Reverse -279 -295 12.3499 0.0735
NP_440993.1_3 Forward -303 -284 10.4217 0.11
NP_441429.1_4 Reverse -307 -326 9.24175 0.236
NP_439975.1_3 Forward -139 -126 16.9322 0.201
NP_441099.1_5 Forward -303 -284 -7.96535 0.183
NP_442002.1_9 Reverse -283 -290 10.7572 0.185
NP_441294.1_7 Reverse -280 -294 13.7621 0.0568
NP_441294.1_7 Forward -155 -141 9.15464 0.256
NP_441646.1_1 Forward -122 -103 4.52268 0.191
NP_442438.1_10 Forward -298 -284 11.996 0.0412
NP_442438.1_10 Reverse -279 -293 11.2093 0.0463
NP_441000.1_6 Forward -294 -280 5.1128 0.0933
NP_442771.1_1 Reverse -282 -300 -4.70074 0.166
NP_442771.1_1 Forward -160 -142 -6.66736 0.168
NP_440147.1_4 Reverse -282 -295 12.2123 0.0326
NP_440147.1_4 Forward -295 -282 11.819 0.0326
NP_440147.1_4 Forward -117 -104 0.314277 0.257
NP_441550.1_8 Forward -295 -285 17.4824 0.00754
NP_441550.1_8 Reverse -282 -292 10.501 0.066
NP_441916.1_7 Reverse -284 -294 18.9579 0.00144
NP_441916.1_7 Forward -293 -283 18.4663 0.00144
NP_440345.1_3 Forward -93 -79 11.8526 0.247
NP_440465.1_4 Reverse -283 -302 13.0775 0.202
NP_440465.1_10 Reverse -281 -300 -1.7705 0.297
NP_441041.1_4 Forward -115 -96 -11.4069 0.246
NP_441041.1_4 Forward -293 -274 -11.6036 0.25
NP_441041.1_7 Reverse -281 -293 19.5648 0.00277
NP_441041.1_7 Forward -296 -284 14.9975 0.0309
NP_441041.1_7 Reverse -212 -224 5.47405 0.255
NP_442004.1_6 Reverse -284 -298 13.8643 0.0811
NP_441725.1_4 Forward -298 -284 12.2903 0.0693
NP_441725.1_5 Forward -292 -282 9.02648 0.0553
NP_441725.1_5 Reverse -285 -295 8.92815 0.0553
NP_439966.1_7 Reverse -282 -292 17.4824 0.00636
NP_439966.1_7 Forward -295 -285 13.8442 0.0234
NP_439966.1_7 Reverse -147 -157 5.09279 0.243
NP_439966.1_9 Reverse -282 -291 10.7178 0.0863
NP_439966.1_9 Forward -295 -286 0.983037 0.253
NP_442941.1_3 Reverse -285 -295 10.9931 0.0116
NP_442941.1_3 Forward -292 -282 2.53664 0.14
NP_440289.1_2 Reverse -281 -294 12.9006 0.0132
NP_440289.1_2 Forward -296 -283 -4.50394 0.288
NP_440983.1_5 Forward -112 -93 -5.50708 0.266
NP_440260.1_8 Reverse -97 -115 11.7205 0.145
NP_442281.1_1 Reverse -279 -293 18.0918 0.00503
NP_442281.1_1 Forward -298 -284 13.6669 0.0249
NP_441334.1_7 Reverse -282 -301 -9.14533 0.12
NP_441334.1_7 Forward -295 -276 -20.5517 0.277
NP_440437.1_1 Reverse -143 -162 -4.32711 0.256
NP_442012.1_1 Forward -299 -280 11.7992 0.0735
NP_442012.1_1 Reverse -100 -119 -0.688862 0.265
NP_441457.1_4 Forward -393 -374 20.1573 0.0766
NP_441457.1_7 Forward -295 -276 22.3206 0.0236
NP_441457.1_8 Forward -370 -351 5.40766 0.238
NP_440375.1_6 Forward -40 -21 8.45592 0.239
NP_443030.1_4 Forward -255 -236 -5.50708 0.272
NP_442068.1_4 Reverse -121 -140 5.11187 0.275
NP_441644.1_6 Reverse -284 -294 19.0557 0.000803
NP_441644.1_6 Forward -293 -283 10.1076 0.0628
NP_441644.1_6 Reverse -100 -110 4.30615 0.242
NP_441644.1_6 Forward -115 -105 3.12618 0.297
NP_442215.1_2 Reverse -237 -253 0.943514 0.144
NP_442215.1_2 Reverse -92 -108 -0.0397962 0.159
NP_442215.1_2 Reverse -104 -120 -2.98973 0.207
NP_442215.1_2 Reverse -282 -298 -3.48138 0.216
NP_440253.1_2 Forward -293 -275 15.4571 0.0158
NP_440929.1_8 Forward -293 -284 19.2726 0.000701
NP_440929.1_8 Reverse -284 -293 19.2726 0.000701
NP_442933.1_10 Forward -293 -284 17.601 0.00325
NP_442933.1_10 Reverse -284 -293 17.601 0.00325
NP_441751.2_8 Reverse -285 -299 5.21113 0.0448
NP_442926.1_3 Forward -304 -285 6.68596 0.199
NP_442554.1_8 Reverse -285 -295 19.1546 0.00369
NP_442554.1_8 Forward -292 -282 16.008 0.0065
NP_441762.1_7 Forward -294 -282 12.527 0.0142
NP_441762.1_7 Reverse -283 -295 11.7404 0.0142
NP_442142.1_4 Forward -296 -283 15.4566 0.0264
NP_442142.1_4 Reverse -281 -294 14.4733 0.0311
NP_442142.1_4 Forward -106 -93 2.47701 0.29
NP_442292.1_1 Reverse -285 -294 17.5026 0.00435
NP_442292.1_1 Forward -292 -283 9.63616 0.0183
NP_442476.1_6 Forward -292 -278 4.71948 0.142
NP_442476.1_6 Reverse -285 -299 4.03116 0.151
NP_442381.1_8 Reverse -281 -300 -13.3736 0.271
NP_443009.1_5 Forward -294 -283 19.626 0.00102
NP_443009.1_5 Reverse -283 -294 7.82632 0.118
NP_441726.1_4 Reverse -75 -89 15.3392 0.281
NP_441715.1_4 Forward -292 -282 9.32148 0.097
NP_441715.1_4 Reverse -285 -295 7.25653 0.108
NP_441198.1_8 Forward -295 -285 15.4199 0.0427
NP_440379.1_5 Forward -302 -283 -2.0655 0.194
NP_441468.1_1 Forward -292 -285 15.8704 0.0124
NP_441468.1_1 Reverse -285 -292 15.8704 0.0124
NP_441020.2_6 Forward -295 -278 14.3952 0.0553
NP_441020.2_6 Reverse -282 -299 12.5269 0.0925
NP_441020.2_6 Forward -70 -53 6.03703 0.28
NP_441015.1_10 Forward -298 -279 4.03102 0.13
NP_441015.1_10 Reverse -101 -120 2.45773 0.15
NP_441015.1_10 Reverse -345 -364 -2.95047 0.184
NP_441015.1_10 Reverse -234 -253 -9.83364 0.282
NP_441673.1_1 Forward -293 -284 20.8459 0.000698
NP_441673.1_1 Reverse -284 -293 20.8459 0.000698
NP_441673.1_1 Forward -103 -94 -7.76842 0.168
NP_441673.1_1 Reverse -94 -103 -8.06341 0.254
NP_441244.1_1 Reverse -166 -184 13.9821 0.255
NP_442253.1_5 Reverse -103 -120 -7.23765 0.298
NP_441826.1_2 Reverse -278 -292 12.1926 0.0298
NP_441826.1_2 Forward -299 -285 -2.45868 0.271
NP_441330.1_1 Reverse -279 -298 -12.5869 0.183
NP_442490.1_9 Forward -305 -286 -8.16202 0.284
NP_442868.1_6 Forward -295 -285 8.63316 0.0555
NP_442868.1_6 Reverse -282 -292 8.53483 0.0555
NP_441251.1_8 Reverse -310 -323 17.8233 0.254
NP_442427.1_3 Forward -298 -280 5.03403 0.171
NP_441911.1_10 Reverse -43 -62 12.4153 0.21
NP_441911.1_10 Reverse -191 -210 6.92008 0.289
NP_442808.1_1 Reverse -283 -293 18.4657 0.00201
NP_442808.1_1 Forward -294 -284 8.73102 0.0481
NP_442808.1_1 Reverse -148 -158 6.86274 0.0941
NP_440145.1_3 Forward -303 -284 10.6192 0.04
NP_440145.1_3 Reverse -274 -293 1.17943 0.129
NP_442050.1_5 Forward -295 -285 17.1874 0.00812
NP_442050.1_5 Reverse -282 -292 8.23937 0.234
NP_442342.1_9 Reverse -282 -298 17.6598 0.0732
NP_442342.1_9 Reverse -104 -120 7.33503 0.207
NP_440346.1_7 Reverse -40 -59 5.80098 0.29
NP_441114.1_3 Forward -316 -307 7.86621 0.231
NP_440558.1_2 Forward -302 -283 -0.885524 0.205
NP_440162.1_2 Forward -57 -38 5.89931 0.282
NP_442789.1_4 Reverse -282 -301 -6.58872 0.286
NP_442789.1_4 Forward -117 -98 -8.06369 0.299
NP_441878.1_6 Forward -116 -106 10.7964 0.0176
NP_441878.1_6 Forward -294 -284 10.5014 0.0176
NP_441878.1_6 Reverse -283 -293 10.4031 0.0176
NP_441878.1_6 Forward -249 -239 0.865012 0.132
NP_441036.1_8 Reverse -283 -293 17.7779 0.000554
NP_441036.1_8 Forward -294 -284 15.713 0.00724
NP_442650.1_2 Reverse -284 -298 7.07942 0.13
NP_442503.1_5 Reverse -125 -144 10.4217 0.286
NP_441557.1_5 Forward -293 -284 19.9609 0.000699
NP_441557.1_5 Reverse -284 -293 19.9609 0.000699
NP_441445.1_1 Reverse -97 -116 2.55606 0.233
NP_441445.1_1 Forward -121 -102 -0.000545616 0.283
NP_442066.2_4 Forward -293 -274 -7.86702 0.289
NP_442066.2_4 Reverse -284 -303 -8.94866 0.296
NP_442066.2_9 Reverse -280 -293 8.47575 0.185
NP_442419.1_2 Forward -298 -279 2.3594 0.235
NP_442419.1_2 Reverse -279 -298 -3.04881 0.249
NP_441308.1_1 Reverse -161 -180 27.5321 0.000145
NP_441308.1_2 Reverse -210 -229 20.1573 0.12
NP_441308.1_8 Forward -295 -285 12.4681 0.218
NP_441308.1_8 Reverse -147 -157 12.1731 0.22
NP_441308.1_8 Reverse -282 -292 9.22315 0.226
NP_440101.1_3 Reverse -279 -298 0.982764 0.287
NP_440101.1_5 Forward -255 -236 5.80098 0.196
NP_440101.1_10 Reverse -278 -297 3.34271 0.24
NP_442183.1_1 Reverse -284 -298 15.4376 0.021
NP_442183.1_1 Forward -293 -279 9.63603 0.0954
NP_441116.1_6 Reverse -315 -334 7.17762 0.29
NP_441574.1_1 Reverse -94 -113 -6.98204 0.283
NP_441549.1_9 Reverse -280 -298 -7.35568 0.207
NP_442347.1_2 Forward -292 -283 11.1111 0.056
NP_442347.1_2 Reverse -150 -159 6.68623 0.156
NP_442347.1_2 Reverse -285 -294 3.34298 0.284
NP_442645.1_2 Reverse -276 -295 -21.0434 0.29
NP_441037.1_4 Forward -295 -285 16.5761 0.0168
NP_441037.1_4 Reverse -282 -292 16.2838 0.0168
NP_441633.1_3 Reverse -282 -295 5.91914 0.0481
NP_441633.1_3 Forward -295 -282 3.95252 0.0699
NP_441633.1_3 Reverse -147 -160 -6.17557 0.238
NP_440136.1_2 Forward -292 -285 15.9687 0.0123
NP_440136.1_2 Reverse -285 -292 15.9687 0.0123
NP_442998.1_10 Forward -291 -284 15.5754 0.0102
NP_442998.1_10 Reverse -286 -293 15.5754 0.0102
NP_440899.1_1 Forward -69 -50 6.74838 0.267
NP_440299.1_1 Forward -297 -284 12.7034 0.0356
NP_441799.1_1 Reverse -280 -294 10.0287 0.0797
NP_441799.1_1 Forward -297 -283 9.34041 0.0942
NP_441007.1_10 Forward -298 -285 13.0973 0.0499
NP_441007.1_10 Reverse -279 -292 3.5592 0.182
NP_440256.1_1 Forward -296 -277 2.85105 0.0589
NP_440256.1_1 Forward -339 -320 -10.0303 0.293
NP_441559.1_8 Forward -298 -284 1.27789 0.156
NP_441270.1_5 Forward -148 -129 11.0424 0.294
NP_440915.1_6 Reverse -280 -294 15.4376 0.0183
NP_440915.1_6 Forward -297 -283 13.3726 0.0187
NP_441296.1_9 Forward -34 -21 9.26181 0.282
NP_442452.1_8 Forward -299 -285 10.8154 0.3
NP_442866.1_1 Forward -134 -115 -8.26035 0.279
NP_441464.1_10 Forward -124 -110 7.47274 0.296
NP_440787.1_5 Reverse -4 -18 10.226 0.256
NP_441939.1_3 Forward -292 -273 5.99764 0.255
NP_441199.1_6 Reverse -280 -299 8.35759 0.106
NP_441494.1_6 Forward -298 -285 18.6038 0.059
NP_442993.1_1 Forward -293 -277 -7.90627 0.148
NP_442386.1_9 Reverse -283 -292 15.7322 0.0144
NP_442386.1_9 Forward -360 -351 8.75075 0.184
NP_442386.1_9 Forward -294 -285 6.39082 0.219
NP_441340.1_5 Forward -292 -285 15.6737 0.0124
NP_441340.1_5 Reverse -285 -292 15.6737 0.0124
NP_441271.1_1 Forward -299 -281 16.3413 0.202
NP_442240.1_2 Reverse -285 -304 -12.9802 0.163
NP_442240.1_2 Forward -292 -273 -14.0619 0.174
NP_442950.1_8 Reverse -55 -74 11.4058 0.252
NP_440586.1_1 Forward -119 -100 5.11266 0.189
NP_440586.1_8 Forward -292 -285 13.2151 0.026
NP_440586.1_8 Reverse -285 -292 13.2151 0.026
NP_442251.1_6 Forward -292 -285 15.2804 0.0124
NP_442251.1_6 Reverse -285 -292 15.2804 0.0124
NP_440192.1_4 Reverse -101 -120 9.49463 0.276
NP_441262.1_3 Reverse -284 -291 14.7888 0.0223
NP_441262.1_3 Forward -293 -286 14.7888 0.0223
NP_440027.1_3 Reverse -100 -118 2.77167 0.286
NP_443051.1_1 Forward -294 -285 19.5676 0.00335
NP_443051.1_1 Reverse -283 -292 10.4228 0.00754
NP_439937.1_8 Reverse -282 -301 7.37428 0.191
NP_439937.1_9 Reverse -283 -300 1.11978 0.0948
NP_441595.1_2 Forward -19 -6 16.3909 0.277
NP_443039.1_7 Forward -35 -21 15.1419 0.0927
NP_440408.1_3 Reverse -97 -116 -3.63879 0.258
NP_440408.1_10 Forward -299 -280 12.3892 0.167
NP_440439.1_1 Forward -296 -283 17.5222 0.0105
NP_440439.1_1 Reverse -281 -294 9.36073 0.0465
NP_440439.1_1 Forward -161 -148 -0.0790467 0.207
NP_440372.1_2 Forward -292 -285 16.3621 0.0124
NP_440372.1_2 Reverse -285 -292 16.3621 0.0124
NP_442285.1_1 Reverse -234 -253 3.44104 0.287
NP_441803.1_2 Forward -298 -279 17.2074 0.0309
NP_441803.1_2 Forward -108 -89 8.65258 0.112
NP_441803.1_2 Reverse -101 -120 1.27776 0.235
NP_439977.1_5 Forward -299 -280 6.68596 0.128
NP_439977.1_5 Reverse -233 -252 4.81767 0.15
NP_439977.1_5 Reverse -100 -119 4.71934 0.152
NP_439977.1_5 Reverse -278 -297 3.53937 0.159
NP_441572.1_1 Forward -338 -319 0.392778 0.212
NP_441572.1_7 Reverse -97 -116 -1.37718 0.188
NP_440267.1_2 Forward -35 -21 4.71887 0.296
NP_442666.1_4 Reverse -310 -329 16.7939 0.275
NP_442384.1_10 Reverse -284 -297 9.36073 0.054
NP_442114.1_4 Forward -293 -282 12.1534 0.107
NP_441877.1_5 Forward -214 -195 8.45592 0.155
NP_441877.1_7 Reverse -279 -298 -0.689632 0.295
NP_441018.1_7 Forward -57 -38 7.66927 0.268
NP_442262.1_10 Forward -292 -285 14.1988 0.0123
NP_442262.1_10 Reverse -285 -292 14.1988 0.0123
NP_441689.1_5 Forward -295 -285 8.43603 0.132
NP_440344.1_10 Forward -300 -283 9.38028 0.00838
NP_440282.1_10 Reverse -102 -121 -1.47551 0.221
NP_441335.1_7 Reverse -338 -357 17.3057 0.181
NP_441965.1_10 Reverse -281 -297 2.8118 0.282
NP_440297.1_9 Forward -292 -282 -0.216628 0.282
NP_440297.1_9 Reverse -285 -295 -0.314959 0.282
NP_442280.1_10 Forward -321 -303 12.1751 0.188
NP_442280.1_10 Reverse -96 -114 9.54524 0.232
NP_441592.1_4 Reverse -100 -119 2.3594 0.199
NP_441896.1_3 Reverse -275 -294 1.0811 0.222
NP_440894.1_10 Reverse -279 -298 11.5042 0.144
NP_441679.1_1 Reverse -352 -371 -1.47551 0.211
NP_440999.1_9 Reverse -280 -294 11.6026 0.0438
NP_440999.1_9 Forward -297 -283 3.93283 0.12
NP_440999.1_9 Reverse -102 -116 1.17956 0.169
NP_440888.1_2 Forward -293 -279 18.2885 0.00261
NP_440888.1_2 Reverse -284 -298 15.9285 0.00837
NP_442948.1_2 Reverse -283 -302 10.6192 0.144
NP_442033.1_10 Reverse -282 -301 0.294447 0.108
NP_441543.1_2 Forward -292 -283 18.486 0.00236
NP_441543.1_2 Reverse -285 -294 15.9293 0.00518
NP_442845.1_2 Forward -299 -285 13.6676 0.0934
NP_442845.1_2 Reverse -296 -310 6.98109 0.199
NP_442845.1_2 Reverse -344 -358 4.22782 0.264
NP_441551.1_5 Reverse -280 -296 9.39927 0.21
NP_442710.1_6 Forward -194 -175 7.37428 0.204
NP_441469.1_8 Reverse -283 -292 16.126 0.00797
NP_441469.1_8 Forward -294 -285 6.5879 0.227
NP_443064.1_6 Reverse -284 -294 10.8217 0.13
NP_442578.1_7 Forward -292 -285 14.5921 0.026
NP_442578.1_7 Reverse -285 -292 14.5921 0.026
NP_441462.1_2 Reverse -284 -294 20.2362 0.000805
NP_441462.1_2 Forward -293 -283 11.5831 0.00406
NP_441621.1_7 Reverse -282 -296 23.7957 0.00827
NP_441621.1_7 Forward -295 -281 6.48943 0.068
NP_441621.1_7 Forward -114 -100 -3.44199 0.188
NP_441929.1_2 Reverse -261 -280 12.9791 0.216
NP_443062.1_1 Forward -293 -275 8.64343 0.15
NP_443062.1_1 Reverse -284 -302 4.64563 0.255
NP_440519.1_6 Forward -323 -309 10.4227 0.29
NP_442204.1_1 Forward -297 -286 11.9567 0.0565
NP_442204.1_2 Reverse -152 -171 7.66927 0.272
NP_441560.1_8 Forward -298 -279 18.1351 0.033
NP_441351.1_8 Forward -105 -86 0.982764 0.276
NP_440516.1_8 Forward -293 -284 16.9127 0.00442
NP_440516.1_8 Reverse -284 -293 16.9127 0.00442
NP_442080.1_7 Reverse -89 -108 -5.01543 0.296
NP_442428.1_5 Forward -292 -285 15.8704 0.0124
NP_442428.1_5 Reverse -285 -292 15.8704 0.0124
NP_442120.1_10 Reverse -278 -297 -6.98204 0.217
NP_440673.1_3 Forward -291 -284 12.4288 0.0426
NP_440673.1_3 Reverse -286 -293 12.4288 0.0426
NP_440865.1_9 Forward -299 -280 -3.14714 0.191
NP_440865.1_9 Reverse -278 -297 -5.60541 0.215
NP_441052.1_2 Forward -293 -283 10.5014 0.0285
NP_441052.1_2 Reverse -284 -294 10.4031 0.0285
NP_441052.1_2 Forward -115 -105 4.20827 0.163
NP_442219.1_8 Reverse -96 -115 13.2887 0.153
NP_442219.1_9 Forward -292 -283 8.35786 0.0681
NP_442219.1_9 Reverse -285 -294 8.25953 0.0681
NP_440436.1_4 Forward -292 -283 18.1905 0.00233
NP_440436.1_4 Reverse -285 -294 9.24241 0.0871
NP_441884.1_8 Reverse -283 -302 -10.522 0.268
NP_441884.1_9 Reverse -281 -300 -12.7836 0.138
NP_441884.1_9 Forward -118 -99 -20.7484 0.205
NP_440314.1_9 Reverse -113 -132 -1.57384 0.135
NP_441719.1_4 Forward -292 -285 16.3621 0.0124
NP_441719.1_4 Reverse -285 -292 16.3621 0.0124
NP_441733.1_10 Forward -296 -283 15.6539 0.0564
NP_441733.1_10 Reverse -281 -294 10.5407 0.106
NP_441004.1_1 Forward -121 -102 -2.16383 0.14
NP_441004.1_1 Reverse -88 -107 -14.9469 0.271
NP_442366.1_3 Reverse -283 -301 6.70565 0.0773
NP_441115.1_4 Reverse -283 -301 10.7364 0.168
NP_442206.1_10 Reverse -284 -299 2.73316 0.198
NP_440328.1_4 Reverse -278 -297 7.27595 0.124
NP_443054.1_2 Forward -295 -281 12.586 0.0722
NP_442430.1_4 Reverse -282 -301 17.699 0.137
NP_442308.1_4 Reverse -100 -119 3.04771 0.267
NP_441851.1_10 Reverse -283 -293 16.008 0.00552
NP_441851.1_10 Forward -294 -284 8.53483 0.114
NP_442622.1_5 Reverse -282 -301 -3.04881 0.171
NP_442011.1_1 Forward -399 -380 -2.45882 0.273
NP_441668.1_4 Reverse -11 -30 2.0644 0.205
NP_441668.1_4 Reverse -12 -31 -0.197208 0.249
NP_442515.1_1 Forward -294 -280 -3.34366 0.29
NP_441396.1_5 Forward -137 -128 8.75118 0.21
NP_440593.1_3 Forward -120 -101 9.14423 0.107
NP_440593.1_3 Reverse -279 -298 1.37609 0.19
NP_440593.1_3 Reverse -101 -120 -1.08219 0.211
NP_441349.1_10 Forward -303 -284 -0.787193 0.0964
NP_441051.1_3 Reverse -99 -118 17.404 0.293
NP_441409.1_6 Forward -299 -280 0.58944 0.0648
NP_440432.1_9 Forward -292 -277 14.9262 0.0135
NP_442843.1_1 Forward -74 -55 -9.047 0.264
NP_440474.1_8 Forward -292 -278 10.3237 0.14
NP_440588.1_2 Forward -302 -283 14.3558 0.0168
NP_440588.1_2 Forward -118 -99 -5.01543 0.236
NP_439950.1_1 Forward -131 -122 14.4544 0.224
NP_441570.1_1 Forward -115 -97 -12.1739 0.209
NP_441078.1_4 Forward -293 -284 19.6659 0.0007
NP_441078.1_4 Reverse -284 -293 19.6659 0.0007
NP_441078.1_4 Forward -115 -106 -1.6719 0.266
NP_442729.1_5 Reverse -308 -318 9.32148 0.235
NP_440526.1_3 Forward -292 -281 11.7595 0.0646
NP_440526.1_3 Reverse -285 -296 9.3996 0.0876
NP_441432.1_8 Forward -294 -285 16.8143 0.00595
NP_441432.1_8 Reverse -283 -292 8.25953 0.0755
NP_441432.1_9 Forward -60 -47 13.0584 0.188
NP_443024.1_2 Reverse -119 -132 17.9149 0.156
NP_443024.1_2 Reverse -120 -133 16.0466 0.21
NP_442320.1_8 Reverse -278 -292 14.5526 0.0132
NP_442320.1_8 Forward -299 -285 8.55439 0.0184
NP_442344.1_7 Forward -292 -273 -5.99873 0.17
NP_441732.1_2 Forward -297 -281 3.30346 0.0141
NP_442447.1_1 Reverse -195 -214 4.62101 0.271
NP_440760.1_1 Reverse -106 -125 -5.01543 0.0475
NP_440760.1_1 Reverse -284 -303 -13.2752 0.1
NP_440760.1_1 Forward -293 -274 -20.945 0.226
NP_441057.1_3 Forward -336 -317 -13.3736 0.283
NP_440913.1_1 Forward -295 -277 6.01734 0.231
NP_440713.1_4 Forward -303 -284 6.19431 0.195
NP_440713.1_4 Reverse -96 -115 0.884433 0.3
NP_442489.1_2 Reverse -89 -108 4.12936 0.224
NP_442489.1_7 Forward -293 -284 20.1576 0.000695
NP_442489.1_7 Reverse -284 -293 20.1576 0.000695
NP_442489.1_7 Forward -115 -106 -1.37691 0.195
NP_442079.1_7 Reverse -285 -304 2.85105 0.222
NP_440559.1_1 Forward -292 -283 8.75118 0.0586
NP_440559.1_1 Reverse -285 -294 8.65285 0.0586
NP_441659.2_8 Reverse -284 -294 20.9245 0.000805
NP_441659.2_8 Forward -293 -283 11.9764 0.0147
NP_440363.1_9 Reverse -98 -116 13.2938 0.254
NP_442913.1_10 Reverse -275 -294 9.3409 0.0455
NP_441040.1_2 Reverse -92 -111 -15.2418 0.286
NP_440442.1_3 Reverse -99 -113 14.2576 0.287
NP_441800.1_3 Forward -120 -102 9.0656 0.286
NP_440779.1_5 Forward -293 -276 -14.5141 0.246
NP_442346.1_5 Forward -294 -284 16.303 0.00248
NP_442346.1_5 Reverse -283 -293 9.02648 0.118
NP_442346.1_5 Forward -116 -106 4.3066 0.291
NP_440545.1_3 Reverse -280 -297 9.38028 0.04
NP_440545.1_3 Forward -297 -280 8.59364 0.0438
NP_440545.1_5 Forward -126 -109 5.25038 0.241
NP_441856.1_5 Reverse -236 -255 14.8466 0.276
NP_440025.1_2 Forward -35 -18 19.5076 0.238
NP_440831.1_3 Reverse -97 -116 11.8235 0.155
NP_440459.1_2 Reverse -300 -317 14.0018 0.119
NP_440010.1_4 Reverse -96 -115 -1.67294 0.267
NP_442551.1_4 Reverse -237 -252 4.89645 0.242
NP_442551.1_4 Reverse -104 -119 -1.49507 0.246
NP_442551.1_4 Forward -118 -103 -1.88839 0.25
NP_440449.1_6 Forward -301 -283 6.89415 0.239
NP_441948.1_4 Reverse -277 -295 -3.22577 0.189
NP_439970.1_3 Reverse -101 -120 6.88262 0.239
NP_441833.1_4 Forward -292 -285 15.9687 0.0124
NP_441833.1_4 Reverse -285 -292 15.9687 0.0124
NP_440541.1_6 Forward -117 -98 17.699 0.209
NP_442162.1_9 Forward -292 -285 16.2637 0.0124
NP_442162.1_9 Reverse -285 -292 16.2637 0.0124
NP_440671.1_4 Forward -299 -285 9.83269 0.17
NP_440671.1_4 Reverse -278 -292 5.40779 0.283
NP_440772.1_7 Reverse -9 -28 10.9142 0.216
NP_442073.1_6 Forward -302 -283 8.75091 0.193
NP_442199.1_5 Forward -301 -282 7.27595 0.0719
NP_442140.1_3 Forward -292 -282 17.4829 0.0159
NP_442140.1_3 Reverse -285 -295 7.94484 0.124
NP_440875.1_9 Forward -291 -281 17.619 0.0104
NP_440875.1_9 Reverse -286 -296 17.5217 0.0116
NP_442547.1_7 Reverse -11 -30 10.2223 0.279
NP_441813.1_5 Reverse -282 -292 10.0098 0.0208
NP_441813.1_5 Forward -295 -285 8.73149 0.0367
NP_440590.1_4 Forward -292 -279 11.9173 0.0173
NP_440590.1_4 Reverse -285 -298 4.44418 0.0601
NP_440590.1_4 Reverse -303 -316 -3.4223 0.255
NP_440567.1_1 Reverse -285 -299 18.8791 0.0136
NP_440567.1_1 Forward -292 -278 3.34284 0.145
NP_442497.1_1 Reverse -55 -74 8.4551 0.275
NP_442497.1_10 Reverse -285 -294 17.601 0.00813
NP_442497.1_10 Forward -292 -283 10.4228 0.0087
NP_440821.1_4 Reverse -282 -292 18.7612 0.00422
NP_440821.1_4 Forward -295 -285 10.7964 0.0146
NP_441239.1_9 Forward -295 -283 17.4436 0.0146
NP_441239.1_9 Reverse -282 -294 16.0669 0.0175
NP_440542.1_2 Forward -79 -62 13.0185 0.245
NP_442691.1_2 Reverse -49 -68 3.93269 0.283
NP_441727.1_3 Forward -300 -281 6.58763 0.244
NP_441892.1_1 Reverse -97 -114 -3.30441 0.237
NP_441892.1_1 Reverse -275 -292 -4.87771 0.269
NP_441892.1_1 Forward -302 -285 -5.76269 0.288
NP_442399.1_3 Forward -28 -9 9.88382 0.252
NP_440604.1_6 Reverse -284 -303 0.58944 0.166
NP_442044.1_1 Forward -298 -279 -10.817 0.271
NP_442270.1_9 Forward -120 -101 -10.9153 0.265
NP_441017.1_6 Forward -258 -244 11.602 0.255
NP_440546.1_4 Reverse -284 -294 13.5365 0.0459
NP_440546.1_4 Forward -293 -283 11.8882 0.0679
NP_440546.1_6 Forward -303 -284 8.84924 0.253
NP_441230.1_5 Reverse -279 -298 15.2408 0.0583
NP_440462.1_6 Forward -295 -285 19.4496 0.00371
NP_440462.1_6 Reverse -282 -292 17.9746 0.00578
NP_442340.1_3 Reverse -102 -121 -6.1954 0.223
NP_442611.1_1 Reverse -284 -303 1.37609 0.238
NP_440868.1_4 Reverse -280 -292 9.77374 0.043
NP_440868.1_4 Forward -297 -285 7.4138 0.0691
NP_442499.1_3 Reverse -283 -301 6.70565 0.282
NP_442402.1_4 Forward -362 -343 -5.60616 0.245
NP_441848.1_4 Reverse -250 -266 9.36501 0.285
NP_441848.1_9 Reverse -128 -139 11.2679 0.268
NP_441084.1_6 Forward -295 -281 11.2833 0.208
NP_440843.1_3 Reverse -77 -96 12.7825 0.187
NP_442039.1_4 Forward -292 -285 15.1821 0.0124
NP_442039.1_4 Reverse -285 -292 15.1821 0.0124
NP_442837.1_3 Forward -292 -285 15.7721 0.0124
NP_442837.1_3 Reverse -285 -292 15.7721 0.0124
NP_442053.1_1 Forward -293 -284 18.3876 0.0007
NP_442053.1_1 Reverse -284 -293 18.3876 0.0007
NP_440505.1_3 Forward -295 -285 15.418 0.0114
NP_440505.1_3 Reverse -282 -292 14.1397 0.0235
NP_442532.1_7 Reverse -284 -298 6.98109 0.171
NP_441408.2_7 Reverse -267 -286 -4.03212 0.279
NP_440914.1_1 Reverse -284 -294 16.3248 0.00196
NP_440914.1_1 Forward -293 -283 8.6151 0.186
NP_441011.1_8 Forward -292 -283 16.9127 0.00602
NP_441011.1_8 Reverse -285 -294 16.6177 0.00602
NP_440068.1_1 Forward -138 -119 1.37609 0.238
NP_442533.1_6 Forward -293 -284 17.2076 0.00137
NP_442533.1_6 Reverse -284 -293 17.2076 0.00137
NP_442533.1_6 Forward -103 -94 9.34117 0.0634
NP_442533.1_6 Reverse -106 -115 5.01461 0.16
NP_442533.1_6 Forward -115 -106 4.32629 0.184
NP_442533.1_6 Reverse -149 -158 3.7363 0.204
NP_442533.1_6 Reverse -239 -248 2.55633 0.25
NP_442533.1_6 Forward -311 -302 2.06468 0.275
NP_442533.1_6 Reverse -113 -122 1.57302 0.294
NP_440263.1_3 Reverse -291 -310 2.3594 0.289
NP_442232.1_3 Forward -301 -282 3.44104 0.0917
NP_442232.1_3 Forward -118 -99 -15.2418 0.289
NP_442322.1_4 Reverse -146 -163 -9.30325 0.29
NP_442229.1_1 Forward -295 -281 8.94708 0.184
NP_441482.1_7 Forward -299 -285 8.55439 0.0162
NP_439944.1_9 Reverse -285 -295 17.7779 0.00341
NP_439944.1_9 Forward -292 -282 10.4031 0.0887
NP_440816.1_2 Reverse -307 -326 7.49989 0.262
NP_441527.1_4 Reverse -360 -379 -11.1252 0.278
NP_441527.1_4 Reverse -310 -329 -13.0351 0.298
NP_440115.1_6 Forward -296 -286 16.9913 0.0288
NP_440115.1_6 Forward -161 -151 5.68323 0.227
NP_439965.1_1 Forward -302 -283 -2.85214 0.177
NP_441347.1_5 Forward -299 -285 10.9137 0.269
NP_441602.1_3 Forward -298 -279 0.392778 0.217
NP_441602.1_3 Reverse -279 -298 -1.96717 0.231
NP_441972.1_5 Forward -114 -95 15.8307 0.0274
NP_441972.1_5 Reverse -285 -304 -6.1954 0.229
NP_441106.1_1 Forward -294 -285 18.486 0.0028
NP_441106.1_1 Reverse -283 -292 18.191 0.0028
NP_439903.1_6 Reverse -103 -122 0.981987 0.255
NP_442306.1_10 Forward -298 -279 -19.3717 0.197
NP_441286.1_1 Forward -294 -282 5.34885 0.0259
NP_441286.1_1 Reverse -283 -295 5.15219 0.0259
NP_440670.1_8 Forward -293 -284 18.3876 0.000699
NP_440670.1_8 Reverse -284 -293 18.3876 0.000699
NP_440886.1_7 Reverse -283 -293 17.7774 0.0011
NP_440886.1_7 Forward -294 -284 8.04271 0.0805
NP_440886.1_7 Reverse -148 -158 4.01116 0.255
NP_440886.1_7 Forward -113 -103 3.8145 0.265
NP_442072.1_9 Forward -294 -276 5.52568 0.0162
NP_442072.1_9 Reverse -283 -301 -22.1053 0.22
NP_440907.2_8 Reverse -285 -295 19.1541 0.00362
NP_440907.2_8 Forward -292 -282 17.4824 0.00685
NP_440907.2_8 Reverse -150 -160 7.0594 0.132
NP_441021.1_1 Reverse -101 -120 0.0977854 0.0939
NP_440193.1_1 Reverse -282 -301 15.5439 0.202
NP_441463.1_3 Reverse -96 -115 -9.24366 0.278
NP_441626.1_2 Forward -292 -285 15.7721 0.0124
NP_441626.1_2 Reverse -285 -292 15.7721 0.0124
NP_442794.1_1 Forward -297 -285 3.57889 0.286
NP_442615.1_1 Forward -302 -284 16.1454 0.00869
NP_442615.1_1 Reverse -275 -293 -6.4707 0.248
NP_441962.1_4 Forward -298 -279 2.65439 0.102
NP_441742.1_7 Forward -119 -100 12.1925 0.295
NP_440387.1_1 Reverse -284 -300 7.2367 0.0282
NP_440387.1_1 Forward -293 -277 -2.20308 0.147
NP_440855.1_5 Forward -111 -92 5.30853 0.285
NP_440855.1_5 Reverse -282 -301 2.45694 0.291
NP_440855.1_5 Reverse -98 -117 1.76863 0.295
NP_441431.1_2 Reverse -281 -295 15.0436 0.0537
NP_441431.1_2 Forward -296 -282 13.7653 0.0806
NP_441431.1_3 Forward -396 -377 2.26107 0.289
NP_441836.1_2 Reverse -94 -113 0.884433 0.197
NP_441993.1_1 Forward -299 -280 13.4467 0.0855
NP_441993.1_1 Forward -121 -102 7.01447 0.176
NP_441993.1_1 Reverse -278 -297 1.4594 0.276
NP_441174.1_2 Forward -296 -282 21.4357 0.00137
NP_440114.1_10 Forward -293 -279 15.3392 0.0264
NP_442698.1_10 Reverse -337 -356 1.0811 0.297
NP_440287.1_6 Forward -295 -276 7.07928 0.16
NP_440766.1_4 Forward -297 -283 16.4209 0.0256
NP_440458.1_10 Reverse -365 -383 16.4404 0.243
NP_439910.1_2 Reverse -276 -293 -3.79607 0.0691
NP_439910.1_2 Reverse -319 -336 -14.2191 0.183
NP_442867.1_8 Forward -349 -330 8.65258 0.231
NP_440457.1_1 Forward -297 -285 6.72548 0.113
NP_440457.1_1 Forward -162 -150 0.0389777 0.25
NP_440798.1_6 Forward -292 -279 12.3107 0.0468
NP_442680.1_5 Reverse -305 -324 0.169919 0.268
NP_440801.1_8 Reverse -326 -345 23.5006 0.027
NP_440142.1_9 Forward -57 -43 21.4351 0.076
NP_442509.1_4 Reverse -100 -119 14.9458 0.237
NP_442509.1_9 Forward -293 -283 16.2041 0.00739
NP_442509.1_9 Reverse -149 -159 13.8442 0.0448
NP_442509.1_9 Reverse -58 -68 10.6976 0.163
NP_442509.1_9 Reverse -284 -294 8.04271 0.192
NP_440660.1_4 Reverse -66 -85 12.7825 0.273
NP_440554.1_4 Reverse -285 -295 15.418 0.0199
NP_440554.1_4 Forward -292 -282 13.943 0.0218
NP_441885.1_5 Forward -293 -283 11.4848 0.00668
NP_441885.1_5 Reverse -284 -294 11.3864 0.00668
NP_440478.1_10 Reverse -98 -112 7.86607 0.257
NP_442341.1_7 Reverse -283 -297 10.816 0.0596
NP_442341.1_7 Forward -294 -280 3.8345 0.21
NP_442341.1_7 Forward -159 -145 1.17956 0.297
NP_442395.2_4 Reverse -283 -302 19.2715 0.0197
NP_440409.1_1 Reverse -276 -295 -0.39387 0.216
NP_443000.1_7 Forward -295 -285 10.7964 0.0345
NP_443000.1_7 Reverse -282 -292 2.04498 0.226
NP_440507.2_3 Forward -302 -283 9.24175 0.227
NP_441842.1_10 Forward -300 -286 11.3077 0.134
NP_440275.1_3 Forward -295 -285 18.6629 0.0082
NP_440275.1_3 Reverse -282 -292 17.9746 0.0082
NP_440091.1_1 Reverse -280 -292 20.1968 0.00953
NP_442451.1_2 Reverse -276 -295 0.0977854 0.153
NP_439951.1_3 Reverse -10 -27 12.9202 0.172
NP_439962.1_4 Reverse -95 -114 -4.42544 0.269
NP_439962.1_4 Forward -301 -282 -6.58872 0.283
NP_441105.1_3 Forward -304 -285 21.5339 0.00539
NP_441105.1_3 Forward -126 -107 -3.73712 0.185
NP_440216.1_1 Forward -293 -279 16.1259 0.00307
NP_440216.1_1 Reverse -284 -298 -2.55701 0.0521
NP_440172.1_1 Reverse -284 -294 17.5813 0.00421
NP_440172.1_1 Forward -293 -283 8.73149 0.0586
NP_440172.1_6 Forward -305 -286 10.1275 0.259
NP_440167.1_3 Reverse -96 -115 13.5691 0.182
NP_442015.1_10 Forward -297 -284 4.54251 0.167
NP_442015.1_10 Reverse -158 -171 -0.472371 0.268
NP_441226.1_7 Forward -292 -285 14.4934 0.0123
NP_441226.1_7 Reverse -285 -292 14.4934 0.0123
NP_442446.1_3 Forward -305 -286 14.1591 0.222
NP_441111.1_7 Forward -292 -284 18.7023 0.00294
NP_441111.1_7 Reverse -285 -293 18.7023 0.00294
NP_442379.1_10 Reverse -277 -294 -0.846137 0.223
NP_441766.1_2 Forward -293 -284 17.5026 0.00297
NP_441766.1_2 Reverse -284 -293 17.5026 0.00297
NP_440416.1_1 Forward -293 -274 -14.1602 0.284
NP_440416.1_9 Forward -300 -281 -13.2752 0.164
NP_440416.1_9 Forward -117 -98 -18.2901 0.256
NP_443052.1_8 Reverse -274 -293 13.2741 0.0119
NP_443052.1_8 Reverse -317 -336 -12.3902 0.254
NP_440261.1_5 Forward -292 -279 -1.16069 0.0662
NP_440261.1_5 Reverse -285 -298 -1.16069 0.0662
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATGACGATGCGGCCCCGCATGTGGATTTTATTCATCCGTTCCCGCATGGCTTCTACGGCTACTTGGTCAGCGGTGTTTTTTTCACCTTTGCCCATCCATTTTGCCGAGGCGATCGCCGCTTGTTCTACGACTTCAATAATTTCTAAACCGAGGGTGCTGTCCACGAATTGAATCCTCCCAACTGCTGATTAGGTTTCCCTAGCTTGTGATTAAGTGTTAATAGTCAAAAGTCTATCAGAGGGGGGGATCAGCGTACAGCATTGTTGAGGGGGGTAATTAGGCTTGGGCGCTGACCACGGCGGGCACCAAAGATCCTCTAAGATTAAGAGTTGGGCGGATTATCTGCCTGCTTTTTGACTGCGTTGAACCATTCCACTGCCAAATTCAGCTAATTTTGACC

CDS

ATGACTGAGTCCGTAATCTCCCCAGAAGATGCCTTCAACCAGGCGATCGCCAGATATAACGGGGGGGAAGGCCCCGAAACCCTGATCCCGGTGTTTAAGGACATTGCCGATAGCTCCCCGAAAAATGCGACGGTGTGGGCTTGCCTAGCTTGGCTGTATCTCCTGGACGACAAGCCAACTTTGGCCTTCAAAGCGGCCCAAAGGTCGGTGAAAATTGACGGTTATCATCCCCAGGCAAGGATTAACTATGCCTTGGCCATGTTGGCTAATAAAAAAACCGGTGTACGGGAACAGGTGGAGTTAGCGGCGCAAATGATGTCCTTTGATCAGGAAATCGCTGCGGGAGTGATGGAAAGTTTGGATGATGGTCTCGAGCGTAAGCCCGATTGGCGAGACATTGAACGGATTAAGAAATGGCTGACAGAATAG

Protein

MTESVISPEDAFNQAIARYNGGEGPETLIPVFKDIADSSPKNATVWACLAWLYLLDDKPTLAFKAAQRSVKIDGYHPQARINYALAMLANKKTGVREQVELAAQMMSFDQEIAAGVMESLDDGLERKPDWRDIERIKKWLTE