Your browser is old and dusty. Try Google Chrome!

Details for sll1967

ORF sll1967
Accession NP_440725.1
Symbol
Category Ribosomal proteins: synthesis and modification
Definition probable RNA methyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Reverse -135 -154 -29.2048 0.219
NP_442657.1_5 Forward -260 -246 16.6161 0.248
NP_441818.1_9 Reverse -139 -158 -10.4236 0.293
NP_441465.1_2 Reverse -229 -248 17.327 0.244
NP_441976.1_1 Forward -156 -137 14.1591 0.135
NP_442655.1_10 Forward -381 -362 -19.8634 0.292
NP_442861.1_4 Reverse -348 -367 0.490334 0.297
NP_440061.1_9 Reverse -357 -371 9.53707 0.143
NP_442972.1_1 Reverse -70 -88 8.05852 0.287
NP_440304.1_4 Forward -210 -200 5.09324 0.229
NP_442434.1_2 Reverse -298 -316 17.5221 0.164
NP_440893.1_3 Reverse -358 -377 3.63691 0.264
NP_441925.1_1 Reverse -83 -97 18.4851 0.293
NP_440856.1_4 Reverse -192 -211 5.99764 0.0783
NP_441738.1_2 Forward -332 -325 8.29857 0.176
NP_441955.1_8 Forward -150 -133 7.02034 0.281
NP_440056.1_9 Forward -308 -289 14.0678 0.272
NP_441713.1_1 Forward -384 -365 -16.4218 0.283
NP_441716.1_1 Reverse -359 -373 3.24451 0.272
NP_441716.1_2 Forward -85 -66 -1.81236 0.289
NP_441327.1_1 Reverse -2 -21 2.86785 0.279
NP_441163.1_1 Forward -293 -276 5.54465 0.273
NP_440747.1_10 Reverse -196 -208 -12.2524 0.254
NP_441847.1_2 Forward -168 -149 8.35759 0.208
NP_441667.1_1 Reverse -81 -96 16.5042 0.231
NP_441014.1_5 Reverse -285 -303 12.0155 0.254
NP_441014.1_5 Forward -296 -278 11.4255 0.258
NP_442848.1_5 Reverse -287 -305 -3.22577 0.29
NP_440376.1_1 Forward -208 -199 2.55633 0.218
NP_442730.1_8 Reverse -268 -287 6.1935 0.228
NP_442687.1_7 Forward -209 -199 6.76487 0.154
NP_442687.1_7 Forward -379 -369 4.89658 0.23
NP_442687.1_7 Reverse -288 -298 3.91327 0.278
NP_441077.1_6 Reverse -77 -93 3.76594 0.265
NP_440642.1_1 Forward -291 -272 7.57094 0.266
NP_440642.1_10 Forward -106 -92 4.03056 0.263
NP_441422.1_7 Reverse -367 -384 -5.1727 0.247
NP_440533.1_6 Forward -296 -277 9.53756 0.276
NP_441950.1_7 Reverse -142 -161 -8.45701 0.287
NP_442782.1_2 Reverse -289 -303 4.22782 0.256
NP_442782.1_2 Forward -303 -289 2.16287 0.277
NP_442782.1_2 Forward -246 -232 0.687908 0.286
NP_442496.1_5 Reverse -305 -323 6.11567 0.285
NP_440656.1_8 Forward -354 -335 -8.55534 0.273
NP_442544.1_2 Forward -311 -297 -1.27871 0.272
NP_441958.1_5 Forward -209 -199 -1.29827 0.236
NP_441958.1_5 Forward -379 -369 -1.88825 0.26
NP_442690.1_1 Forward -89 -70 -12.5869 0.245
NP_442911.1_2 Forward -205 -186 -9.83364 0.264
NP_441591.1_10 Forward -380 -361 4.12936 0.297
NP_440827.1_3 Reverse -284 -303 14.4541 0.201
NP_440827.1_3 Forward -297 -278 13.3725 0.226
NP_442002.1_9 Forward -209 -202 11.3472 0.185
NP_442598.1_1 Reverse -76 -90 19.1741 0.0753
NP_441646.1_1 Reverse -352 -371 0.392778 0.251
NP_441646.1_1 Forward -202 -183 -1.67217 0.293
NP_441473.1_4 Forward -185 -171 19.7641 0.119
NP_441916.1_10 Reverse -287 -306 5.70265 0.208
NP_440345.1_3 Forward -85 -71 11.5661 0.247
NP_441041.1_7 Forward -337 -325 6.05711 0.226
NP_441725.1_5 Reverse -200 -210 0.0783647 0.215
NP_440983.1_5 Forward -156 -137 2.0644 0.199
NP_440983.1_5 Reverse -277 -296 -5.01543 0.261
NP_440260.1_8 Reverse -340 -358 -2.3408 0.243
NP_441678.1_9 Forward -304 -285 10.6192 0.17
NP_442281.1_1 Reverse -194 -208 3.34225 0.235
NP_442281.1_1 Forward -149 -135 2.16228 0.276
NP_442575.1_8 Reverse -306 -325 -6.29373 0.278
NP_442500.1_8 Forward -360 -346 9.21432 0.285
NP_441644.1_6 Reverse -369 -379 9.22267 0.0819
NP_442215.1_2 Forward -294 -278 1.73016 0.128
NP_442215.1_2 Reverse -274 -290 -0.236458 0.164
NP_442554.1_8 Forward -297 -287 2.53664 0.268
NP_442142.1_4 Forward -192 -179 7.88518 0.127
NP_442142.1_4 Forward -151 -138 3.85363 0.243
NP_443009.1_5 Forward -379 -368 4.18809 0.259
NP_442406.1_9 Reverse -311 -330 -0.197208 0.291
NP_441015.1_10 Forward -297 -278 -2.36049 0.178
NP_441015.1_10 Forward -373 -354 -10.3253 0.284
NP_441637.1_9 Reverse -179 -197 -0.7675 0.292
NP_441764.1_8 Forward -176 -166 11.7892 0.284
NP_442427.1_8 Forward -217 -198 8.65258 0.196
NP_441911.1_10 Forward -364 -345 9.52306 0.231
NP_440630.1_5 Forward -121 -102 11.7008 0.108
NP_440558.1_2 Forward -301 -282 -4.72043 0.248
NP_442792.1_5 Reverse -290 -307 10.4619 0.285
NP_441878.1_6 Forward -299 -289 1.55333 0.0937
NP_441878.1_6 Reverse -288 -298 0.963343 0.128
NP_441878.1_6 Forward -209 -199 -6.90313 0.198
NP_441878.1_6 Reverse -276 -286 -7.68978 0.255
NP_441739.1_2 Reverse -117 -133 5.95771 0.227
NP_440101.1_10 Reverse -283 -302 3.73603 0.236
NP_441458.1_8 Forward -98 -79 3.34933 0.273
NP_442166.1_7 Reverse -54 -68 16.1259 0.142
NP_442464.1_7 Forward -321 -302 19.9606 0.0527
NP_442594.1_8 Reverse -309 -328 7.37428 0.213
NP_442594.1_8 Forward -370 -351 7.07928 0.215
NP_442594.1_8 Reverse -310 -329 3.53937 0.28
NP_442047.1_2 Forward -290 -276 15.4376 0.161
NP_440690.1_9 Forward -214 -195 12.4875 0.231
NP_441633.1_3 Reverse -267 -280 -5.78224 0.236
NP_442764.1_8 Reverse -278 -297 5.70265 0.241
NP_442998.1_5 Reverse -62 -72 13.5497 0.158
NP_440299.1_1 Reverse -361 -374 11.0318 0.0529
NP_440256.1_1 Reverse -132 -151 -4.13045 0.147
NP_440256.1_1 Reverse -196 -215 -5.50708 0.184
NP_440256.1_1 Forward -381 -362 -9.44032 0.28
NP_441362.1_2 Reverse -68 -87 16.18 0.141
NP_441270.1_5 Reverse -135 -154 14.1654 0.211
NP_440915.1_6 Forward -290 -276 -1.5737 0.239
NP_441866.1_6 Forward -306 -287 17.6982 0.117
NP_442452.1_8 Reverse -359 -373 12.782 0.273
NP_442453.1_6 Forward -66 -52 15.1122 0.286
NP_440570.1_5 Forward -313 -294 2.65439 0.234
NP_440570.1_5 Forward -302 -283 0.196116 0.257
NP_441340.1_9 Reverse -76 -86 15.1001 0.194
NP_441271.1_8 Forward -290 -280 14.7297 0.266
NP_443028.1_4 Reverse -76 -95 9.50036 0.293
NP_440161.1_3 Forward -210 -191 12.1925 0.185
NP_442714.1_3 Forward -337 -318 20.0581 0.0482
NP_442714.1_5 Forward -376 -357 2.75272 0.238
NP_441027.1_1 Reverse -3 -17 11.602 0.27
NP_440586.1_8 Forward -143 -136 7.31526 0.265
NP_440192.1_4 Forward -303 -284 12.0171 0.193
NP_440684.1_9 Forward -377 -363 7.9644 0.246
NP_439937.1_9 Reverse -367 -384 -16.7764 0.287
NP_440439.1_1 Reverse -196 -209 -1.75067 0.281
NP_440439.1_1 Forward -381 -368 -2.04567 0.293
NP_439943.1_1 Reverse -344 -363 -10.4236 0.29
NP_441689.1_4 Reverse -70 -89 19.0502 0.0845
NP_442244.1_3 Reverse -53 -72 5.99764 0.236
NP_440075.1_7 Forward -61 -42 24.2068 0.0125
NP_440282.1_3 Reverse -278 -297 -1.7705 0.298
NP_440297.1_9 Reverse -290 -300 7.35486 0.126
NP_440297.1_9 Forward -285 -275 3.61828 0.263
NP_440297.1_9 Forward -297 -287 0.0783647 0.282
NP_440888.1_2 Forward -320 -306 5.40719 0.28
NP_442277.1_7 Reverse -74 -90 8.50558 0.175
NP_441304.1_10 Reverse -323 -332 14.651 0.164
NP_441319.1_8 Reverse -359 -377 8.57394 0.231
NP_442337.1_8 Forward -310 -291 -0.4922 0.274
NP_441462.1_2 Forward -208 -198 -1.10161 0.281
NP_440936.1_10 Forward -88 -69 -4.34531 0.266
NP_440911.1_9 Forward -166 -147 8.75091 0.208
NP_442204.1_1 Forward -290 -279 3.0086 0.266
NP_441867.1_2 Reverse -303 -322 -3.44213 0.176
NP_440673.1_3 Reverse -55 -62 8.20058 0.234
NP_440077.1_5 Reverse -276 -295 16.4207 0.143
NP_440992.1_2 Forward -303 -284 8.55425 0.291
NP_441893.1_5 Forward -301 -287 16.1252 0.244
NP_442864.1_3 Reverse -136 -155 11.8975 0.181
NP_443054.1_2 Forward -287 -273 1.27789 0.25
NP_441851.1_10 Reverse -288 -298 4.79825 0.247
NP_442515.1_1 Forward -157 -143 1.57289 0.155
NP_441396.1_2 Reverse -253 -270 1.31644 0.264
NP_440593.1_3 Reverse -278 -297 5.30933 0.124
NP_440593.1_3 Forward -297 -278 -5.60541 0.264
NP_442689.1_8 Forward -96 -79 -4.18939 0.263
NP_442843.1_1 Forward -215 -196 -11.7019 0.291
NP_440726.1_3 Reverse -288 -307 18.7807 0.0607
NP_440726.1_9 Reverse -213 -232 18.2882 0.0187
NP_440431.1_3 Forward -23 -4 -9.047 0.24
NP_440588.1_2 Forward -307 -288 -5.99873 0.266
NP_440588.1_5 Forward -261 -247 15.6743 0.215
NP_442243.1_1 Forward -292 -274 -3.02983 0.298
NP_442348.1_2 Reverse -325 -334 7.76787 0.28
NP_441432.1_8 Forward -379 -370 5.21127 0.185
NP_441432.1_9 Forward -93 -80 12.2827 0.217
NP_441030.1_4 Reverse -68 -87 15.899 0.0551
NP_442489.1_2 Reverse -278 -297 1.96607 0.278
NP_442489.1_7 Reverse -199 -208 -1.77023 0.247
NP_442489.1_7 Forward -208 -199 -1.86856 0.259
NP_441800.1_3 Forward -297 -279 10.6389 0.279
NP_440335.1_9 Reverse -220 -238 9.0656 0.298
NP_442346.1_5 Reverse -288 -298 6.17489 0.212
NP_442346.1_5 Forward -299 -289 4.3066 0.291
NP_440352.1_5 Forward -187 -168 10.6116 0.27
NP_440545.1_3 Reverse -285 -302 -2.3211 0.183
NP_440831.1_3 Forward -371 -352 7.06668 0.265
NP_440486.1_9 Forward -302 -288 14.1593 0.228
NP_442137.1_1 Forward -306 -287 12.3892 0.114
NP_440847.1_3 Reverse -132 -146 10.8154 0.282
NP_440449.1_6 Reverse -282 -300 7.96405 0.206
NP_442799.1_2 Reverse -357 -376 4.916 0.198
NP_441329.1_6 Reverse -105 -124 -1.86252 0.293
NP_442699.1_8 Forward -182 -163 -12.5869 0.255
NP_442699.1_8 Forward -345 -326 -12.7836 0.257
NP_442254.1_1 Reverse -277 -296 -5.50708 0.282
NP_441239.1_9 Forward -300 -288 4.75886 0.243
NP_441239.1_9 Reverse -197 -209 4.36554 0.253
NP_441009.1_4 Reverse -289 -308 11.7008 0.254
NP_441892.1_1 Reverse -280 -297 -0.551145 0.187
NP_440989.1_8 Forward -161 -142 6.78429 0.109
NP_440833.1_6 Reverse -197 -211 8.65209 0.272
NP_440412.1_2 Reverse -275 -294 6.19431 0.281
NP_442052.1_8 Reverse -287 -297 14.4347 0.253
NP_441782.1_10 Forward -294 -280 17.609 0.123
NP_440055.1_2 Reverse -139 -158 15.5357 0.111
NP_440462.1_4 Forward -210 -196 5.1128 0.29
NP_442402.1_4 Reverse -347 -366 -5.01617 0.234
NP_442358.1_6 Reverse -314 -332 8.47561 0.239
NP_442923.1_6 Reverse -79 -93 11.1842 0.251
NP_442679.1_1 Forward -269 -250 5.80098 0.147
NP_442679.1_2 Forward -366 -347 6.88262 0.279
NP_440160.1_2 Reverse -288 -307 11.9958 0.123
NP_440160.1_2 Forward -304 -285 1.47442 0.217
NP_440160.1_2 Reverse -277 -296 0.786102 0.217
NP_439994.1_4 Reverse -281 -300 13.3725 0.223
NP_441701.1_3 Forward -307 -290 9.08529 0.246
NP_441102.1_4 Forward -370 -351 18.6823 0.245
NP_442471.1_4 Forward -100 -81 15.7316 0.288
NP_442533.1_6 Reverse -289 -298 5.21127 0.15
NP_442533.1_6 Forward -66 -57 2.16301 0.27
NP_441482.1_7 Reverse -283 -297 -9.14519 0.194
NP_441482.1_7 Forward -214 -200 -11.8985 0.286
NP_442597.1_6 Forward -88 -69 15.0396 0.292
NP_442203.1_1 Reverse -74 -88 20.3514 0.0509
NP_441028.1_6 Reverse -168 -178 5.19112 0.265
NP_442664.1_3 Reverse -137 -151 13.3726 0.246
NP_441527.1_4 Forward -359 -340 -2.91293 0.162
NP_441527.1_4 Reverse -75 -94 -4.4408 0.186
NP_441527.1_4 Forward -270 -251 -6.06416 0.214
NP_441527.1_4 Reverse -78 -97 -6.25514 0.215
NP_441527.1_4 Forward -349 -330 -6.44613 0.218
NP_441527.1_4 Forward -361 -342 -12.4621 0.288
NP_440115.1_6 Forward -381 -371 5.09324 0.271
NP_440007.1_9 Reverse -291 -305 3.8345 0.267
NP_439903.1_6 Reverse -196 -215 2.45694 0.226
NP_439903.1_6 Forward -301 -282 2.06362 0.233
NP_442306.1_7 Forward -172 -153 17.4032 0.253
NP_442306.1_10 Reverse -194 -213 -12.5869 0.181
NP_442674.1_1 Forward -24 -5 12.7942 0.218
NP_440670.1_8 Forward -208 -199 5.11294 0.171
NP_441930.1_1 Reverse -285 -304 5.80098 0.266
NP_442614.1_2 Reverse -289 -303 9.5377 0.242
NP_442382.1_9 Reverse -355 -374 9.14342 0.281
NP_442382.1_9 Forward -325 -306 8.16011 0.286
NP_442264.1_5 Forward -298 -284 14.6509 0.222
NP_441021.1_1 Forward -309 -290 -12.4886 0.288
NP_440841.1_4 Forward -210 -191 -4.22878 0.185
NP_441993.1_1 Forward -214 -195 2.04414 0.265
NP_440143.1_9 Forward -86 -67 -2.75457 0.217
NP_440114.1_10 Reverse -199 -213 7.76774 0.227
NP_442698.1_10 Forward -372 -353 6.98095 0.233
NP_440311.1_2 Forward -297 -278 14.2574 0.283
NP_440725.1_2 Forward -290 -271 18.9773 0.0241
NP_440293.1_3 Reverse -281 -300 -1.27885 0.239
NP_440643.1_6 Reverse -278 -297 1.76941 0.265
NP_442930.1_1 Forward -12 -2 12.1726 0.239
NP_442930.1_1 Reverse -4 -14 11.1893 0.26
NP_441133.1_1 Reverse -136 -155 12.8808 0.252
NP_440213.1_5 Forward -303 -284 11.3075 0.214
NP_442680.1_5 Forward -270 -251 2.80756 0.237
NP_440473.1_1 Forward -151 -132 11.4502 0.274
NP_442509.1_9 Forward -334 -324 6.66608 0.259
NP_441159.1_8 Reverse -250 -269 -0.00131823 0.236
NP_442862.1_3 Reverse -134 -151 11.8386 0.201
NP_440727.1_3 Reverse -279 -298 19.764 0.109
NP_440091.1_1 Forward -175 -163 -0.0593532 0.27
NP_442451.1_2 Forward -342 -323 -3.44213 0.195
NP_442638.1_3 Reverse -75 -94 10.4559 0.298
NP_441105.1_3 Reverse -278 -297 -4.72043 0.204
NP_441105.1_3 Forward -309 -290 -6.1954 0.23
NP_440216.1_9 Forward -366 -357 6.29291 0.289
NP_440172.1_1 Reverse -199 -209 7.05986 0.0929
NP_441064.1_4 Forward -292 -273 9.24257 0.276
NP_442371.1_1 Reverse -378 -388 12.0743 0.267
NP_440416.1_9 Reverse -282 -301 -18.8801 0.266
NP_442116.1_6 Reverse -4 -21 8.35994 0.253
NP_440988.1_10 Forward -370 -356 7.99683 0.209
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGGCTTTAAGAATTCTTTCGAGGTAATCGGTGGTCATGGAAAACGAGAGCAAAAACGGTAGTAGCTAAAATCCCCCTTTCCAGTTTCCCACTCTTTGGCAGAGCCTTGGCCCAGGCTAAGGGCCTATTGAAGAGGAATAAAGTAAAGAAAGTGGGGTACAGTTTTTTGTTGTAGAGTTCAGAATTAGATAGGGCAATTGGCTGGTTAAATCACCATTAACGATGGAGCAAAGATGACGAGTTTGACAACCACACCAGCGAAGGAATGGTTTAAGGTACTTTGATTTGTATTATGTTCCCTCGGATTATTTCTTAATTTTTACTTTAAAAATCTGCCCAGCGACGACAAGATACAATGGTCGTAATTAAGGCCCCATAGAGTATTGGTAAATAATTTTCG

CDS

ATGACCCAAAGTAATAATTTCGCCACTAGCCCTCTTTGGCAACAGGGGTCCGTAGTGGAACTGACCATTACCGGCCTCAATCACCAAGGGGAGGGTATTGGCCGCTTTAATGAGCGAGTAGTGTTTGTGCCCGACACGGCCCCCGGCGATCGCCTGGAAGTCCGCTTGGTAAAAGTCAAAAGAAATTATGCCTTGGCCCAATTGCTCAAAATTTTAGAACCTTCTGTCCAGCGCACCCGCCCGTCCTGCATTGTGGCGGATAAATGTGGCGGTTGCCAATGGCAACATCTGGATTATCAATTCCAGGTAGAAAGTAAGCAACAACAAATTATTGACGCCCTGGAGCGTATTGGTGGTTTCACCACTTTGCCCCTGGAGCCTCTATTACAGTCCCCCGCTAGCTTGGGTTATCGCAACAAAGCCACCTATCCCCTAAGTCGCTCCAAAACCGGCCAGGTGCAAGCTGGTTATTACCGCAAGGGTAGCCATCGTTTGGTAAATATTAACCAATGCCCTGTGCAGGATGATCGCCTAAATTTATTGCTGACCGAGGTGAAGAAAGATATTGAAAATCGGGGTTGGTCTATCTATGACGAAGAGAAAAAGCAGGGCAAATTACGTCACCTAAGCCTACGCATTGGCCAACGTACGGGGGAAATGTTACTGACCCTGATTTCGGCCCATAAAGGTTTACCGGATTTGGAAGAACAGGCTGGGGAATGGTTGGAGCGCTATCCCGATTTGGGCGGCATTTGTTTAAATATTCAGCCCGAACCCAACAATCGCATTTTTGGCGATGAGACCGTGGTGATTGCAGGGCGGGGTATTTGTCGAGAAAAGTTTGCTGATCTGAGCTTTAGCCTGGGGGCTAATACGTTTTTCCAAGTTAACAGCGGGGCGGCAGAGCTACTGTTAACCAGGCTTCAGCAAGCATTAAATTTGCAAGGCGCCGAATTGTTGGTGGACGCCTATGCTGGGGTGGGCACTTTCACCCTCCCCCTCGCCCGCCAAGTCCGCCAGGCGATCGCCATTGAGGTCAACCAAGATTCGGTGCACCAGGGACAGCGCAACGCTGAGATCAATCAGATTGCCAATGTGGATTTTTTGGCTGGTACCGTAGAGACCGTTTTACCCACCCTGTCAGAGATTCCCGATGTTTTACTCCTTGATCCTCCCCGTAAGGGTTGTGCACCAGAAGTGCTCAGGGAAATTATCCGACAGCGCCCCGAAAAAATTGCCTACATTAGTTGCCAGCCCCCCACCCTAGCGAGGGACTTGAAATTTCTCTGTGCCGAGGGCTTCTATGGAATTACCTGGGTTCAGGGTTGTGATTTCTTTCCCCAAACAGCCCATGTGGAGTGTGCAGTAATTCTCAAAGCGGTCAATGGTTAA

Protein

MTQSNNFATSPLWQQGSVVELTITGLNHQGEGIGRFNERVVFVPDTAPGDRLEVRLVKVKRNYALAQLLKILEPSVQRTRPSCIVADKCGGCQWQHLDYQFQVESKQQQIIDALERIGGFTTLPLEPLLQSPASLGYRNKATYPLSRSKTGQVQAGYYRKGSHRLVNINQCPVQDDRLNLLLTEVKKDIENRGWSIYDEEKKQGKLRHLSLRIGQRTGEMLLTLISAHKGLPDLEEQAGEWLERYPDLGGICLNIQPEPNNRIFGDETVVIAGRGICREKFADLSFSLGANTFFQVNSGAAELLLTRLQQALNLQGAELLVDAYAGVGTFTLPLARQVRQAIAIEVNQDSVHQGQRNAEINQIANVDFLAGTVETVLPTLSEIPDVLLLDPPRKGCAPEVLREIIRQRPEKIAYISCQPPTLARDLKFLCAEGFYGITWVQGCDFFPQTAHVECAVILKAVNG