Your browser is old and dusty. Try Google Chrome!

Details for sll1960

ORF sll1960
Accession NP_441179.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441818.1_9 Forward -27 -8 -4.72043 0.242
NP_440226.1_1 Forward -35 -16 3.83436 0.212
NP_442173.1_1 Forward -132 -124 6.01761 0.2
NP_442173.1_1 Forward -234 -226 5.0343 0.24
NP_442752.1_4 Reverse -161 -168 5.54565 0.194
NP_443027.1_4 Reverse -159 -169 7.35486 0.24
NP_443027.1_4 Reverse -213 -223 6.8632 0.262
NP_442975.1_10 Forward -96 -82 3.53891 0.257
NP_442975.1_10 Reverse -228 -242 3.14559 0.263
NP_440784.1_7 Forward -285 -278 7.51227 0.138
NP_440784.1_7 Reverse -3 -10 5.84064 0.248
NP_440061.1_9 Reverse -75 -89 6.78381 0.232
NP_439979.1_9 Reverse -348 -366 9.26226 0.257
NP_442062.1_8 Reverse -161 -171 3.61828 0.26
NP_442062.1_8 Reverse -215 -225 3.22496 0.279
NP_441802.1_1 Forward -319 -300 5.30933 0.286
NP_440044.1_8 Forward -169 -150 3.24438 0.136
NP_442097.1_2 Reverse -247 -266 0.884433 0.259
NP_441434.1_7 Forward -29 -15 3.24451 0.254
NP_440056.1_6 Reverse -17 -36 16.7582 0.192
NP_441770.1_4 Forward -100 -81 -5.99873 0.22
NP_442570.1_3 Forward -283 -264 -4.6221 0.233
NP_442601.1_3 Forward -144 -125 13.0775 0.0882
NP_441716.1_1 Reverse -2 -16 3.34284 0.268
NP_440747.1_10 Reverse -121 -133 -12.5474 0.297
NP_442634.1_4 Reverse -105 -119 1.17956 0.149
NP_440470.1_5 Forward -193 -174 11.0289 0.185
NP_441014.1_10 Reverse -379 -398 5.01354 0.194
NP_442485.1_3 Reverse -81 -100 5.30933 0.169
NP_440642.1_10 Reverse -379 -393 7.57046 0.221
NP_442782.1_2 Reverse -266 -280 2.45787 0.275
NP_442782.1_2 Reverse -107 -121 1.37622 0.281
NP_439905.1_1 Forward -291 -278 6.60746 0.283
NP_440153.1_6 Reverse -106 -125 11.7992 0.231
NP_442002.1_9 Forward -150 -143 11.1505 0.185
NP_440147.1_1 Forward -230 -211 1.67108 0.297
NP_440260.1_8 Forward -165 -147 -6.76569 0.295
NP_441079.1_7 Reverse -173 -192 -6.09781 0.271
NP_442575.1_8 Forward -133 -114 -0.885524 0.232
NP_001035871.2_7 Forward -237 -227 13.943 0.219
NP_441556.1_7 Forward -235 -216 -0.197979 0.3
NP_441644.1_6 Forward -224 -214 3.61784 0.272
NP_442029.1_6 Forward -20 -1 4.12936 0.273
NP_442933.1_10 Forward -31 -22 8.1612 0.0885
NP_441751.2_8 Forward -229 -215 -5.50694 0.214
NP_442554.1_8 Forward -223 -213 4.99491 0.163
NP_442167.1_6 Reverse -145 -161 10.7759 0.269
NP_442970.1_3 Forward -192 -174 13.525 0.197
NP_442970.1_3 Forward -193 -175 12.4897 0.235
NP_443009.1_5 Reverse -214 -225 5.07306 0.218
NP_442406.1_9 Forward -282 -263 5.80098 0.271
NP_442406.1_9 Reverse -275 -294 -0.590531 0.291
NP_441198.1_8 Reverse -213 -223 10.6345 0.254
NP_441320.1_8 Reverse -324 -343 17.3057 0.206
NP_441826.1_2 Forward -281 -267 -2.45868 0.271
NP_442745.1_6 Reverse -158 -177 15.5357 0.258
NP_441764.1_6 Reverse -160 -171 16.2833 0.284
NP_442719.1_2 Forward -180 -162 -11.1913 0.29
NP_442719.1_2 Reverse -77 -95 -11.6829 0.294
NP_442559.1_3 Forward -321 -302 15.8307 0.137
NP_442427.1_8 Forward -142 -123 7.86593 0.203
NP_442808.1_1 Reverse -264 -274 4.30615 0.2
NP_440145.1_4 Reverse -257 -267 14.4342 0.241
NP_442542.1_9 Reverse -265 -279 7.66879 0.187
NP_440558.1_2 Forward -89 -70 2.3594 0.169
NP_440558.1_2 Forward -228 -209 -4.91709 0.249
NP_442503.1_9 Reverse -282 -301 8.75091 0.22
NP_441445.1_1 Forward -20 -1 6.78429 0.142
NP_441590.1_4 Reverse -211 -230 1.6703 0.299
NP_440101.1_3 Reverse -272 -291 3.44104 0.231
NP_442397.1_3 Reverse -106 -124 20.472 0.135
NP_442347.1_2 Forward -169 -160 17.7976 0.056
NP_442347.1_2 Forward -113 -104 3.93297 0.284
NP_442645.1_2 Forward -94 -75 -17.1101 0.248
NP_442888.1_6 Forward -322 -303 1.17943 0.298
NP_442764.1_3 Forward -12 -2 16.1063 0.295
NP_442998.1_5 Forward -151 -141 8.23984 0.267
NP_440299.1_5 Reverse -40 -59 16.3224 0.241
NP_442333.2_5 Reverse -7 -26 -15.3402 0.291
NP_441559.1_8 Forward -229 -215 -7.57189 0.295
NP_441559.1_8 Forward -306 -292 -7.76856 0.299
NP_440915.1_6 Reverse -268 -282 0.687908 0.155
NP_442158.1_4 Forward -158 -148 10.3048 0.299
NP_441179.1_6 Forward -190 -171 16.1257 0.295
NP_441179.1_7 Forward -97 -78 19.6656 0.253
NP_441179.1_9 Forward -226 -216 14.1392 0.246
NP_440717.1_3 Reverse -5 -19 8.16044 0.27
NP_440749.1_7 Forward -400 -381 16.6629 0.217
NP_440537.1_6 Reverse -6 -25 5.89931 0.267
NP_441464.1_10 Reverse -337 -351 11.6026 0.219
NP_441464.1_10 Forward -23 -9 10.521 0.254
NP_442386.1_9 Forward -225 -216 10.4224 0.129
NP_442386.1_9 Reverse -265 -274 5.9975 0.23
NP_441750.1_1 Forward -218 -199 -9.63698 0.3
NP_441750.1_1 Reverse -221 -240 -11.3086 0.3
NP_440327.1_6 Reverse -60 -79 3.83436 0.279
NP_440161.1_3 Forward -74 -55 9.83255 0.237
NP_440161.1_3 Reverse -280 -299 9.63589 0.238
NP_440211.1_7 Reverse -215 -233 6.50899 0.287
NP_442959.1_5 Reverse -293 -312 7.86593 0.23
NP_441262.1_1 Forward -234 -216 16.8337 0.199
NP_440027.1_3 Forward -292 -274 10.0481 0.177
NP_440027.1_8 Forward -136 -117 4.91521 0.285
NP_439937.1_9 Reverse -1 -18 0.0381458 0.107
NP_439937.1_9 Reverse -255 -272 -16.973 0.291
NP_442294.1_3 Forward -144 -130 13.1753 0.274
NP_440398.1_2 Reverse -317 -336 10.5209 0.162
NP_440316.1_10 Reverse -98 -108 14.9263 0.175
NP_442384.1_10 Forward -114 -101 4.44418 0.157
NP_442384.1_10 Forward -224 -211 2.67422 0.216
NP_440297.1_9 Forward -223 -213 -0.609952 0.292
NP_440894.1_10 Forward -246 -227 2.45773 0.29
NP_440888.1_2 Forward -281 -267 11.012 0.0783
NP_440179.1_6 Reverse -78 -97 3.53937 0.266
NP_440179.1_6 Reverse -257 -276 3.34271 0.274
NP_442033.1_10 Forward -294 -275 -10.7186 0.243
NP_440575.1_1 Forward -381 -362 -1.67294 0.29
NP_442845.1_2 Reverse -209 -223 10.226 0.156
NP_442845.1_2 Reverse -71 -85 3.8345 0.275
NP_441178.1_5 Forward -347 -328 15.1424 0.152
NP_442710.1_7 Reverse -174 -193 -8.08773 0.299
NP_441469.1_8 Forward -225 -216 5.40793 0.272
NP_442578.1_7 Reverse -290 -297 6.72562 0.18
NP_440710.1_1 Forward -289 -271 -9.22396 0.296
NP_443062.1_1 Forward -170 -152 10.2035 0.121
NP_443062.1_6 Forward -309 -290 1.0811 0.28
NP_440519.1_8 Forward -27 -11 3.00846 0.254
NP_441560.1_10 Reverse -218 -237 6.19431 0.292
NP_441443.1_7 Forward -104 -85 -2.45882 0.27
NP_441052.1_2 Reverse -2 -12 2.63497 0.197
NP_442219.1_9 Forward -169 -160 1.76968 0.298
NP_440314.1_9 Forward -115 -96 -4.32711 0.205
NP_441004.1_1 Reverse -221 -240 -14.0619 0.263
NP_441004.1_1 Forward -218 -199 -14.0619 0.263
NP_442813.1_4 Forward -283 -264 -8.65367 0.299
NP_442854.1_6 Reverse -107 -126 1.47442 0.279
NP_442312.1_1 Forward -161 -142 12.2908 0.266
NP_442622.1_5 Forward -241 -222 -2.65548 0.171
NP_440432.1_9 Reverse -23 -38 -1.79006 0.167
NP_442843.1_1 Forward -30 -11 -4.03212 0.232
NP_442168.1_5 Reverse -222 -241 -0.197208 0.264
NP_442443.1_1 Forward -369 -350 -6.78538 0.298
NP_441432.1_8 Reverse -123 -132 5.21127 0.185
NP_441432.1_8 Reverse -282 -291 2.55633 0.298
NP_442797.1_7 Forward -293 -275 1.49411 0.258
NP_440913.1_1 Forward -283 -265 15.7521 0.1
NP_440913.1_3 Forward -348 -335 14.7689 0.232
NP_440713.1_4 Reverse -114 -133 2.45773 0.262
NP_440386.1_3 Forward -58 -39 -12.1936 0.292
NP_441659.2_8 Forward -281 -271 3.02829 0.177
NP_441040.1_2 Forward -243 -224 6.09597 0.119
NP_442346.1_5 Reverse -214 -224 4.20827 0.296
NP_440545.1_3 Reverse -273 -290 1.21881 0.123
NP_440486.1_2 Forward -294 -275 9.63589 0.23
NP_442828.1_7 Reverse -314 -333 -4.32711 0.276
NP_441047.1_1 Forward -249 -230 1.47442 0.243
NP_441112.1_6 Forward -321 -302 12.7825 0.0651
NP_442162.1_9 Forward -132 -125 5.93897 0.214
NP_440671.1_4 Reverse -353 -367 5.01447 0.297
NP_442199.1_5 Reverse -18 -37 -7.08038 0.286
NP_442140.1_3 Reverse -231 -241 4.10993 0.261
NP_442028.1_1 Forward -195 -182 14.863 0.251
NP_440590.1_4 Reverse -233 -246 3.36254 0.0746
NP_441239.1_9 Reverse -213 -225 6.82381 0.175
NP_441951.1_4 Forward -247 -228 3.53937 0.275
NP_440400.1_1 Forward -348 -329 3.14526 0.244
NP_441892.1_1 Reverse -13 -30 2.39878 0.14
NP_441892.1_1 Forward -44 -27 -5.56602 0.283
NP_442193.1_8 Forward -95 -76 17.8948 0.211
NP_441017.1_6 Forward -393 -379 12.192 0.224
NP_440833.1_6 Forward -74 -60 6.98048 0.292
NP_441936.1_9 Reverse -242 -261 12.6841 0.26
NP_442052.1_7 Reverse -311 -325 13.9626 0.22
NP_440546.1_4 Reverse -215 -225 8.00989 0.209
NP_442787.1_9 Forward -272 -253 12.1925 0.296
NP_442402.1_10 Reverse -259 -269 10.6976 0.282
NP_440696.1_3 Reverse -273 -291 2.87075 0.213
NP_441811.1_8 Forward -17 -3 7.57108 0.241
NP_442837.1_3 Forward -169 -162 6.52896 0.2
NP_440505.1_3 Reverse -122 -132 5.28991 0.236
NP_442360.1_5 Forward -273 -263 13.353 0.279
NP_442533.1_6 Forward -224 -215 6.09625 0.118
NP_442533.1_6 Reverse -215 -224 4.71961 0.177
NP_442533.1_6 Reverse -272 -281 3.14632 0.224
NP_442533.1_6 Forward -86 -77 2.85133 0.236
NP_441482.1_7 Reverse -118 -132 -12.2918 0.292
NP_441108.1_3 Reverse -345 -364 19.174 0.1
NP_442269.1_5 Reverse -282 -301 21.1855 0.0957
NP_441697.1_5 Reverse -175 -194 -5.5867 0.229
NP_441028.1_6 Forward -169 -159 12.6642 0.183
NP_441527.1_4 Reverse -173 -192 -10.4568 0.27
NP_440007.1_9 Reverse -268 -282 3.34284 0.27
NP_440480.1_10 Reverse -32 -46 17.6985 0.224
NP_440886.1_7 Reverse -1 -11 7.0594 0.106
NP_439899.1_1 Forward -197 -179 6.03672 0.221
NP_441463.1_2 Forward -190 -172 1.52397 0.256
NP_442365.1_7 Reverse -226 -245 0.0977854 0.177
NP_442794.1_1 Reverse -120 -132 5.74217 0.209
NP_441962.1_4 Reverse -242 -261 -14.3569 0.286
NP_441796.1_6 Reverse -216 -235 9.14423 0.236
NP_441836.1_2 Forward -139 -120 -5.40875 0.279
NP_440634.1_4 Forward -319 -300 8.65258 0.257
NP_440634.1_10 Reverse -149 -168 12.9783 0.164
NP_441174.1_4 Reverse -159 -169 10.4031 0.288
NP_440766.1_4 Forward -162 -148 1.86788 0.209
NP_440766.1_5 Reverse -178 -190 11.6665 0.258
NP_442930.1_1 Reverse -50 -60 11.6809 0.258
NP_440457.1_1 Reverse -340 -352 0.137309 0.25
NP_441332.1_4 Reverse -172 -191 5.60432 0.261
NP_442509.1_9 Reverse -316 -326 8.04271 0.192
NP_441489.1_3 Reverse -176 -190 8.70139 0.232
NP_440524.1_3 Forward -284 -265 10.2259 0.275
NP_442514.1_5 Reverse -116 -135 -8.85106 0.29
NP_442514.1_5 Reverse -139 -158 -9.83437 0.298
NP_441440.1_8 Forward -278 -265 14.3756 0.299
NP_441159.1_8 Forward -195 -176 -0.689632 0.236
NP_440554.1_5 Reverse -67 -85 13.6872 0.158
NP_441885.1_5 Reverse -124 -134 -1.59326 0.273
NP_440898.1_6 Reverse -296 -315 9.3409 0.286
NP_440191.1_6 Reverse -180 -194 15.8633 0.294
NP_443000.1_7 Forward -340 -330 1.25834 0.26
NP_441307.1_6 Forward -27 -8 4.52268 0.283
NP_442275.1_1 Reverse -215 -234 -0.0988766 0.295
NP_441105.1_3 Reverse -113 -132 -5.9004 0.225
NP_440216.1_9 Forward -125 -116 5.3096 0.298
NP_442662.1_7 Reverse -334 -353 14.2574 0.242
NP_442446.1_10 Reverse -228 -247 20.1564 0.106
NP_443052.1_9 Forward -249 -230 -6.68705 0.287
NP_440072.1_5 Forward -20 -2 -0.0791831 0.236
NP_440261.1_5 Reverse -257 -270 -5.19226 0.188
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATCCCTATAAAGCAAGCGAAATTAATTTAACTGCCGCCTGTATTGTCTCCACCACACCACTAATGTTCACCACCCCGGTTCAGCAACAGAAAATGGCTGATATTTACCGCCAATGTCAGCGCACCGCCTTTGGGGGAGATTGTTTCAATTACCTCAGTGCCGCTAGCGGTTGGACAGCCATGCCCTTAGTAATAGTGGAAGCGGATTTAAATTTTTATGACTTTTGTGCATTGATCCCCATTTTGACCGGGGCAAATTACTGTTTTACCGATTGGCAGGGCAAAGAGTTAACCCCAGAGTCCACGGAAGTTGTGGCCAGTCCTAACCCAAAATTGCACAGTGAAATTTTAGCTTTCCTGCAATAATTGATCGATGGTTCGTTCTGGGGGGTGATGACGG

CDS

GTGCAATTAAGCTTTCAAGAACGTTTGGAGTCCATTAAGGCCGGTTGCCTCGGGGCGACCGCCTTTGGGTTGGTTTATGGATTGACCTTGCTGGGCAACACCTATTTCAACCTACTGACAAGCACACTCAATTCGGACTGGATTAACCTGGGTTTGAACTTTGGTAGTGGTTTGCTGAGTGGCTTTTTATTTGCTGTCACCTATCGTTACATCATTCGCCAGGATGACAATGCCCATCTCCGGGACGGGGCGGTTTTAGCTTTCACTTTGGTGCGGAGCAGCGGACTGATCGCGTTACCCACCACTGAAGACCCCCTGGCGATCGCCATTTTGATGGGGGAAAGTCTGATTGGTTTTGCTGTAGTTCGTTCCAGCCTCGATTGGGCCATGGCTAGGGATTGGCTCCGGCCCTTTAAAAGTTGA

Protein

MQLSFQERLESIKAGCLGATAFGLVYGLTLLGNTYFNLLTSTLNSDWINLGLNFGSGLLSGFLFAVTYRYIIRQDDNAHLRDGAVLAFTLVRSSGLIALPTTEDPLAIAILMGESLIGFAVVRSSLDWAMARDWLRPFKS