Your browser is old and dusty. Try Google Chrome!

Details for sll1958

ORF sll1958
Accession NP_441181.1
Symbol hisC
Category Aromatic amino acid family
Definition histidinol phosphate aminotransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Forward -155 -136 0.58944 0.265
NP_440795.1_7 Forward -149 -142 7.31561 0.259
NP_441453.1_4 Forward -128 -120 4.24765 0.259
NP_441818.1_9 Forward -27 -8 -1.27885 0.2
NP_440813.1_3 Forward -39 -20 16.0274 0.173
NP_440996.1_3 Reverse -221 -239 15.6538 0.152
NP_442173.1_1 Forward -155 -147 4.93597 0.241
NP_439997.1_6 Reverse -70 -89 23.4022 0.0248
NP_439997.1_6 Forward -69 -50 16.6174 0.177
NP_441476.1_5 Reverse -25 -44 -3.3438 0.235
NP_440878.1_4 Forward -138 -120 18.8987 0.153
NP_442062.1_8 Forward -156 -146 4.60159 0.206
NP_442062.1_8 Reverse -288 -298 3.71661 0.256
NP_442974.1_10 Forward -273 -254 16.2232 0.201
NP_441802.1_1 Forward -31 -12 6.09597 0.269
NP_440304.1_4 Reverse -34 -44 13.0581 0.051
NP_439918.1_3 Reverse -243 -262 4.42435 0.264
NP_441594.1_6 Reverse -333 -352 5.30933 0.209
NP_441594.1_6 Reverse -150 -169 -0.39387 0.299
NP_442276.1_2 Forward -31 -12 2.16274 0.299
NP_440132.1_1 Forward -285 -267 15.0638 0.113
NP_440856.1_4 Reverse -131 -150 -4.91709 0.27
NP_440856.1_7 Reverse -18 -37 -8.85033 0.28
NP_441955.1_8 Forward -162 -145 7.11867 0.281
NP_442889.1_8 Reverse -116 -130 7.96378 0.136
NP_440747.1_10 Forward -48 -36 -12.1541 0.227
NP_440747.1_10 Reverse -255 -267 -12.2524 0.254
NP_441486.1_1 Reverse -116 -130 0.392915 0.138
NP_440403.1_10 Reverse -342 -361 0.884433 0.293
NP_440842.1_6 Reverse -232 -251 10.4217 0.284
NP_441014.1_8 Reverse -120 -139 -0.590531 0.218
NP_441014.1_10 Forward -163 -144 5.70185 0.181
NP_442848.1_5 Reverse -335 -353 -0.374176 0.276
NP_443018.1_3 Forward -127 -120 12.5271 0.0523
NP_443018.1_3 Reverse -120 -127 12.5271 0.0523
NP_443018.1_3 Forward -155 -148 10.7572 0.0907
NP_443018.1_3 Reverse -148 -155 4.56234 0.241
NP_441634.1_8 Forward -263 -249 -3.93365 0.295
NP_441588.1_4 Reverse -121 -131 5.09324 0.297
NP_441013.1_3 Reverse -154 -173 9.14423 0.233
NP_441422.1_7 Forward -158 -141 -1.14113 0.181
NP_442296.1_5 Forward -276 -257 1.67108 0.281
NP_440360.1_8 Reverse -139 -158 14.9458 0.27
NP_442658.1_1 Reverse -145 -155 12.5659 0.0526
NP_442658.1_1 Forward -269 -259 5.48612 0.265
NP_440141.1_4 Reverse -249 -268 -11.4069 0.298
NP_442782.1_2 Forward -27 -13 3.63784 0.263
NP_442496.1_5 Forward -284 -266 4.34571 0.292
NP_441317.1_4 Reverse -72 -86 10.4189 0.29
NP_442486.1_6 Forward -34 -15 -4.91709 0.27
NP_439990.1_5 Reverse -253 -266 5.82081 0.272
NP_441580.1_6 Reverse -25 -44 -7.17871 0.236
NP_442536.1_8 Forward -33 -14 10.6192 0.296
NP_443055.1_6 Forward -221 -203 -0.571569 0.263
NP_440993.1_4 Reverse -119 -136 1.8088 0.3
NP_440138.1_6 Reverse -31 -50 0.588665 0.296
NP_441654.1_7 Forward -92 -73 11.081 0.295
NP_441646.1_1 Forward -135 -116 -1.86883 0.296
NP_442431.1_10 Forward -30 -12 2.37909 0.238
NP_442870.1_4 Reverse -83 -97 18.9775 0.161
NP_442870.1_4 Reverse -215 -229 17.6992 0.168
NP_441295.1_4 Forward -260 -241 -2.85214 0.29
NP_440206.1_4 Reverse -14 -33 1.27698 0.289
NP_441041.1_1 Forward -33 -14 6.78429 0.267
NP_441041.1_4 Reverse -154 -173 -10.1286 0.228
NP_441041.1_4 Reverse -282 -301 -11.5053 0.248
NP_441725.1_2 Forward -306 -287 20.4514 0.0681
NP_441725.1_3 Forward -258 -239 23.3039 0.00678
NP_439966.1_7 Forward -233 -223 6.86274 0.163
NP_439966.1_7 Forward -158 -148 5.19112 0.24
NP_440983.1_5 Reverse -330 -349 -8.85033 0.298
NP_440260.1_8 Forward -137 -119 1.49411 0.184
NP_442281.1_1 Reverse -142 -156 3.44058 0.231
NP_440018.1_3 Forward -83 -64 4.03102 0.28
NP_440177.1_1 Forward -32 -14 7.4923 0.272
NP_442012.1_2 Reverse -256 -275 7.07928 0.211
NP_442012.1_5 Forward -34 -15 0.491109 0.288
NP_440723.1_4 Forward -261 -242 -9.047 0.272
NP_441644.1_6 Forward -128 -118 13.1559 0.0227
NP_441644.1_6 Reverse -119 -129 4.60114 0.233
NP_443049.1_6 Reverse -221 -231 11.3482 0.263
NP_440253.1_2 Forward -255 -237 -1.45582 0.242
NP_442926.1_3 Reverse -25 -44 3.24438 0.289
NP_442554.1_8 Reverse -120 -130 13.1564 0.0193
NP_442554.1_8 Forward -127 -117 10.8948 0.0424
NP_442554.1_8 Forward -44 -34 3.81494 0.209
NP_441762.1_7 Reverse -146 -158 -3.50094 0.11
NP_442142.1_4 Forward -159 -146 15.0633 0.0302
NP_442142.1_4 Forward -264 -251 7.49186 0.137
NP_442142.1_4 Reverse -15 -28 5.23026 0.197
NP_442142.1_9 Reverse -140 -159 0.884433 0.291
NP_442292.1_1 Reverse -120 -129 5.80125 0.129
NP_442292.1_1 Forward -127 -118 4.22796 0.181
NP_442292.1_1 Forward -44 -35 3.04799 0.211
NP_440919.1_1 Forward -148 -129 -3.14714 0.221
NP_440919.1_1 Reverse -168 -187 -8.45701 0.294
NP_442338.1_3 Reverse -70 -89 17.2327 0.266
NP_442741.1_8 Reverse -248 -266 18.5054 0.204
NP_440183.1_9 Reverse -245 -264 -21.1417 0.296
NP_440379.1_5 Reverse -243 -262 1.17943 0.162
NP_440379.1_5 Reverse -21 -40 -10.7186 0.283
NP_441468.1_1 Reverse -148 -155 4.07068 0.263
NP_441468.1_1 Reverse -120 -127 3.97235 0.277
NP_441468.1_1 Forward -127 -120 3.97235 0.277
NP_441015.1_10 Reverse -154 -173 -10.817 0.288
NP_441172.1_2 Reverse -132 -149 25.9974 0.0107
NP_442868.1_6 Forward -233 -223 1.16001 0.205
NP_442808.1_1 Forward -298 -288 6.76441 0.0982
NP_440568.1_8 Forward -53 -34 9.73422 0.265
NP_440031.1_10 Reverse -283 -302 0.196116 0.28
NP_440145.1_3 Reverse -170 -189 2.0644 0.121
NP_442789.1_4 Forward -353 -334 -8.35868 0.299
NP_441878.1_6 Forward -129 -119 0.668351 0.139
NP_441878.1_6 Reverse -118 -128 0.668351 0.139
NP_441878.1_6 Forward -15 -5 -7.59145 0.245
NP_441590.1_4 Forward -104 -85 1.6703 0.299
NP_441458.1_10 Reverse -138 -157 3.14605 0.255
NP_442444.1_6 Reverse -28 -46 12.7271 0.268
NP_442645.1_2 Forward -136 -117 -22.715 0.293
NP_441633.1_3 Forward -167 -154 -6.47056 0.253
NP_442590.1_9 Reverse -242 -261 4.81767 0.273
NP_442998.1_5 Reverse -58 -68 9.22315 0.248
NP_442998.1_10 Forward -187 -180 4.16902 0.259
NP_440899.1_1 Reverse -154 -173 17.2883 0.0659
NP_440299.1_1 Forward -343 -330 4.05029 0.221
NP_440299.1_1 Forward -259 -246 3.46031 0.243
NP_441799.1_1 Forward -132 -118 4.22722 0.261
NP_441799.1_1 Forward -49 -35 4.03056 0.269
NP_440256.1_1 Reverse -177 -196 -6.78538 0.22
NP_440256.1_1 Forward -48 -29 -6.98204 0.225
NP_441559.1_8 Reverse -190 -204 0.687908 0.163
NP_441559.1_8 Forward -160 -146 -5.31028 0.259
NP_441559.1_8 Forward -61 -47 -5.40861 0.261
NP_442386.1_9 Reverse -146 -155 10.914 0.111
NP_442386.1_9 Forward -129 -120 10.324 0.132
NP_442386.1_9 Forward -157 -148 6.68581 0.219
NP_442386.1_9 Reverse -275 -284 6.19416 0.23
NP_441340.1_5 Reverse -181 -188 8.8889 0.084
NP_441340.1_5 Reverse -120 -127 4.07068 0.239
NP_441340.1_5 Forward -127 -120 4.07068 0.239
NP_441340.1_5 Forward -155 -148 3.97235 0.274
NP_440161.1_3 Forward -158 -139 8.94757 0.262
NP_440586.1_8 Forward -127 -120 7.61025 0.227
NP_440586.1_8 Reverse -120 -127 7.61025 0.227
NP_443051.1_5 Reverse -49 -68 12.6841 0.202
NP_439937.1_9 Reverse -17 -34 -14.6131 0.287
NP_440840.1_5 Forward -83 -64 18.5079 0.25
NP_443039.1_7 Reverse -269 -283 8.06211 0.188
NP_440439.1_5 Forward -69 -57 19.4096 0.27
NP_441803.1_2 Forward -263 -244 3.24438 0.194
NP_441803.1_2 Reverse -107 -126 0.491109 0.251
NP_442416.1_10 Forward -286 -267 11.3075 0.297
NP_440399.1_10 Forward -133 -115 14.8489 0.25
NP_440530.1_6 Reverse -82 -96 16.1483 0.201
NP_442790.1_4 Reverse -95 -114 -9.83364 0.195
NP_442262.1_10 Forward -127 -120 10.4622 0.145
NP_442262.1_10 Reverse -120 -127 10.4622 0.145
NP_442262.1_10 Forward -155 -148 9.87221 0.164
NP_440282.1_3 Reverse -136 -155 -4.72043 0.298
NP_440189.1_10 Forward -139 -120 3.24438 0.282
NP_440562.1_10 Reverse -125 -143 6.41066 0.284
NP_440297.1_9 Forward -127 -117 0.0783647 0.282
NP_440297.1_9 Reverse -120 -130 -0.118297 0.282
NP_440350.1_5 Reverse -355 -374 0.58944 0.16
NP_441592.1_4 Reverse -119 -138 4.12936 0.158
NP_441103.1_9 Forward -64 -54 13.0755 0.27
NP_442129.1_6 Forward -378 -359 18.9882 0.246
NP_442129.1_6 Reverse -364 -383 14.5282 0.246
NP_442067.1_4 Reverse -136 -155 5.01433 0.244
NP_442067.1_4 Reverse -241 -260 4.916 0.244
NP_442892.1_9 Forward -63 -49 11.7003 0.296
NP_440792.1_6 Reverse -207 -226 12.1925 0.23
NP_440179.1_6 Forward -266 -247 5.89931 0.224
NP_442033.1_10 Forward -168 -149 -11.4069 0.253
NP_441543.1_2 Reverse -120 -129 5.11294 0.209
NP_442845.1_2 Reverse -85 -99 5.01447 0.247
NP_442845.1_2 Forward -134 -120 4.12949 0.267
NP_442845.1_2 Reverse -159 -173 3.44117 0.29
NP_442315.1_2 Reverse -86 -98 11.1504 0.291
NP_441621.1_7 Reverse -247 -261 -3.44199 0.188
NP_441621.1_7 Forward -29 -15 -4.4253 0.223
NP_440519.1_8 Forward -27 -11 2.22182 0.267
NP_442204.1_1 Reverse -284 -295 1.53364 0.269
NP_442428.1_5 Reverse -148 -155 4.46401 0.267
NP_442428.1_5 Forward -127 -120 4.36568 0.271
NP_442428.1_5 Reverse -120 -127 4.36568 0.271
NP_442428.1_8 Forward -160 -141 3.73603 0.224
NP_442120.1_10 Forward -33 -14 -15.2418 0.292
NP_441867.1_2 Reverse -163 -182 -13.9635 0.277
NP_440673.1_3 Forward -154 -147 10.5605 0.123
NP_440673.1_3 Reverse -20 -27 6.23397 0.283
NP_441052.1_2 Reverse -119 -129 5.19158 0.128
NP_442219.1_8 Reverse -170 -189 10.7762 0.199
NP_442219.1_8 Forward -138 -119 6.52434 0.294
NP_440436.1_4 Forward -155 -146 10.7174 0.0743
NP_440436.1_4 Reverse -120 -129 4.7192 0.244
NP_441004.1_1 Forward -33 -14 -14.3569 0.267
NP_441004.1_2 Reverse -201 -220 -4.03212 0.288
NP_443029.1_8 Reverse -12 -31 10.7175 0.293
NP_441851.1_10 Forward -129 -119 4.3066 0.277
NP_440682.1_4 Forward -289 -270 1.96607 0.0449
NP_441982.1_6 Forward -374 -365 11.6259 0.288
NP_442314.1_1 Forward -263 -245 -3.12744 0.232
NP_442843.1_1 Forward -286 -267 -9.44032 0.266
NP_440474.1_8 Reverse -139 -153 8.45543 0.186
NP_440588.1_2 Forward -165 -146 -6.88371 0.294
NP_440023.1_7 Reverse -213 -232 6.4893 0.269
NP_441570.1_1 Reverse -141 -159 -13.0589 0.221
NP_441078.1_4 Forward -128 -119 -1.6719 0.266
NP_441078.1_4 Reverse -119 -128 -1.77023 0.266
NP_442348.1_2 Forward -278 -269 10.3245 0.27
NP_442348.1_2 Forward -71 -62 6.8829 0.298
NP_441432.1_8 Forward -129 -120 6.19458 0.118
NP_441432.1_9 Reverse -76 -89 11.2162 0.235
NP_442320.1_8 Reverse -368 -382 -5.01529 0.2
NP_442797.1_6 Forward -349 -330 7.06155 0.294
NP_443011.1_7 Forward -173 -154 18.6823 0.284
NP_440713.1_4 Forward -160 -141 1.37609 0.287
NP_442489.1_2 Forward -167 -148 8.35759 0.168
NP_442489.1_7 Forward -128 -119 -1.6719 0.235
NP_442489.1_7 Reverse -119 -128 -1.77023 0.247
NP_441659.2_8 Forward -128 -118 5.78156 0.0979
NP_441659.2_8 Reverse -246 -256 1.35667 0.242
NP_439956.1_7 Reverse -85 -104 1.76941 0.28
NP_442008.1_2 Forward -300 -281 2.75272 0.277
NP_442346.1_2 Reverse -211 -230 9.24257 0.216
NP_442346.1_5 Forward -129 -119 13.4514 0.0235
NP_442346.1_5 Reverse -118 -128 4.89658 0.269
NP_440545.1_3 Reverse -176 -193 2.20212 0.106
NP_441856.1_6 Forward -157 -143 19.0758 0.142
NP_440831.1_3 Reverse -249 -268 5.12514 0.29
NP_440555.1_1 Forward -139 -120 1.27776 0.294
NP_440010.1_3 Reverse -276 -295 -3.63879 0.25
NP_440010.1_10 Forward -140 -121 5.211 0.234
NP_440847.1_3 Forward -103 -89 10.8154 0.282
NP_441888.1_7 Forward -161 -147 0.786239 0.281
NP_441047.1_2 Reverse -142 -161 10.0292 0.12
NP_441329.1_6 Reverse -49 -68 1.28872 0.24
NP_442140.1_3 Reverse -120 -130 7.45319 0.14
NP_442140.1_3 Reverse -148 -158 5.38824 0.211
NP_442021.1_3 Reverse -74 -93 -7.67036 0.277
NP_441813.1_5 Forward -158 -148 -0.216628 0.237
NP_440590.1_4 Forward -257 -244 -1.65234 0.225
NP_441239.1_9 Reverse -117 -129 11.2487 0.0648
NP_441239.1_9 Forward -158 -146 3.87389 0.272
NP_441009.1_4 Forward -27 -8 12.9791 0.219
NP_440400.1_1 Forward -98 -79 -2.26292 0.285
NP_442325.1_1 Forward -26 -7 19.764 0.0986
NP_440833.1_6 Reverse -267 -281 9.93039 0.257
NP_440833.1_6 Forward -222 -208 8.75042 0.272
NP_440546.1_6 Forward -34 -15 6.58763 0.297
NP_440868.1_4 Forward -160 -148 1.21895 0.19
NP_442402.1_4 Forward -63 -44 3.44025 0.153
NP_442402.1_10 Reverse -364 -374 12.6642 0.204
NP_440653.1_10 Forward -82 -63 5.99764 0.218
NP_442679.1_1 Reverse -44 -63 -4.13045 0.273
NP_442829.1_2 Forward -90 -74 8.33436 0.287
NP_440160.1_3 Forward -300 -281 12.1917 0.209
NP_442053.1_3 Forward -201 -182 17.8957 0.104
NP_440505.1_3 Reverse -256 -266 4.60159 0.277
NP_442533.1_6 Forward -128 -119 7.17789 0.0948
NP_442533.1_6 Reverse -119 -128 6.68623 0.105
NP_442541.1_10 Reverse -119 -133 2.16228 0.265
NP_442232.1_3 Forward -47 -28 -14.4552 0.288
NP_443016.1_1 Forward -134 -115 -0.197208 0.213
NP_441482.1_7 Forward -261 -247 -8.8502 0.193
NP_441028.1_6 Forward -64 -54 12.6642 0.183
NP_441527.1_4 Reverse -47 -66 -8.45146 0.244
NP_440007.1_9 Reverse -191 -205 5.60446 0.251
NP_441680.1_4 Reverse -142 -161 -2.55715 0.268
NP_441347.1_5 Reverse -179 -193 18.0918 0.118
NP_441602.1_4 Reverse -241 -260 11.1109 0.278
NP_441972.1_5 Forward -268 -249 -9.73531 0.293
NP_441972.1_5 Forward -266 -247 -9.83364 0.293
NP_441106.1_1 Reverse -146 -155 4.42462 0.226
NP_441106.1_1 Reverse -35 -44 2.75299 0.261
NP_441479.1_9 Reverse -282 -300 16.1454 0.238
NP_441705.1_3 Reverse -141 -160 -6.49039 0.291
NP_441001.1_5 Reverse -271 -290 10.6192 0.289
NP_442382.1_9 Reverse -69 -88 9.34008 0.281
NP_442221.1_4 Forward -31 -12 6.78429 0.296
NP_440387.1_1 Reverse -119 -135 -4.95634 0.208
NP_440855.1_1 Forward -30 -11 1.27776 0.226
NP_441431.1_2 Forward -159 -145 6.98048 0.255
NP_441431.1_3 Forward -291 -272 4.32602 0.263
NP_441993.1_1 Forward -261 -242 1.06957 0.285
NP_442224.1_1 Forward -145 -126 0.294447 0.233
NP_442224.1_1 Reverse -139 -158 -1.47551 0.233
NP_440114.1_10 Forward -128 -114 11.0127 0.127
NP_442323.1_7 Forward -173 -154 1.08032 0.292
NP_440311.1_8 Forward -370 -356 19.0758 0.25
NP_442930.1_1 Forward -221 -211 10.0093 0.28
NP_440502.1_3 Forward -64 -54 14.6665 0.209
NP_441981.1_3 Reverse -45 -59 15.1853 0.268
NP_441801.1_4 Forward -265 -255 2.63497 0.29
NP_442680.1_5 Reverse -45 -64 -0.220842 0.278
NP_441984.1_6 Forward -134 -122 15.4769 0.219
NP_440473.1_3 Forward -161 -142 14.2574 0.287
NP_440524.1_2 Reverse -20 -39 7.27595 0.158
NP_440554.1_4 Forward -155 -145 3.91327 0.211
NP_442341.1_9 Forward -293 -279 5.50552 0.267
NP_440191.1_4 Forward -63 -53 15.3781 0.254
NP_440507.2_3 Forward -159 -140 9.43841 0.221
NP_440507.2_3 Forward -264 -245 6.98015 0.293
NP_441183.1_2 Reverse -301 -311 15.8729 0.281
NP_440679.1_10 Reverse -140 -159 -14.1602 0.226
NP_441122.1_1 Reverse -115 -130 3.81481 0.28
NP_441207.1_7 Forward -369 -355 13.0311 0.229
NP_439962.1_4 Reverse -139 -158 -2.45882 0.23
NP_439962.1_4 Reverse -10 -29 -5.9004 0.28
NP_439962.1_4 Forward -301 -282 -8.35868 0.293
NP_440149.1_8 Forward -156 -137 -2.0655 0.164
NP_442214.1_1 Forward -289 -270 9.43923 0.276
NP_440216.1_9 Forward -126 -117 7.37455 0.286
NP_440216.1_9 Reverse -121 -130 7.37455 0.286
NP_440172.1_1 Reverse -36 -46 3.12662 0.244
NP_442015.1_10 Forward -343 -330 0.412608 0.227
NP_440416.1_9 Forward -262 -243 -15.6352 0.196
NP_443052.1_9 Reverse -14 -33 -4.6221 0.259
NP_443052.1_9 Forward -262 -243 -7.08038 0.293
NP_440261.1_5 Reverse -148 -161 -6.66722 0.201
NP_440988.1_10 Forward -233 -219 4.80201 0.25
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCTATTCGCCTCCAGGTGCTAACTCTGCTGGAAAATCAAGAACAGTGCGTCTGTGACCTTTGCGACCAACTGAATATTAGTCAATCCAAGTTATCTTTTCACCTCAAACGCCTGCGGGATGCGGAATTGGTGCACACTCGCCAGGACGGCCGCTGGATTTATTACCGTCTCAATCCCGAACAATTTCACCATCTACGGCATTACCTGGAATCCTATGGCCAAGTAACCCAAGCCTATGTTCCCCGCCATTGCTGTGACTGATTGGCAGTTTGGCCATGGCATATCTCCATGTCGTCCCAATCCATCCCTAAAAAATAGCCCAAACAAAGGGCATTCTTTCCCCTGTTTTTTCCTAGACGTCGCCTTTACAGCGGCAACGGTGTCGGGGTATGGTCTGTA

CDS

ATGGGAGAAGCTTTAAACAAAGGGATTTATTGCCCCTTTGATCGTAATTGCGCAATGGTGTCTATCCGTCCGTCCGTCCGTCATACCCCCGCCTATGTGCCTGGGGAACAGCCCCAAACCAACGATTTTATCAAGCTCAACACCAACGAAAATCCCTACGATCCTCCCGCCCAGGTGTTGGCAGCGGTGGCAGCGGAGTTACCAAAAGTAAGGCTTTACCCTGATCCCGTTTCGACCCAGTTACGTCAAGCAGCGGCGGATTTGTATGGAGTGGATTTAAATCAGGTTTTAGCAGGCAATGGCTCCGACGATATTCTCAATATTGTGGTGCGTACCTTTGTCGATCCAGGGGAAACTGTTGCCTTTTTAGATCTTACTTACTCCCTATATGAAACGATCGCCTCAGTCCATGGGGCTAAGGTACAAAAAATTGCCACCGATGCCAATTTTGATTTAACCGGGCCGGTGATTTGTCCAGAGGCAAAACTGATTTTCCTCGCTTCCCCCAATCCCCCCAAAGGCAAGCATTTAAATCGAGAATTCCTTTGGCAGACCTGCGCCCAGGCGGAGGGAGTAGTGGTCATTGACGAAGCCTACGGGGATTTTTCCGACGAGGACCATTGGGACTTTCTGCAAGAGTTTGACAATGTGATTATTTCCCGTACCCTTTCCAAGAGTTATAGCCTGGCGGGGATGCGGGTGGGTTTGGCGATCGCCGCTCCGGCCTTGATTGAAGAAATGGATAAGGTGCGGGATTCCTACAACTTGGATCGTTTGGCCCAGGTATTGGGCACCGCCGCTTTACGGAACCAGGCTGAATTTGTGCCCCTCTGGGAAAAGGTACGCCACACTCGCACCCGTTTAATGGAGCAATTGGCGGAGTTAGATTTCCAGGTATGTCCCTCGGATGCCAATTTTGTGTTTGCCGCTCCCCGTTGGATGGCCGCCGCTGACCTGTACCAAGCCTTAAAGGAAAAGAAAATTCTGGTGCGTTACTTTAACCATCCCCGCATTACCGATTATCTCCGCATTACCGTGGGTACTGACGGGGAAATTGATCAACTACTGTTGGCGATCGCCAGTTTGAAAGGGTCTTTGGGATAG

Protein

MGEALNKGIYCPFDRNCAMVSIRPSVRHTPAYVPGEQPQTNDFIKLNTNENPYDPPAQVLAAVAAELPKVRLYPDPVSTQLRQAAADLYGVDLNQVLAGNGSDDILNIVVRTFVDPGETVAFLDLTYSLYETIASVHGAKVQKIATDANFDLTGPVICPEAKLIFLASPNPPKGKHLNREFLWQTCAQAEGVVVIDEAYGDFSDEDHWDFLQEFDNVIISRTLSKSYSLAGMRVGLAIAAPALIEEMDKVRDSYNLDRLAQVLGTAALRNQAEFVPLWEKVRHTRTRLMEQLAELDFQVCPSDANFVFAAPRWMAAADLYQALKEKKILVRYFNHPRITDYLRITVGTDGEIDQLLLAIASLKGSLG