Your browser is old and dusty. Try Google Chrome!

Details for sll1957

ORF sll1957
Accession NP_441182.1
Symbol
Category transcriptional regulator
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -111 -97 14.0609 0.154
NP_441098.1_3 Reverse -23 -42 -5.83193 0.28
NP_440637.1_7 Forward -206 -187 9.3409 0.259
NP_001035873.1_1 Reverse -348 -367 15.3876 0.252
NP_443027.1_4 Forward -104 -94 10.5014 0.128
NP_441250.1_3 Reverse -225 -244 1.76941 0.284
NP_440061.1_9 Reverse -50 -64 6.0955 0.261
NP_442972.1_2 Forward -363 -349 16.5185 0.136
NP_440304.1_4 Forward -133 -123 1.94665 0.299
NP_441352.1_2 Reverse -373 -392 2.75272 0.222
NP_442742.1_9 Reverse -208 -227 -13.3736 0.274
NP_441083.1_5 Forward -152 -142 1.94665 0.197
NP_441434.1_1 Forward -353 -339 10.0383 0.233
NP_441434.1_1 Reverse -196 -210 8.60589 0.254
NP_441738.1_2 Forward -47 -40 8.1019 0.204
NP_442889.1_10 Reverse -1 -20 10.8152 0.272
NP_441716.1_2 Reverse -286 -305 5.36543 0.229
NP_442596.1_10 Reverse -175 -194 11.3075 0.262
NP_442145.1_4 Forward -243 -224 3.00757 0.299
NP_440470.1_5 Reverse -226 -245 7.87766 0.268
NP_440842.1_4 Reverse -24 -43 -0.21493 0.292
NP_441013.1_3 Forward -73 -54 6.29264 0.281
NP_442782.1_2 Forward -216 -202 1.37622 0.281
NP_442782.1_2 Reverse -306 -320 0.491246 0.289
NP_442205.1_9 Forward -108 -92 13.5299 0.0479
NP_441127.1_1 Reverse -194 -208 9.04604 0.283
NP_442690.1_1 Reverse -236 -255 -15.4385 0.28
NP_442064.1_1 Reverse -35 -54 -8.65367 0.259
NP_440809.1_2 Forward -149 -130 -2.36049 0.275
NP_441550.1_7 Reverse -221 -240 18.0934 0.232
NP_441916.1_10 Forward -57 -38 0.786102 0.275
NP_441916.1_10 Forward -219 -200 -0.000545616 0.294
NP_440569.1_7 Reverse -125 -144 10.4225 0.286
NP_442996.1_1 Forward -245 -226 5.1084 0.247
NP_439966.1_7 Forward -184 -174 4.69947 0.263
NP_441514.1_4 Reverse -28 -47 13.0855 0.272
NP_441678.1_9 Reverse -163 -182 3.53937 0.218
NP_439908.1_5 Reverse -351 -370 9.14423 0.298
NP_442281.1_1 Forward -394 -380 1.86729 0.285
NP_441334.1_6 Forward -262 -243 20.8456 0.0617
NP_441079.1_7 Forward -245 -226 -0.689632 0.2
NP_441079.1_7 Reverse -226 -245 -4.42619 0.25
NP_441795.1_4 Forward -254 -241 17.7053 0.211
NP_440382.1_2 Forward -243 -224 2.9486 0.275
NP_442970.1_3 Reverse -227 -245 14.278 0.174
NP_440919.1_7 Forward -326 -308 16.5377 0.142
NP_440464.1_10 Forward -60 -50 14.345 0.169
NP_442719.1_2 Forward -211 -193 -8.63467 0.252
NP_442719.1_2 Reverse -240 -258 -10.3063 0.272
NP_441251.1_8 Forward -363 -350 14.2901 0.254
NP_441612.1_2 Reverse -52 -62 6.51622 0.287
NP_440346.1_6 Reverse -216 -226 16.7711 0.14
NP_442724.1_1 Reverse -250 -260 17.5813 0.259
NP_441445.1_1 Reverse -134 -153 9.43923 0.104
NP_442192.1_5 Forward -61 -42 12.9791 0.193
NP_441819.1_2 Forward -260 -241 16.7584 0.27
NP_441819.1_5 Forward -258 -239 14.3711 0.195
NP_441819.1_5 Forward -269 -250 12.0793 0.247
NP_442347.1_2 Reverse -94 -103 6.29291 0.175
NP_442347.1_2 Reverse -290 -299 5.70292 0.226
NP_442998.1_5 Forward -249 -239 8.82982 0.261
NP_442998.1_5 Reverse -244 -254 8.53483 0.261
NP_442998.1_5 Forward -217 -207 7.84651 0.28
NP_442504.1_4 Reverse -10 -29 9.40425 0.114
NP_441090.1_2 Forward -144 -125 10.6192 0.0791
NP_440709.1_1 Reverse -240 -259 5.80018 0.163
NP_441866.1_4 Reverse -384 -397 12.564 0.282
NP_440306.1_8 Forward -168 -149 -1.96793 0.241
NP_440677.1_6 Reverse -183 -202 9.83255 0.27
NP_441340.1_9 Reverse -223 -233 7.00193 0.297
NP_439909.1_6 Forward -226 -207 17.2074 0.234
NP_442327.1_3 Forward -246 -227 4.53544 0.283
NP_443028.1_4 Reverse -363 -382 8.34704 0.293
NP_440586.1_1 Reverse -135 -154 0.392778 0.237
NP_442959.1_5 Forward -49 -30 9.73422 0.224
NP_442959.1_5 Forward -30 -11 8.45592 0.224
NP_442959.1_5 Reverse -31 -50 8.25926 0.224
NP_441232.1_2 Forward -111 -92 16.5191 0.0778
NP_439937.1_9 Reverse -51 -68 -8.61494 0.176
NP_441138.1_5 Reverse -230 -243 2.92653 0.297
NP_440819.1_5 Forward -357 -349 7.68924 0.266
NP_442114.1_8 Forward -246 -232 9.83206 0.234
NP_440350.1_1 Forward -128 -109 1.86774 0.21
NP_442129.1_6 Forward -254 -235 14.2373 0.246
NP_442077.1_9 Forward -45 -26 -6.39206 0.289
NP_442710.1_6 Reverse -322 -341 10.8159 0.204
NP_442710.1_7 Reverse -333 -352 -0.783387 0.213
NP_442710.1_7 Reverse -9 -28 -7.12663 0.294
NP_441929.1_7 Forward -329 -310 13.9625 0.232
NP_440936.1_2 Reverse -223 -242 15.7324 0.16
NP_441410.1_3 Forward -58 -39 3.83436 0.295
NP_442780.1_3 Reverse -225 -244 8.45061 0.258
NP_442872.1_1 Forward -197 -178 -9.63698 0.241
NP_440603.1_9 Forward -159 -140 2.75272 0.278
NP_441052.1_2 Forward -61 -51 3.02829 0.185
NP_441004.1_4 Forward -134 -124 8.73149 0.267
NP_440296.1_6 Forward -46 -28 9.83765 0.298
NP_441157.1_1 Forward -240 -226 5.30886 0.241
NP_441668.1_5 Reverse -192 -211 8.55425 0.232
NP_441396.1_5 Forward -117 -108 9.24284 0.21
NP_441396.1_5 Forward -224 -215 8.1612 0.224
NP_442689.1_8 Forward -264 -247 -3.79607 0.252
NP_442689.1_8 Reverse -240 -257 -8.22096 0.294
NP_442024.1_7 Forward -262 -243 14.5352 0.291
NP_441432.1_9 Forward -262 -249 10.1497 0.256
NP_441732.1_2 Reverse -48 -64 -16.9527 0.223
NP_441057.1_4 Forward -77 -59 -2.73412 0.275
NP_442400.1_10 Reverse -250 -263 9.80195 0.27
NP_442749.1_5 Forward -244 -227 11.2123 0.183
NP_441629.1_3 Forward -152 -133 -4.81951 0.299
NP_441710.1_3 Reverse -352 -371 17.699 0.0712
NP_441126.1_1 Forward -161 -142 13.3448 0.223
NP_441888.1_9 Forward -315 -296 15.0437 0.26
NP_441050.1_5 Forward -220 -202 -2.73412 0.284
NP_441329.1_3 Reverse -253 -263 14.8103 0.25
NP_440671.1_4 Reverse -137 -151 11.2093 0.138
NP_440594.1_5 Forward -48 -29 6.68515 0.293
NP_442254.1_1 Forward -332 -313 -5.40875 0.282
NP_442497.1_1 Reverse -52 -71 10.0284 0.256
NP_442193.1_1 Reverse -174 -192 17.6204 0.113
NP_441541.1_1 Forward -42 -24 -4.8681 0.285
NP_440212.1_9 Forward -48 -29 5.07836 0.181
NP_440546.1_6 Forward -221 -202 9.83255 0.247
NP_441497.1_3 Reverse -143 -162 -11.5053 0.294
NP_442479.1_9 Reverse -143 -162 -6.09707 0.266
NP_442479.1_9 Forward -213 -194 -8.65367 0.266
NP_441474.1_1 Forward -193 -174 -3.04956 0.29
NP_442402.1_4 Forward -69 -50 5.40686 0.144
NP_442402.1_6 Reverse -189 -198 14.1594 0.241
NP_441848.1_4 Reverse -21 -37 8.3146 0.288
NP_441848.1_4 Reverse -239 -255 7.26419 0.292
NP_441848.1_7 Reverse -203 -222 -1.18128 0.246
NP_441848.1_7 Reverse -204 -223 -4.03287 0.287
NP_441843.2_2 Forward -284 -265 14.8466 0.219
NP_442829.1_2 Forward -50 -34 9.10743 0.287
NP_442837.1_3 Reverse -94 -101 6.52896 0.2
NP_441959.1_8 Reverse -24 -37 10.2518 0.286
NP_441252.1_6 Reverse -148 -155 14.3954 0.168
NP_442532.1_1 Reverse -3 -17 9.23901 0.284
NP_442533.1_1 Reverse -176 -195 -15.8318 0.257
NP_440854.1_5 Reverse -339 -353 19.301 0.188
NP_441697.1_5 Reverse -19 -38 -8.35597 0.258
NP_441697.1_5 Forward -49 -30 -9.02441 0.268
NP_441697.1_5 Forward -28 -9 -9.69285 0.273
NP_441697.1_5 Forward -352 -333 -10.0748 0.278
NP_441697.1_5 Reverse -334 -353 -11.3162 0.295
NP_441028.1_6 Reverse -349 -359 4.7978 0.277
NP_442202.1_6 Forward -60 -41 2.26107 0.265
NP_441527.1_4 Forward -361 -342 -2.33998 0.156
NP_441527.1_4 Forward -362 -343 -5.5867 0.204
NP_441527.1_4 Reverse -363 -382 -10.7433 0.274
NP_441106.1_3 Forward -262 -243 12.7825 0.208
NP_440886.1_7 Reverse -108 -118 3.42118 0.282
NP_439899.1_1 Forward -262 -244 4.57667 0.263
NP_441463.1_2 Forward -264 -246 1.04342 0.261
NP_441401.1_4 Forward -244 -231 15.2606 0.186
NP_441962.1_4 Forward -112 -93 -13.3736 0.272
NP_442020.1_1 Forward -255 -236 -1.18128 0.291
NP_441193.1_1 Reverse -96 -115 9.14342 0.277
NP_442090.1_2 Reverse -234 -253 5.68135 0.296
NP_440766.1_5 Reverse -148 -160 9.85211 0.275
NP_441489.1_3 Reverse -240 -254 10.7067 0.231
NP_442582.1_3 Reverse -249 -263 19.0145 0.0839
NP_443037.1_6 Reverse -299 -318 6.58763 0.194
NP_442936.1_10 Forward -41 -27 8.59394 0.269
NP_442862.1_3 Reverse -239 -256 9.67528 0.219
NP_442862.1_3 Reverse -228 -245 5.84037 0.267
NP_441885.1_5 Forward -61 -51 5.28991 0.0729
NP_442703.1_9 Forward -305 -287 4.05072 0.262
NP_442341.1_7 Reverse -51 -65 13.7659 0.0334
NP_441173.1_9 Forward -312 -304 12.1137 0.21
NP_441183.1_1 Reverse -306 -325 23.7246 0.013
NP_441397.1_5 Reverse -33 -49 18.5636 0.134
NP_441397.1_8 Reverse -22 -35 14.4811 0.192
NP_440305.1_1 Reverse -248 -262 19.0145 0.0522
NP_443052.1_9 Reverse -100 -119 -3.93378 0.253
NP_440072.1_5 Reverse -174 -192 -2.93078 0.271
NP_442116.1_6 Reverse -20 -37 7.02305 0.266
NP_442116.1_6 Reverse -249 -266 6.06813 0.287
NP_442226.1_1 Reverse -243 -262 10.8159 0.281
NP_442046.1_2 Reverse -28 -41 17.3445 0.193
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCAATAAATTCAGCAATGTACTTTTTCATTTGCGTCTTCAAAAAGGGAAAAAGAGTTTATTTCTTGTTAGGCTCAATTTAGGCCTAGGTTTAGCCAACTAGTTTGGATCAAAAATATCCACCACGAAAGGTAGCACTGTTTTGTCAAATTTTGTACAAAATCAACGAAAATTTTACTTTTTGGGGGCAAGAATTTGGCTACATTTCCCCAGCATCTAACCCACTCCCTAGTTTTGAACGGAATCTTTGCCCAATCAGCCTGCACAGTGGGGTAATGTCGTAGCTAGATGGGGGGTGAATGGGATCAATTCACACCATAATACATCCAGAGCTTTTCGGTGGTTATCCGCAAGAAAATCGCATAAATTATTTTTAATATCCTCATATTTTTCTATATTGTC

CDS

GTGAAAACAACGGAAAAAGACCTAATCAGTGTCGGGTTTCAAGCTTTGTCTGACCCTATTCGCCTCCAGGTGCTAACTCTGCTGGAAAATCAAGAACAGTGCGTCTGTGACCTTTGCGACCAACTGAATATTAGTCAATCCAAGTTATCTTTTCACCTCAAACGCCTGCGGGATGCGGAATTGGTGCACACTCGCCAGGACGGCCGCTGGATTTATTACCGTCTCAATCCCGAACAATTTCACCATCTACGGCATTACCTGGAATCCTATGGCCAAGTAACCCAAGCCTATGTTCCCCGCCATTGCTGTGACTGA

Protein

MKTTEKDLISVGFQALSDPIRLQVLTLLENQEQCVCDLCDQLNISQSKLSFHLKRLRDAELVHTRQDGRWIYYRLNPEQFHHLRHYLESYGQVTQAYVPRHCCD