Your browser is old and dusty. Try Google Chrome!

Details for sll1949

ORF sll1949
Accession NP_441193.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -250 -264 2.45787 0.176
NP_442291.1_5 Forward -160 -144 5.46674 0.0762
NP_441453.1_1 Reverse -95 -113 3.45998 0.264
NP_441453.1_4 Forward -159 -151 7.19758 0.0757
NP_441453.1_4 Reverse -150 -158 6.70593 0.121
NP_441623.1_1 Forward -351 -333 -1.16082 0.24
NP_442151.1_6 Reverse -150 -164 6.19444 0.244
NP_441818.1_1 Forward -158 -147 8.51463 0.288
NP_440226.1_1 Reverse -150 -169 10.4225 0.0622
NP_440226.1_1 Forward -159 -140 6.4893 0.128
NP_442173.1_1 Forward -158 -150 5.82095 0.2
NP_442173.1_1 Reverse -151 -159 5.72262 0.203
NP_442752.1_4 Reverse -150 -157 13.8055 0.0199
NP_442752.1_4 Forward -116 -109 6.52896 0.154
NP_443027.1_4 Reverse -148 -158 7.25653 0.24
NP_440784.1_7 Forward -158 -151 6.23397 0.241
NP_440784.1_7 Reverse -151 -158 6.13563 0.241
NP_440061.1_9 Forward -161 -147 13.2736 0.0819
NP_441054.1_3 Reverse -113 -131 16.8045 0.171
NP_441054.1_4 Reverse -140 -158 11.5239 0.0619
NP_442062.1_8 Reverse -150 -160 7.84651 0.0871
NP_442062.1_8 Forward -159 -149 7.64985 0.0911
NP_442062.1_8 Forward -13 -3 2.7333 0.297
NP_441900.1_2 Forward -393 -375 -6.27474 0.293
NP_440304.1_4 Forward -283 -273 2.7333 0.299
NP_442242.1_4 Reverse -151 -158 12.4288 0.0393
NP_441492.1_5 Reverse -163 -182 1.52129 0.3
NP_441208.1_9 Forward -162 -148 7.07942 0.227
NP_441083.1_5 Forward -159 -149 11.0914 0.0166
NP_441083.1_5 Reverse -150 -160 10.6981 0.0184
NP_441434.1_1 Forward -145 -131 8.79688 0.252
NP_441738.1_2 Forward -157 -150 15.28 0.0102
NP_441558.1_5 Reverse -148 -167 4.42435 0.281
NP_440209.1_1 Reverse -150 -158 14.8674 0.012
NP_440209.1_1 Forward -159 -151 8.57422 0.0425
NP_440056.1_1 Reverse -371 -390 12.5858 0.168
NP_440056.1_9 Reverse -219 -238 14.0678 0.272
NP_441713.1_1 Forward -165 -146 -5.31042 0.113
NP_441792.1_5 Forward -238 -222 12.7432 0.19
NP_441716.1_1 Forward -358 -344 5.99778 0.208
NP_441716.1_1 Reverse -150 -164 2.94952 0.284
NP_441163.1_1 Forward -272 -255 5.83964 0.267
NP_440906.1_5 Forward -158 -151 12.0355 0.0724
NP_440906.1_5 Reverse -151 -158 12.0355 0.0724
NP_440012.1_6 Forward -210 -191 14.1591 0.157
NP_440438.2_8 Forward -173 -154 15.2408 0.0486
NP_440438.2_8 Forward -183 -164 13.0775 0.0579
NP_442442.1_5 Forward -230 -211 15.5357 0.156
NP_440747.1_10 Forward -162 -150 14.9853 0.00221
NP_440747.1_10 Reverse -147 -159 7.02048 0.0108
NP_441486.1_1 Reverse -147 -161 5.21113 0.0384
NP_441486.1_1 Forward -162 -148 -3.83532 0.183
NP_441194.1_1 Reverse -163 -182 27.4535 0.000238
NP_441194.1_2 Reverse -204 -223 26.2529 0.00188
NP_441194.1_3 Reverse -328 -346 25.9785 0.00346
NP_441194.1_7 Reverse -284 -303 19.8623 0.117
NP_443018.1_3 Forward -158 -151 5.34899 0.212
NP_443018.1_3 Reverse -151 -158 5.34899 0.212
NP_440376.1_1 Forward -159 -150 9.73449 0.0365
NP_440376.1_1 Reverse -150 -159 9.73449 0.0365
NP_441857.1_6 Reverse -216 -226 13.5497 0.269
NP_442687.1_7 Reverse -149 -159 7.35486 0.134
NP_442687.1_7 Forward -183 -173 4.3066 0.255
NP_441077.1_6 Reverse -160 -176 1.8378 0.294
NP_441846.1_10 Reverse -36 -55 -19.8634 0.256
NP_441846.1_10 Reverse -34 -53 -21.6334 0.256
NP_440642.1_8 Forward -157 -138 23.1679 0.00763
NP_442658.1_1 Forward -266 -256 4.7978 0.297
NP_441855.2_4 Forward -233 -214 9.42666 0.278
NP_442782.1_2 Reverse -212 -226 5.1128 0.247
NP_442544.1_6 Reverse -143 -162 -5.80207 0.298
NP_441414.1_9 Reverse -150 -169 -4.03212 0.145
NP_441414.1_9 Forward -159 -140 -9.24366 0.256
NP_441958.1_5 Reverse -149 -159 2.7333 0.0378
NP_441958.1_5 Forward -160 -150 2.53664 0.0409
NP_441127.1_1 Forward -281 -267 7.66941 0.3
NP_440203.1_5 Reverse -120 -130 10.1076 0.239
NP_442816.1_7 Reverse -308 -327 10.3605 0.229
NP_439905.1_1 Forward -158 -145 11.819 0.204
NP_440984.1_7 Reverse -145 -159 11.5043 0.122
NP_440984.1_7 Forward -164 -150 6.88276 0.195
NP_442364.1_2 Forward -138 -119 9.83255 0.279
NP_439990.1_5 Forward -164 -151 7.6891 0.186
NP_442911.1_2 Forward -169 -150 1.86774 0.0556
NP_442911.1_2 Reverse -140 -159 -0.0988766 0.0718
NP_442064.1_1 Forward -164 -145 -5.01543 0.209
NP_442002.1_1 Reverse -32 -50 -3.32411 0.211
NP_442438.1_10 Reverse -145 -159 1.76955 0.188
NP_442438.1_10 Forward -210 -196 -0.492064 0.264
NP_440484.1_3 Forward -98 -84 11.5043 0.242
NP_440484.1_3 Reverse -148 -162 8.45605 0.298
NP_440147.1_4 Forward -161 -148 9.2624 0.0423
NP_440147.1_4 Forward -236 -223 1.29759 0.233
NP_440147.1_4 Reverse -148 -161 -0.669033 0.294
NP_441550.1_8 Reverse -148 -158 5.78111 0.23
NP_441550.1_8 Forward -161 -151 5.48612 0.247
NP_441041.1_4 Reverse -34 -53 1.67108 0.0792
NP_441041.1_4 Forward -379 -360 -13.1769 0.282
NP_442004.1_6 Reverse -150 -164 2.45787 0.264
NP_439966.1_7 Reverse -148 -158 5.48612 0.22
NP_442941.1_3 Forward -158 -148 9.51814 0.0306
NP_442941.1_3 Reverse -151 -161 1.25834 0.15
NP_442256.1_2 Forward -281 -263 -1.55415 0.175
NP_441087.1_3 Reverse -319 -334 13.4512 0.298
NP_441644.1_6 Reverse -150 -160 13.0576 0.0244
NP_441644.1_6 Forward -159 -149 8.53436 0.0982
NP_442215.1_2 Forward -161 -145 -4.66135 0.237
NP_442215.1_2 Reverse -148 -164 -6.7263 0.278
NP_440253.1_2 Reverse -67 -85 -2.3408 0.265
NP_440929.1_8 Forward -159 -150 9.73449 0.0257
NP_440929.1_8 Reverse -150 -159 9.4395 0.0326
NP_442933.1_1 Reverse -308 -327 6.44528 0.27
NP_442933.1_10 Reverse -150 -159 13.9627 0.0192
NP_442933.1_10 Reverse -229 -238 9.63616 0.0616
NP_442933.1_10 Forward -159 -150 8.1612 0.0885
NP_441751.2_8 Forward -237 -223 -3.93365 0.157
NP_441751.2_8 Reverse -151 -165 -5.01529 0.19
NP_442554.1_8 Forward -158 -148 6.46988 0.117
NP_442554.1_8 Reverse -151 -161 5.78156 0.138
NP_442142.1_4 Forward -162 -149 12.5067 0.0442
NP_442142.1_4 Forward -376 -363 5.32859 0.194
NP_442292.1_1 Forward -158 -149 8.75118 0.0306
NP_442292.1_1 Reverse -151 -160 8.65285 0.0335
NP_442476.1_6 Forward -158 -144 13.0776 0.0454
NP_442476.1_6 Reverse -5 -19 11.5043 0.056
NP_440895.1_6 Forward -165 -152 21.9471 0.0108
NP_443009.1_5 Forward -160 -149 5.95804 0.18
NP_443009.1_5 Reverse -3 -14 4.67974 0.234
NP_442301.1_2 Forward -195 -176 3.24359 0.299
NP_441715.1_4 Forward -158 -148 7.64985 0.108
NP_440730.1_4 Reverse -224 -243 -5.21209 0.298
NP_440464.1_10 Reverse -151 -161 12.7217 0.189
NP_441468.1_1 Forward -158 -151 6.13563 0.209
NP_441468.1_1 Reverse -151 -158 6.0373 0.223
NP_441673.1_1 Forward -159 -150 11.1111 0.0121
NP_441673.1_1 Reverse -150 -159 11.0128 0.018
NP_441172.1_1 Forward -58 -40 3.06741 0.198
NP_441826.1_2 Reverse -364 -378 -2.36035 0.271
NP_442490.1_9 Reverse -217 -236 -3.73712 0.244
NP_442490.1_10 Reverse -113 -131 13.5888 0.148
NP_441764.1_4 Reverse -164 -181 15.2337 0.116
NP_441764.1_4 Reverse -154 -171 13.1329 0.172
NP_442868.1_6 Reverse -148 -158 9.41981 0.0485
NP_442868.1_6 Reverse -237 -247 0.57002 0.217
NP_442868.1_6 Forward -161 -151 0.0783647 0.248
NP_441251.1_8 Forward -323 -310 14.7675 0.254
NP_442677.1_3 Forward -143 -124 -8.65367 0.287
NP_442427.1_8 Reverse -141 -160 8.06259 0.203
NP_442808.1_1 Forward -160 -150 7.35439 0.0814
NP_440145.1_5 Forward -202 -183 9.93088 0.265
NP_442113.1_10 Forward -53 -34 -6.98204 0.265
NP_441114.1_3 Reverse -257 -266 14.5527 0.193
NP_441878.1_6 Forward -160 -150 0.668351 0.139
NP_441878.1_6 Reverse -149 -159 0.57002 0.14
NP_441036.1_3 Forward -96 -77 -5.40875 0.286
NP_441036.1_8 Forward -160 -150 6.76487 0.215
NP_441534.1_7 Forward -301 -282 15.9291 0.162
NP_441557.1_5 Forward -159 -150 10.2261 0.0144
NP_441557.1_5 Reverse -150 -159 10.1278 0.0188
NP_441445.1_1 Forward -168 -149 4.22769 0.197
NP_441445.1_1 Reverse -141 -160 -0.39387 0.291
NP_441590.1_4 Reverse -103 -122 6.68515 0.254
NP_440101.1_10 Forward -379 -360 4.32602 0.216
NP_442397.1_9 Reverse -249 -268 6.19431 0.246
NP_442397.1_9 Forward -399 -380 1.17943 0.291
NP_441116.1_9 Reverse -137 -151 11.7993 0.268
NP_442444.1_6 Forward -98 -80 13.501 0.244
NP_441467.1_10 Forward -30 -16 6.29277 0.281
NP_442347.1_2 Forward -158 -149 3.93297 0.284
NP_442347.1_2 Forward -12 -3 3.53964 0.284
NP_442645.1_2 Reverse -362 -381 -20.2567 0.288
NP_441633.1_3 Reverse -148 -161 -6.37223 0.248
NP_441633.1_3 Reverse -2 -15 -7.25721 0.3
NP_440136.1_2 Forward -158 -151 6.23397 0.171
NP_440136.1_2 Reverse -151 -158 6.13563 0.193
NP_440136.1_2 Reverse -5 -12 3.97235 0.288
NP_441728.2_4 Reverse -153 -172 11.6018 0.292
NP_442998.1_10 Forward -157 -150 15.5754 0.0102
NP_442998.1_10 Reverse -152 -159 5.74231 0.255
NP_440899.1_8 Reverse -77 -96 -10.522 0.28
NP_440299.1_1 Forward -163 -150 9.75346 0.0661
NP_440299.1_1 Reverse -146 -159 4.34528 0.209
NP_441799.1_1 Forward -163 -149 8.06211 0.125
NP_441799.1_1 Reverse -146 -160 7.47213 0.141
NP_440640.1_6 Reverse -25 -44 2.85105 0.23
NP_441007.1_10 Reverse -145 -158 6.31247 0.167
NP_441435.1_9 Reverse -372 -391 18.2882 0.29
NP_440256.1_1 Forward -162 -143 -2.85214 0.123
NP_441559.1_8 Forward -215 -201 -5.60527 0.267
NP_440915.1_1 Reverse -209 -227 16.3421 0.295
NP_442158.1_4 Forward -123 -113 14.4347 0.182
NP_441296.1_9 Forward -49 -36 17.9149 0.106
NP_441296.1_9 Forward -198 -185 8.86849 0.289
NP_442866.1_1 Reverse -206 -225 -6.49039 0.255
NP_440306.1_8 Reverse -78 -97 0.785326 0.204
NP_440306.1_8 Forward -82 -63 -0.00131823 0.211
NP_439985.1_7 Reverse -237 -256 3.44104 0.266
NP_442993.1_1 Reverse -239 -255 -8.10294 0.153
NP_442993.1_1 Forward -265 -249 -9.28291 0.181
NP_442386.1_9 Reverse -3 -12 7.2758 0.219
NP_441340.1_5 Reverse -151 -158 6.13563 0.175
NP_441340.1_5 Forward -158 -151 5.93897 0.198
NP_442327.1_3 Reverse -302 -321 12.9387 0.182
NP_440586.1_8 Reverse -151 -158 11.4451 0.0645
NP_440586.1_9 Reverse -232 -251 7.7676 0.273
NP_442251.1_6 Forward -158 -151 12.0355 0.0627
NP_441262.1_3 Reverse -150 -157 14.7888 0.0223
NP_440027.1_4 Forward -182 -163 8.46259 0.126
NP_443051.1_1 Reverse -149 -158 0.786375 0.125
NP_443051.1_1 Forward -160 -151 0.688044 0.134
NP_439937.1_9 Reverse -11 -28 -12.2532 0.27
NP_439937.1_9 Forward -160 -143 -15.5964 0.287
NP_441167.1_1 Reverse -163 -182 5.211 0.237
NP_440408.1_7 Reverse -184 -203 9.83255 0.255
NP_440408.1_7 Forward -159 -140 7.27595 0.29
NP_440372.1_2 Reverse -151 -158 6.72562 0.0929
NP_440372.1_2 Forward -158 -151 6.62729 0.151
NP_441181.1_6 Reverse -371 -389 4.14905 0.254
NP_439977.1_5 Reverse -266 -285 -1.7705 0.26
NP_442384.1_10 Forward -159 -146 17.1289 0.00642
NP_442384.1_10 Reverse -150 -163 5.72248 0.121
NP_442114.1_4 Reverse -4 -15 8.51513 0.197
NP_442114.1_8 Reverse -14 -28 6.68548 0.234
NP_441877.1_9 Forward -174 -157 3.57876 0.284
NP_442572.1_6 Forward -199 -180 7.07928 0.295
NP_442790.1_4 Forward -247 -228 -14.6519 0.278
NP_441689.1_5 Reverse -362 -372 5.09279 0.285
NP_440531.1_6 Reverse -142 -161 -1.37718 0.231
NP_441965.1_10 Reverse -147 -163 10.285 0.107
NP_441965.1_10 Reverse -199 -215 9.10498 0.123
NP_441896.1_5 Reverse -217 -224 15.3787 0.268
NP_440894.1_10 Forward -350 -331 2.94938 0.279
NP_440888.1_2 Forward -159 -145 6.68548 0.223
NP_441748.1_3 Reverse -145 -164 12.8065 0.247
NP_441949.1_5 Reverse -154 -173 14.5362 0.178
NP_441759.1_2 Reverse -194 -213 -0.983855 0.287
NP_441543.1_2 Reverse -151 -160 7.47288 0.117
NP_441543.1_2 Forward -158 -149 7.17789 0.131
NP_441543.1_3 Reverse -93 -107 9.53707 0.229
NP_441469.1_8 Forward -280 -271 5.11294 0.289
NP_442315.1_2 Forward -122 -110 9.87208 0.291
NP_443064.1_6 Forward -159 -149 11.5004 0.13
NP_442578.1_7 Reverse -151 -158 5.93897 0.183
NP_440220.1_4 Forward -228 -209 -1.77127 0.264
NP_441462.1_2 Reverse -150 -160 2.14332 0.0801
NP_441462.1_2 Forward -159 -149 1.84832 0.081
NP_443062.1_6 Forward -167 -148 4.81767 0.214
NP_442204.1_1 Reverse -146 -157 -0.0396598 0.285
NP_442204.1_5 Forward -23 -4 -0.000545616 0.274
NP_441560.1_8 Forward -164 -145 12.2918 0.255
NP_440454.1_2 Forward -321 -307 19.7785 0.114
NP_440516.1_2 Forward -165 -147 5.82068 0.122
NP_440516.1_8 Reverse -150 -159 15.6344 0.00582
NP_440516.1_8 Forward -159 -150 7.47288 0.0581
NP_442080.1_7 Reverse -245 -264 -1.67217 0.287
NP_442428.1_5 Forward -158 -151 6.13563 0.209
NP_442428.1_5 Reverse -151 -158 6.0373 0.212
NP_440673.1_3 Forward -157 -150 12.4288 0.0426
NP_441052.1_2 Reverse -150 -160 10.3048 0.0289
NP_441052.1_2 Forward -159 -149 10.2065 0.0295
NP_442219.1_8 Reverse -252 -271 6.62097 0.292
NP_442219.1_9 Forward -158 -149 8.06287 0.0696
NP_442219.1_9 Reverse -151 -160 7.96454 0.0696
NP_442219.1_9 Forward -204 -195 2.65466 0.241
NP_440436.1_4 Forward -158 -149 13.9623 0.0193
NP_440436.1_4 Reverse -151 -160 13.9623 0.0193
NP_442414.1_10 Forward -378 -359 21.828 0.0305
NP_441719.1_4 Reverse -151 -158 6.72562 0.093
NP_441719.1_4 Forward -158 -151 6.62729 0.151
NP_442366.1_3 Reverse -149 -167 -3.22577 0.244
NP_442694.1_4 Forward -126 -117 13.3727 0.225
NP_440328.1_4 Reverse -144 -163 4.12936 0.17
NP_440728.1_1 Forward -310 -291 15.4366 0.216
NP_443054.1_2 Reverse -381 -395 7.07942 0.169
NP_441966.1_7 Forward -389 -370 2.75194 0.197
NP_441851.1_10 Forward -160 -150 6.07655 0.187
NP_441851.1_10 Reverse -149 -159 6.07655 0.187
NP_441851.1_10 Reverse -3 -13 4.40493 0.271
NP_442515.1_1 Forward -160 -146 8.35772 0.079
NP_441396.1_5 Forward -122 -113 8.1612 0.224
NP_441046.1_2 Forward -95 -76 6.58763 0.221
NP_441409.1_6 Forward -165 -146 1.37609 0.0606
NP_442843.1_1 Reverse -203 -222 -11.7019 0.291
NP_440431.1_3 Forward -160 -141 -5.31042 0.181
NP_442450.1_5 Reverse -227 -237 5.48657 0.242
NP_440588.1_2 Reverse -220 -239 4.81767 0.0762
NP_441031.1_1 Reverse -161 -180 4.70179 0.288
NP_442006.1_2 Reverse -176 -193 -17.6607 0.279
NP_442243.1_1 Reverse -243 -261 4.73828 0.193
NP_442243.1_1 Reverse -144 -162 -1.9482 0.283
NP_441078.1_4 Forward -159 -150 9.93116 0.0203
NP_441078.1_4 Reverse -150 -159 9.83282 0.0226
NP_442729.1_8 Forward -17 -4 5.42749 0.246
NP_441663.1_8 Reverse -144 -163 -3.83545 0.298
NP_442348.1_2 Reverse -255 -264 9.53783 0.28
NP_440526.1_3 Reverse -151 -162 6.44969 0.201
NP_441432.1_8 Reverse -149 -158 7.17789 0.102
NP_441432.1_8 Forward -160 -151 7.07956 0.105
NP_441432.1_9 Reverse -301 -314 10.9253 0.235
NP_441432.1_9 Reverse -300 -313 10.6345 0.245
NP_442320.1_8 Forward -19 -5 -2.55701 0.0913
NP_441732.1_2 Forward -163 -147 -7.80794 0.0935
NP_440760.1_1 Reverse -150 -169 -15.4385 0.147
NP_442400.1_10 Forward -104 -91 7.89211 0.281
NP_440713.1_4 Forward -215 -196 2.85105 0.256
NP_442489.1_7 Forward -159 -150 10.6195 0.00984
NP_442489.1_7 Reverse -150 -159 10.3245 0.0193
NP_440559.1_1 Forward -158 -149 14.1594 0.0317
NP_440559.1_1 Reverse -151 -160 7.96454 0.0739
NP_441659.2_8 Reverse -150 -160 14.828 0.00801
NP_441659.2_8 Forward -159 -149 8.63316 0.0405
NP_439956.1_7 Reverse -206 -225 13.3725 0.155
NP_442346.1_5 Reverse -149 -159 15.3197 0.00738
NP_442346.1_5 Forward -160 -150 6.96153 0.187
NP_442346.1_5 Forward -91 -81 4.3066 0.291
NP_440545.1_3 Forward -163 -146 -6.05768 0.268
NP_441856.1_3 Reverse -147 -166 7.96426 0.101
NP_440025.1_1 Forward -377 -358 8.45592 0.222
NP_442934.1_8 Reverse -123 -142 9.53756 0.266
NP_442603.1_7 Forward -159 -145 9.14375 0.155
NP_441833.1_4 Forward -158 -151 14.1004 0.0258
NP_441833.1_4 Reverse -151 -158 6.13563 0.198
NP_441329.1_1 Forward -328 -309 9.97848 0.194
NP_441329.1_1 Reverse -308 -327 9.7875 0.194
NP_442162.1_9 Forward -158 -151 6.62729 0.142
NP_442162.1_9 Reverse -151 -158 6.52896 0.178
NP_442140.1_3 Reverse -151 -161 10.7964 0.0902
NP_441671.1_6 Reverse -256 -275 8.55425 0.179
NP_441671.1_10 Reverse -328 -347 2.16274 0.257
NP_441813.1_5 Reverse -148 -158 8.33817 0.047
NP_440590.1_4 Forward -158 -145 8.77074 0.042
NP_440590.1_4 Forward -247 -234 -5.38892 0.277
NP_440590.1_4 Reverse -151 -164 -5.88057 0.293
NP_440567.1_1 Forward -158 -144 -0.000409212 0.261
NP_440567.1_1 Reverse -5 -19 -0.393733 0.281
NP_442497.1_10 Forward -158 -149 0.688044 0.141
NP_442497.1_10 Reverse -151 -160 0.589713 0.153
NP_440821.1_4 Reverse -2 -12 4.79825 0.123
NP_440821.1_4 Forward -161 -151 -0.314959 0.251
NP_440821.1_4 Reverse -148 -158 -0.41329 0.257
NP_441892.1_1 Forward -251 -234 2.10379 0.144
NP_442193.1_1 Reverse -224 -242 7.68896 0.282
NP_442270.1_9 Forward -384 -365 -11.0136 0.266
NP_442270.1_9 Forward -390 -371 -12.1936 0.291
NP_442138.1_10 Reverse -229 -248 -3.83545 0.242
NP_440546.1_4 Reverse -150 -160 8.00989 0.209
NP_440868.1_4 Reverse -146 -158 9.97041 0.0405
NP_440868.1_4 Forward -163 -151 5.93884 0.0879
NP_442402.1_4 Forward -302 -283 -8.85106 0.284
NP_442402.1_10 Forward -72 -62 11.6809 0.241
NP_441848.1_5 Reverse -296 -315 12.1291 0.269
NP_441084.1_6 Forward -92 -78 11.4772 0.201
NP_442039.1_4 Forward -12 -5 10.8555 0.109
NP_440825.1_7 Reverse -371 -381 11.7385 0.214
NP_442786.1_2 Forward -320 -301 11.6973 0.258
NP_442837.1_3 Reverse -230 -237 6.82395 0.184
NP_442837.1_3 Forward -158 -151 6.13563 0.25
NP_442837.1_3 Reverse -151 -158 5.93897 0.265
NP_440160.1_9 Reverse -211 -230 8.16093 0.27
NP_442053.1_1 Forward -159 -150 9.34117 0.0666
NP_442053.1_1 Reverse -150 -159 8.55452 0.0784
NP_440505.1_3 Reverse -148 -158 17.0896 0.00449
NP_440013.1_1 Reverse -76 -95 10.6184 0.241
NP_440914.1_1 Forward -159 -149 16.032 0.00231
NP_440914.1_1 Forward -264 -254 9.7862 0.172
NP_440914.1_1 Reverse -150 -160 7.83437 0.219
NP_442533.1_1 Reverse -33 -52 -15.9302 0.26
NP_442533.1_6 Forward -159 -150 7.66954 0.0897
NP_442533.1_6 Reverse -150 -159 7.37455 0.0898
NP_442232.1_3 Reverse -221 -240 -12.9802 0.282
NP_439944.1_9 Reverse -151 -161 8.53483 0.107
NP_441697.1_5 Forward -178 -159 -7.30556 0.242
NP_441028.1_6 Reverse -89 -99 5.38779 0.255
NP_441527.1_4 Forward -323 -304 -11.7937 0.284
NP_440115.1_6 Reverse -147 -157 15.0247 0.0505
NP_440115.1_6 Reverse -332 -342 4.60159 0.293
NP_440007.1_9 Reverse -373 -387 4.32615 0.267
NP_441972.1_5 Reverse -191 -210 -9.73531 0.293
NP_441106.1_1 Forward -160 -151 6.29291 0.0927
NP_441286.1_1 Reverse -149 -161 10.3637 0.0192
NP_441286.1_1 Forward -160 -148 3.18557 0.0485
NP_441286.1_1 Forward -206 -194 -2.81262 0.145
NP_440670.1_8 Forward -159 -150 16.5193 0.00214
NP_440670.1_8 Reverse -150 -159 9.4395 0.0559
NP_440886.1_7 Reverse -149 -159 4.01116 0.255
NP_442614.1_2 Reverse -150 -164 14.5526 0.0966
NP_442614.1_2 Forward -159 -145 6.58777 0.291
NP_439899.1_1 Forward -175 -157 5.55004 0.241
NP_441463.1_6 Reverse -136 -150 5.93276 0.287
NP_441626.1_2 Forward -158 -151 6.0373 0.212
NP_441626.1_2 Reverse -151 -158 6.0373 0.212
NP_442209.1_5 Reverse -239 -258 16.4323 0.242
NP_440107.1_5 Reverse -195 -214 -6.98204 0.272
NP_442794.1_1 Forward -163 -151 10.8554 0.0721
NP_442615.1_1 Forward -168 -150 -4.50408 0.188
NP_440387.1_1 Reverse -150 -166 -6.52964 0.292
NP_441836.1_2 Reverse -144 -163 -2.55715 0.23
NP_441193.1_1 Forward -239 -220 18.7798 0.176
NP_441193.1_3 Forward -307 -293 19.0758 0.258
NP_441193.1_6 Forward -89 -70 26.7455 0.00207
NP_441993.1_1 Reverse -256 -275 4.09075 0.225
NP_441156.1_1 Reverse -33 -52 11.6025 0.229
NP_441421.1_6 Reverse -158 -175 9.88781 0.28
NP_441237.1_9 Reverse -151 -161 10.7964 0.218
NP_442743.1_1 Reverse -104 -123 5.80018 0.268
NP_441133.1_1 Forward -125 -106 14.6508 0.2
NP_439910.1_2 Forward -256 -239 -22.184 0.215
NP_441332.1_6 Forward -186 -176 11.8404 0.244
NP_442509.1_9 Forward -159 -149 8.04271 0.192
NP_441885.1_5 Reverse -150 -160 11.3864 0.00668
NP_441885.1_5 Forward -159 -149 11.1898 0.00775
NP_441275.1_1 Forward -174 -156 2.57575 0.189
NP_442341.1_7 Reverse -149 -163 2.65453 0.249
NP_440409.1_10 Reverse -260 -279 8.75091 0.29
NP_443000.1_7 Reverse -148 -158 10.1081 0.0376
NP_443000.1_7 Forward -161 -151 0.57002 0.294
NP_441842.1_1 Forward -157 -144 19.7832 0.0111
NP_441842.1_10 Reverse -143 -157 7.37441 0.258
NP_440275.1_3 Reverse -148 -158 5.48657 0.145
NP_440275.1_3 Forward -161 -151 5.19158 0.161
NP_443060.1_5 Forward -167 -148 5.2102 0.271
NP_441804.1_8 Reverse -181 -200 19.469 0.22
NP_442373.1_2 Reverse -34 -53 -2.85214 0.198
NP_440216.1_1 Forward -159 -145 0.786239 0.0284
NP_440172.1_1 Forward -159 -149 5.48657 0.143
NP_440172.1_1 Reverse -150 -160 5.19158 0.149
NP_442015.1_10 Reverse -146 -159 8.86907 0.0585
NP_442015.1_10 Forward -163 -150 0.510939 0.224
NP_441111.1_7 Forward -158 -150 8.96754 0.0463
NP_441111.1_7 Reverse -151 -159 8.86921 0.0589
NP_441766.1_2 Forward -159 -150 7.86621 0.0703
NP_441766.1_2 Reverse -150 -159 7.66954 0.0723
NP_442154.1_1 Forward -125 -107 -15.6155 0.222
NP_442564.1_10 Forward -233 -219 8.45605 0.296
NP_440261.1_5 Forward -158 -145 4.93583 0.0478
NP_440261.1_5 Reverse -151 -164 -3.22564 0.12
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAGGTAGCGGGCTTCTGCATCAGCATTCACGATTGATTTCGTGACGATACTCATGGATGGATTCCTCCGTAAAGATTTAAAACGTTAAAAAAAGGCTTTAAGCTGATTTTATCAACCGAGGCGCAGTCACGAACTGGACAATGCCGTTAACCAGCGGACTCCAGCGAGCAACCTGCCCAAACCATTCTCAGGCATTGCGTTCCTGATTACACTGCCCCCGTAACAGTTTGTAATATTTCTTGACGATCGCCAGCAGAATTTACTTTAATCCCTTGGCATTTTTGGGGGAGGCTGTAAGATTAGAGGGGAAAGTAATGGTTAAATCCAGATTTCCCCGAATTTAGACTTCCACTCCTCCGCCTCCCTTCGTATTTTCGGCTGTGTTGCAGCGATTCCAATA

CDS

ATGAAGAAGCGATCTCTGTTCTCCCTTTTAACTGTCTCCCTGCTGATGTTCAGCGGTGGATGTGGATTTCTCCCCGGCGGTGGCAGTGGTGAAGAAACCGATGTTTCCGTCGAGAATCAAGAAACAGCTCCCCCGGAAGTGCCCCTGACCGCCGTTCGGCCCCTGCCCCCGGTGGATATCGCCGCCCTGGGGTTAATTCCCCCCGTATTGCCGGATCAACGTTTGAGGGAAATCCAGGCTGGTCGGCCAAATCCTTTCGCCTTGATCCCAGTTGAAGCAAAGGTTACAAGCCCGGGATCTACCGCTGATGGGAGCAAAGCAACAGATGGGGCGTCGAATGGAGGAGAAAATAGCGGCAACGTTGCCAGCAGTGATGGACAAACAGGAGTCAATGGCATCACAGGTGAGCCTGGGCAACAAAATGGCAGCTCAATCTTTCCAAATTCGGAGCCGCCCAGACTTTATCCCGATGATGCTAGGGCTGTGGTGGTTTCCGGTGTTATCGAAATCGGCAGTCGTCCCTATGCCATTGTCCAAGCCCCTGGGGAACCCGTAGCCCGTAACGTAACCGTTGGCGATCGCCTGTCCGGTGGCAATGTTAGGGTGCAATCCATCAACGTCATGGGGGAAAATTCAAACATTGTGCTGGAACAGTATGGCGAGTCCGTAACCCGTGATGTCGGCGCTCCAGCTTTACCCCCCCTTACACCGCCAGTATTGCCGATTCCCCCATCTGACTCCTAA

Protein

MKKRSLFSLLTVSLLMFSGGCGFLPGGGSGEETDVSVENQETAPPEVPLTAVRPLPPVDIAALGLIPPVLPDQRLREIQAGRPNPFALIPVEAKVTSPGSTADGSKATDGASNGGENSGNVASSDGQTGVNGITGEPGQQNGSSIFPNSEPPRLYPDDARAVVVSGVIEIGSRPYAIVQAPGEPVARNVTVGDRLSGGNVRVQSINVMGENSNIVLEQYGESVTRDVGAPALPPLTPPVLPIPPSDS