Your browser is old and dusty. Try Google Chrome!

Details for sll1937

ORF sll1937
Accession NP_440429.1
Symbol
Category ferric uptake regulation protein
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440815.1_5 Forward -158 -139 4.71934 0.286
NP_441623.1_1 Reverse -54 -72 -0.7675 0.237
NP_441818.1_9 Reverse -149 -168 8.45592 0.113
NP_440758.1_6 Reverse -67 -86 13.7658 0.279
NP_442752.1_4 Forward -353 -346 5.54565 0.194
NP_443027.1_4 Forward -355 -345 6.46988 0.275
NP_441675.1_4 Reverse -294 -313 5.11266 0.246
NP_440878.1_9 Forward -398 -379 -0.885524 0.221
NP_442581.1_1 Reverse -207 -221 8.45605 0.262
NP_442242.1_1 Reverse -200 -219 15.4341 0.29
NP_441352.1_2 Reverse -291 -310 2.45773 0.222
NP_441208.1_9 Reverse -152 -166 9.73436 0.204
NP_442110.1_7 Forward -250 -236 3.14618 0.216
NP_441082.1_10 Forward -379 -366 12.0157 0.236
NP_441082.1_10 Forward -364 -351 7.59077 0.297
NP_441925.1_5 Reverse -157 -171 16.3225 0.132
NP_440407.1_6 Reverse -205 -219 11.701 0.28
NP_442398.1_4 Forward -223 -204 12.6833 0.147
NP_441327.1_5 Reverse -58 -67 16.2243 0.164
NP_440012.1_6 Forward -364 -345 6.09597 0.299
NP_442801.1_1 Forward -92 -73 15.4993 0.293
NP_440842.1_10 Reverse -43 -57 1.96621 0.281
NP_442848.1_5 Forward -251 -233 4.24738 0.276
NP_443018.1_3 Reverse -248 -255 10.2655 0.107
NP_440376.1_1 Forward -250 -241 2.16301 0.233
NP_440376.1_1 Forward -146 -137 2.16301 0.233
NP_442485.1_3 Forward -205 -186 -3.04881 0.272
NP_442530.1_2 Reverse -291 -301 11.6814 0.282
NP_440642.1_10 Forward -64 -50 1.17898 0.3
NP_440667.1_7 Reverse -365 -384 14.2566 0.277
NP_440141.1_8 Forward -127 -108 5.11266 0.278
NP_442836.1_10 Forward -374 -364 14.4347 0.212
NP_440203.1_5 Reverse -140 -150 13.4509 0.115
NP_441097.1_2 Forward -383 -366 9.97027 0.223
NP_442690.1_1 Reverse -282 -301 -0.590531 0.126
NP_442690.1_1 Forward -304 -285 -16.6185 0.29
NP_440411.1_10 Reverse -152 -171 14.5557 0.194
NP_442870.1_4 Reverse -157 -171 18.7808 0.161
NP_440147.1_4 Reverse -180 -193 6.80412 0.0829
NP_441916.1_10 Forward -154 -135 8.94757 0.164
NP_441041.1_4 Reverse -235 -254 -4.13045 0.13
NP_441041.1_4 Forward -146 -127 -13.3736 0.285
NP_442941.1_3 Forward -352 -342 2.7333 0.14
NP_440260.1_8 Reverse -151 -169 -5.48739 0.275
NP_442281.1_1 Forward -110 -96 3.14559 0.243
NP_442575.1_8 Reverse -376 -395 -3.63879 0.254
NP_001035871.2_7 Forward -149 -139 16.7946 0.14
NP_440647.1_1 Forward -164 -145 5.30933 0.193
NP_442288.1_3 Reverse -136 -153 5.84037 0.28
NP_441556.1_7 Reverse -174 -193 1.17865 0.287
NP_441556.1_10 Reverse -116 -130 12.7526 0.195
NP_442215.1_2 Reverse -134 -150 -1.21977 0.181
NP_442177.1_5 Forward -377 -363 20.1574 0.0617
NP_442029.1_10 Reverse -114 -133 14.2574 0.145
NP_442933.1_2 Forward -163 -145 5.34953 0.299
NP_440430.1_1 Reverse -20 -39 28.0746 0.000397
NP_442926.1_3 Reverse -236 -255 2.94938 0.294
NP_442554.1_8 Forward -255 -245 3.81494 0.209
NP_442554.1_9 Reverse -145 -164 14.1224 0.269
NP_441198.1_1 Forward -250 -231 5.30933 0.217
NP_440379.1_5 Reverse -238 -257 -10.9153 0.285
NP_441015.1_8 Forward -152 -133 5.01433 0.258
NP_442719.1_2 Reverse -112 -130 -4.30813 0.21
NP_441251.1_7 Reverse -288 -301 10.639 0.284
NP_443058.1_7 Reverse -136 -155 3.44104 0.263
NP_442808.1_1 Reverse -363 -373 1.35624 0.287
NP_442808.1_1 Reverse -136 -146 0.962914 0.299
NP_440031.1_9 Reverse -209 -228 9.43923 0.258
NP_442050.1_1 Forward -131 -112 21.7306 0.0692
NP_440558.1_2 Reverse -238 -257 -5.99873 0.269
NP_441100.1_4 Forward -223 -205 20.7787 0.222
NP_441557.1_2 Reverse -132 -150 17.8171 0.178
NP_442350.1_1 Forward -22 -3 11.7992 0.278
NP_441433.1_8 Forward -61 -42 -2.75381 0.27
NP_441459.1_2 Forward -207 -188 16.4207 0.193
NP_441819.1_5 Reverse -282 -301 9.50102 0.266
NP_441574.1_1 Reverse -223 -242 -5.21209 0.26
NP_441238.1_1 Forward -366 -347 20.8456 0.037
NP_442347.1_2 Reverse -345 -354 9.4395 0.0691
NP_442347.1_2 Reverse -123 -132 4.91628 0.249
NP_442590.1_10 Forward -191 -172 8.45592 0.208
NP_442998.1_5 Reverse -208 -218 13.353 0.158
NP_442998.1_5 Reverse -59 -69 10.7964 0.204
NP_442998.1_5 Reverse -291 -301 9.91146 0.232
NP_442998.1_5 Reverse -209 -219 9.32148 0.243
NP_440256.1_1 Reverse -139 -158 -9.83364 0.289
NP_443042.1_3 Reverse -280 -298 26.5685 0.00144
NP_441559.1_8 Reverse -117 -131 13.2743 0.0574
NP_441559.1_8 Forward -255 -241 -5.9986 0.271
NP_442860.1_6 Forward -306 -287 17.2588 0.262
NP_442158.1_4 Reverse -158 -168 12.8614 0.239
NP_442069.1_4 Reverse -165 -184 5.99764 0.245
NP_442866.1_1 Forward -390 -371 -5.60541 0.243
NP_440748.1_5 Reverse -367 -386 3.83436 0.207
NP_441464.1_10 Forward -375 -361 11.8976 0.213
NP_441464.1_10 Reverse -158 -172 9.14437 0.263
NP_442993.1_1 Forward -353 -337 -9.47957 0.186
NP_440677.1_1 Reverse -94 -113 7.07928 0.243
NP_440570.1_5 Forward -150 -131 -2.75381 0.28
NP_440570.1_5 Reverse -366 -385 -3.73712 0.292
NP_441027.1_1 Reverse -59 -73 19.4684 0.169
NP_441027.1_1 Reverse -107 -121 15.3386 0.256
NP_440211.1_4 Forward -73 -63 15.123 0.237
NP_440586.1_1 Reverse -237 -256 -3.54046 0.272
NP_440586.1_8 Reverse -248 -255 9.08521 0.178
NP_439937.1_8 Reverse -233 -252 -2.95047 0.264
NP_442239.1_8 Reverse -145 -164 5.11266 0.285
NP_441138.1_5 Reverse -146 -159 3.78596 0.297
NP_440819.1_5 Forward -122 -114 7.98423 0.228
NP_442384.1_10 Reverse -344 -357 3.65753 0.183
NP_442262.1_10 Reverse -248 -255 9.18389 0.211
NP_441335.1_8 Reverse -217 -236 6.4893 0.284
NP_442693.1_7 Forward -147 -128 7.17762 0.291
NP_442102.1_4 Reverse -296 -315 12.1925 0.231
NP_440894.1_7 Forward -382 -363 10.815 0.234
NP_440894.1_10 Reverse -117 -136 9.93088 0.155
NP_440894.1_10 Forward -267 -248 6.78429 0.211
NP_440999.1_9 Forward -266 -252 -2.95034 0.281
NP_440888.1_2 Reverse -122 -136 8.45543 0.16
NP_440888.1_2 Forward -250 -236 6.39049 0.236
NP_440052.1_8 Reverse -20 -39 12.7825 0.182
NP_442033.1_8 Reverse -188 -206 19.587 0.175
NP_442033.1_10 Reverse -119 -138 -12.8819 0.277
NP_441123.1_4 Forward -206 -192 17.1085 0.23
NP_440575.1_8 Forward -71 -52 0.491109 0.185
NP_442315.1_2 Forward -378 -366 8.29878 0.297
NP_441621.1_3 Reverse -245 -263 16.1454 0.182
NP_443062.1_1 Forward -256 -238 9.22847 0.138
NP_442204.1_1 Forward -150 -139 1.53364 0.269
NP_442768.1_6 Reverse -164 -183 16.7157 0.278
NP_441443.1_10 Forward -60 -42 2.67334 0.275
NP_442120.1_10 Reverse -235 -254 -9.63698 0.244
NP_442120.1_10 Forward -256 -237 -11.0136 0.262
NP_441867.1_2 Reverse -202 -221 -15.4385 0.291
NP_442219.1_9 Reverse -345 -354 1.86802 0.295
NP_441086.1_3 Reverse -282 -301 4.79098 0.298
NP_439949.1_7 Forward -74 -60 14.8476 0.215
NP_439949.1_7 Reverse -8 -22 9.83269 0.296
NP_442873.1_5 Forward -242 -223 7.07848 0.286
NP_442206.1_10 Reverse -242 -257 6.46974 0.178
NP_442854.1_6 Forward -385 -366 7.37428 0.229
NP_442430.1_6 Reverse -289 -308 7.07928 0.271
NP_440864.1_9 Reverse -144 -163 -6.88371 0.28
NP_441542.1_4 Reverse -206 -220 3.73617 0.264
NP_442856.1_7 Reverse -238 -257 -5.9004 0.289
NP_441668.1_4 Reverse -292 -311 0.982764 0.227
NP_441409.1_7 Forward -215 -196 19.174 0.0626
NP_441031.1_10 Forward -67 -48 19.1627 0.15
NP_439950.1_1 Reverse -9 -18 14.4544 0.224
NP_440195.1_4 Forward -365 -346 5.01433 0.29
NP_442243.1_1 Reverse -235 -253 -2.34152 0.29
NP_440707.1_9 Reverse -236 -255 3.83436 0.266
NP_440793.1_1 Reverse -107 -121 11.012 0.279
NP_441432.1_8 Forward -56 -47 2.75299 0.287
NP_441333.1_1 Reverse -107 -117 10.9226 0.29
NP_441732.1_2 Forward -254 -238 -16.1661 0.165
NP_440497.1_6 Forward -190 -171 -7.57203 0.298
NP_442797.1_6 Forward -254 -235 9.00069 0.25
NP_442797.1_7 Reverse -129 -147 -1.16082 0.293
NP_440199.1_10 Reverse -28 -38 6.46988 0.299
NP_441057.1_4 Reverse -225 -243 -3.6191 0.295
NP_440913.1_1 Reverse -245 -263 5.23069 0.243
NP_442489.1_2 Forward -267 -248 10.6192 0.168
NP_442489.1_2 Forward -255 -236 1.27776 0.293
NP_441807.1_9 Reverse -230 -249 14.6508 0.272
NP_440545.1_3 Forward -195 -178 -4.87771 0.235
NP_441629.1_3 Forward -22 -3 -3.73788 0.287
NP_441629.1_3 Forward -318 -299 -4.81951 0.299
NP_440486.1_4 Reverse -248 -266 -0.177514 0.226
NP_440486.1_6 Reverse -205 -224 13.4708 0.207
NP_440459.1_2 Forward -149 -132 10.4619 0.198
NP_440010.1_10 Forward -377 -358 8.06259 0.221
NP_442311.1_5 Reverse -197 -216 -0.295539 0.288
NP_440847.1_3 Reverse -111 -125 16.3219 0.139
NP_441329.1_3 Forward -298 -288 13.3642 0.265
NP_441895.1_10 Reverse -205 -224 0.786102 0.0417
NP_442140.1_3 Reverse -236 -246 4.69992 0.238
NP_442723.1_1 Reverse -112 -131 1.96529 0.292
NP_441609.1_1 Reverse -131 -150 -0.197208 0.23
NP_440875.1_9 Forward -254 -244 11.3895 0.17
NP_440590.1_4 Forward -130 -117 -5.38892 0.277
NP_441239.1_9 Reverse -233 -245 3.77555 0.276
NP_440156.1_4 Forward -220 -210 17.0891 0.176
NP_441892.1_1 Reverse -238 -255 -0.551145 0.187
NP_440665.1_1 Reverse -137 -156 -11.6036 0.244
NP_442643.1_3 Forward -390 -371 2.55606 0.162
NP_441541.1_1 Reverse -280 -298 -1.62138 0.24
NP_440833.1_6 Reverse -60 -74 10.1271 0.255
NP_440833.1_6 Forward -230 -216 9.83206 0.26
NP_440401.1_9 Reverse -369 -376 14.5917 0.287
NP_440638.2_3 Forward -148 -129 14.0608 0.153
NP_442402.1_4 Forward -307 -288 3.34192 0.153
NP_441084.1_6 Forward -172 -158 11.6711 0.194
NP_440653.1_10 Reverse -47 -66 4.22769 0.252
NP_440696.1_3 Reverse -183 -201 -1.45582 0.259
NP_442039.1_7 Reverse -378 -388 11.9764 0.257
NP_441811.1_8 Reverse -338 -352 7.76774 0.241
NP_440825.1_6 Reverse -210 -229 7.17762 0.287
NP_440505.1_3 Forward -355 -345 4.89658 0.257
NP_441252.1_6 Reverse -207 -214 14.3954 0.168
NP_440914.1_1 Reverse -365 -375 7.44401 0.237
NP_440914.1_1 Forward -105 -95 6.56569 0.273
NP_443016.1_1 Forward -227 -208 -5.11376 0.244
NP_440007.1_9 Forward -82 -68 14.3559 0.163
NP_441059.1_2 Forward -131 -112 -3.24547 0.242
NP_441059.1_10 Forward -148 -135 10.7374 0.277
NP_440429.1_2 Forward -255 -236 18.4857 0.0973
NP_440429.1_6 Forward -182 -163 19.174 0.253
NP_442614.1_2 Forward -353 -339 5.89945 0.296
NP_440028.1_6 Reverse -221 -239 14.2771 0.218
NP_441463.1_3 Reverse -144 -163 -10.3253 0.293
NP_441901.1_1 Forward -149 -130 2.85105 0.218
NP_442362.1_5 Forward -245 -226 13.3716 0.284
NP_440143.1_1 Forward -178 -159 12.5858 0.284
NP_442437.1_3 Reverse -367 -386 14.9449 0.106
NP_441510.2_7 Reverse -47 -61 12.6836 0.28
NP_440293.1_3 Forward -380 -361 -6.68705 0.291
NP_440293.1_9 Reverse -143 -157 8.92841 0.299
NP_440766.1_5 Reverse -289 -301 8.61071 0.277
NP_441984.1_3 Forward -157 -139 5.72234 0.278
NP_441332.1_6 Reverse -364 -374 10.7754 0.287
NP_442228.1_10 Forward -382 -363 11.0125 0.288
NP_441428.1_8 Forward -264 -245 2.65439 0.268
NP_442341.1_9 Forward -253 -239 6.58715 0.221
NP_441173.1_9 Forward -297 -289 12.1137 0.21
NP_441173.1_9 Forward -216 -208 12.1137 0.21
NP_441173.1_9 Reverse -114 -122 9.75379 0.284
NP_442395.2_4 Forward -132 -113 1.08032 0.254
NP_443000.1_3 Reverse -227 -246 10.6499 0.267
NP_440507.2_3 Forward -337 -318 8.25844 0.257
NP_441842.1_7 Reverse -125 -144 13.5683 0.213
NP_442932.1_9 Reverse -6 -25 3.93269 0.289
NP_439924.1_1 Forward -41 -22 14.4541 0.17
NP_439962.1_4 Forward -389 -370 -7.57203 0.29
NP_441105.1_3 Reverse -236 -255 -5.11376 0.213
NP_442252.1_3 Forward -138 -120 9.16393 0.244
NP_443052.1_8 Forward -141 -122 1.37609 0.061
NP_443052.1_9 Forward -254 -235 2.3594 0.172
NP_442116.1_6 Reverse -285 -302 9.41035 0.227
NP_442154.1_1 Reverse -224 -242 -17.1888 0.249
NP_441430.1_6 Reverse -236 -255 18.0924 0.121
NP_440988.1_10 Reverse -45 -59 9.83628 0.193
NP_440988.1_10 Forward -252 -238 6.44783 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCTTCACTTAGGGCCGCCAACTGTTGGGGTTTGGGCTCATAGGTGTGGGGATCATTATTACCCGGTACCAGTACGCTGACTCGAACTAAGTCACCACCAATTTTTTCCAAAAAGTATTGTTGAGGTGGAATACTCACCGTAATATCCATGGCATCTGCCACCGGAGCATCCTCAACTTGACCATTTTGCCCAACCTGTTCAACAGCGGGCTGACAGCCTAGGGTGCTCAAACCCAGAACAAAAGCAACACCAAGGGGTTGGACAAAGCGGGGAACAGCGGGGAAAATGAACATTACCGATGTGCAATACAGTGAAGATCAAGCTGATGGGAAATTTATCCCTTTGGCATTAGGACAATAAACGATAATCATTATCATTGCATAATTCCTCCACCTTGTC

CDS

ATGAGTCTTCCCACTCCTTCCCTTGCCGTTCGCCTAGAGTCCCTCACAGTCAACCAAAGACTGGTGCTCCAAGCTTTGCAAAGGGAAACGGAGCCCCTGTCGGCCCAAGCCCTCTTCGCCAAACTGCGGGAAACAAAAAAAATTGGCTTGGCCACGGTGTACCGAGCTTTAGATGCCCTCAAGTTAGCCGGATTTATCCAACATCAGGCCACCATGACAGGGGAATTGCTTTACCAAACCCTAGAGCAGGACCAACATTGTTTGACCTGTTTGCAGTGTGGGGAATCGGTACCCATTCAGGGTTGCCCTGTGCAGTCCCTAGAGGAAAATTTGCAGGCTAATTATTCTTTTCGGATTTACTATCACACCCTAGAATTCTTCGGGCTTTGTCAACTTTGTGCCAAAGGAAGTGATTAG

Protein

MSLPTPSLAVRLESLTVNQRLVLQALQRETEPLSAQALFAKLRETKKIGLATVYRALDALKLAGFIQHQATMTGELLYQTLEQDQHCLTCLQCGESVPIQGCPVQSLEENLQANYSFRIYYHTLEFFGLCQLCAKGSD