Your browser is old and dusty. Try Google Chrome!

Details for sll1926

ORF sll1926
Accession NP_440568.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Reverse -29 -48 3.14605 0.213
NP_440795.1_7 Forward -36 -29 14.6904 0.0123
NP_440795.1_7 Reverse -29 -36 14.6904 0.0123
NP_440795.1_7 Forward -183 -176 10.2655 0.154
NP_440795.1_7 Forward -226 -219 8.8889 0.188
NP_439954.1_1 Reverse -38 -52 18.1908 0.143
NP_441418.1_6 Forward -37 -18 -22.0267 0.166
NP_441418.1_6 Forward -167 -148 -28.7132 0.208
NP_442291.1_5 Reverse -27 -43 -3.38305 0.239
NP_441453.1_1 Reverse -21 -39 3.8533 0.263
NP_441453.1_4 Reverse -28 -36 16.539 0.00633
NP_441453.1_4 Forward -37 -29 16.539 0.00633
NP_441453.1_4 Reverse -218 -226 11.5241 0.043
NP_441453.1_4 Forward -167 -159 7.09925 0.0962
NP_441453.1_4 Reverse -158 -166 6.80426 0.121
NP_441453.1_4 Forward -286 -278 5.52596 0.127
NP_441453.1_4 Reverse -175 -183 4.14932 0.264
NP_441453.1_4 Reverse -277 -285 3.85433 0.284
NP_442151.1_6 Reverse -28 -42 20.7474 0.0045
NP_442151.1_6 Forward -37 -23 9.93102 0.137
NP_442151.1_6 Reverse -158 -172 8.94771 0.162
NP_440226.1_1 Forward -37 -18 9.93088 0.0679
NP_440226.1_1 Reverse -28 -47 9.3409 0.0734
NP_440226.1_1 Forward -167 -148 5.01433 0.17
NP_441630.1_3 Reverse -150 -169 11.3075 0.0797
NP_441342.1_2 Forward -41 -27 11.5043 0.208
NP_440150.1_6 Forward -289 -270 4.03102 0.245
NP_443002.1_5 Reverse -137 -155 9.26148 0.296
NP_442173.1_1 Forward -36 -28 15.4574 0.00633
NP_442173.1_1 Reverse -29 -37 15.4574 0.00633
NP_442173.1_1 Reverse -159 -167 5.82095 0.2
NP_442173.1_1 Forward -166 -158 5.72262 0.203
NP_442173.1_1 Forward -183 -175 4.73931 0.258
NP_442752.1_4 Reverse -158 -165 13.8055 0.0199
NP_442752.1_4 Forward -37 -30 13.8055 0.0199
NP_442752.1_4 Reverse -28 -35 13.8055 0.0199
NP_443027.1_4 Reverse -26 -36 13.943 0.0452
NP_441812.1_3 Forward -38 -24 12.6843 0.197
NP_441812.1_3 Reverse -157 -171 7.86607 0.259
NP_442975.1_10 Reverse -24 -38 20.3534 0.00216
NP_442975.1_10 Forward -171 -157 10.2254 0.056
NP_442975.1_10 Forward -41 -27 1.76896 0.291
NP_440784.1_7 Forward -36 -29 15.9687 0.0123
NP_440784.1_7 Reverse -29 -36 15.9687 0.0123
NP_440784.1_7 Reverse -159 -166 6.23397 0.241
NP_440784.1_7 Forward -166 -159 6.13563 0.241
NP_440061.1_9 Forward -288 -274 14.2569 0.0707
NP_440061.1_9 Forward -39 -25 10.1271 0.128
NP_440061.1_9 Forward -147 -133 9.93039 0.134
NP_440110.1_4 Forward -178 -159 10.6192 0.111
NP_440110.1_4 Reverse -213 -232 4.62101 0.185
NP_441054.1_4 Reverse -126 -144 -3.71743 0.281
NP_442062.1_8 Forward -37 -27 19.4496 0.000558
NP_442062.1_8 Reverse -28 -38 17.3846 0.00193
NP_442062.1_8 Reverse -158 -168 7.84651 0.0871
NP_442062.1_8 Forward -167 -157 7.55152 0.0946
NP_442062.1_8 Reverse -136 -146 4.79825 0.198
NP_441859.1_3 Forward -38 -19 4.81688 0.213
NP_440304.1_4 Reverse -26 -36 9.91146 0.051
NP_440304.1_4 Forward -169 -159 9.12481 0.0626
NP_440304.1_4 Forward -39 -29 1.84832 0.299
NP_442242.1_4 Forward -36 -29 14.3954 0.0124
NP_442242.1_4 Reverse -29 -36 14.3954 0.0124
NP_442242.1_4 Forward -166 -159 10.8555 0.127
NP_440044.1_8 Forward -166 -147 7.17762 0.0851
NP_440044.1_8 Forward -36 -17 0.58944 0.195
NP_440908.1_5 Reverse -30 -47 11.0519 0.229
NP_441352.1_2 Forward -92 -73 1.96607 0.235
NP_441208.1_9 Forward -40 -26 7.47274 0.221
NP_441208.1_9 Reverse -155 -169 5.80112 0.262
NP_440370.1_10 Forward -46 -27 9.63589 0.221
NP_442110.1_7 Reverse -294 -308 5.30946 0.175
NP_442110.1_7 Reverse -28 -42 2.06454 0.222
NP_441925.1_4 Forward -226 -207 -15.3409 0.263
NP_440856.1_4 Reverse -21 -40 -1.67217 0.202
NP_440856.1_4 Forward -257 -238 -2.55715 0.214
NP_440856.1_4 Reverse -156 -175 -5.01543 0.274
NP_441083.1_3 Reverse -135 -145 11.9759 0.296
NP_441083.1_5 Reverse -28 -38 20.3345 0.00053
NP_441083.1_5 Forward -37 -27 11.3864 0.0159
NP_441083.1_5 Forward -167 -157 10.9931 0.017
NP_441083.1_5 Reverse -158 -168 1.74999 0.198
NP_441083.1_5 Forward -286 -276 -0.904945 0.283
NP_442827.1_8 Forward -45 -26 1.47364 0.178
NP_442827.1_8 Forward -175 -156 -1.27961 0.245
NP_442245.1_3 Reverse -117 -135 20.767 0.284
NP_442245.1_7 Reverse -350 -368 9.36059 0.286
NP_441738.1_2 Forward -165 -158 15.28 0.0102
NP_441738.1_2 Forward -35 -28 15.28 0.0102
NP_441738.1_2 Reverse -30 -37 15.28 0.0102
NP_441558.1_5 Reverse -26 -45 16.5191 0.0291
NP_441558.1_5 Forward -229 -210 5.80098 0.24
NP_440209.1_1 Reverse -28 -36 18.1123 0.00295
NP_440209.1_1 Forward -37 -29 18.1123 0.00295
NP_440209.1_1 Forward -167 -159 14.8674 0.012
NP_440209.1_1 Reverse -158 -166 8.57422 0.0425
NP_442889.1_8 Reverse -25 -39 21.1401 0.00339
NP_442889.1_8 Forward -170 -156 7.86545 0.14
NP_440447.1_6 Reverse -269 -287 7.19731 0.143
NP_440447.1_6 Reverse -233 -251 1.10079 0.273
NP_441713.1_1 Reverse -271 -290 -4.91709 0.113
NP_440178.1_7 Reverse -27 -46 -12.1936 0.115
NP_440178.1_7 Forward -38 -19 -20.945 0.204
NP_440178.1_7 Forward -310 -291 -23.01 0.287
NP_440659.1_9 Reverse -149 -168 11.0125 0.232
NP_442111.1_4 Reverse -157 -171 19.9608 0.00373
NP_442111.1_4 Forward -38 -24 11.111 0.0515
NP_442111.1_4 Reverse -27 -41 1.96621 0.292
NP_440906.1_5 Forward -36 -29 15.8704 0.0124
NP_440906.1_5 Reverse -29 -36 15.8704 0.0124
NP_440906.1_5 Reverse -159 -166 6.23397 0.234
NP_440906.1_5 Forward -166 -159 6.13563 0.241
NP_440747.1_10 Forward -40 -28 14.887 0.00223
NP_440747.1_10 Reverse -155 -167 5.25052 0.0154
NP_440747.1_10 Reverse -25 -37 -2.1243 0.0225
NP_440747.1_10 Forward -170 -158 -11.8591 0.161
NP_440747.1_10 Reverse -274 -286 -12.2524 0.254
NP_441486.1_1 Reverse -25 -39 5.50613 0.0365
NP_441486.1_1 Forward -40 -26 4.52282 0.0432
NP_441486.1_1 Reverse -172 -186 1.08123 0.119
NP_441486.1_1 Reverse -155 -169 -3.54032 0.179
NP_442850.1_8 Forward -171 -152 14.0832 0.266
NP_440944.1_2 Forward -49 -30 -3.63879 0.293
NP_441265.1_3 Reverse -22 -36 1.57289 0.2
NP_440842.1_10 Reverse -25 -39 0.88457 0.296
NP_441014.1_10 Reverse -129 -148 2.35861 0.216
NP_442848.1_1 Forward -43 -29 -0.393733 0.263
NP_442848.1_5 Reverse -168 -186 6.70565 0.232
NP_442848.1_5 Forward -223 -205 -3.71743 0.297
NP_442848.1_9 Forward -43 -24 4.42435 0.206
NP_443018.1_3 Forward -36 -29 14.8871 0.0123
NP_443018.1_3 Reverse -29 -36 14.8871 0.0123
NP_443018.1_3 Reverse -159 -166 12.6255 0.0471
NP_443018.1_3 Forward -285 -278 10.6589 0.0967
NP_443018.1_3 Forward -166 -159 5.25066 0.214
NP_443018.1_3 Reverse -219 -226 4.56234 0.241
NP_443018.1_3 Forward -226 -219 4.46401 0.244
NP_443018.1_3 Forward -183 -176 4.36568 0.254
NP_443018.1_3 Reverse -278 -285 4.16902 0.278
NP_443018.1_3 Reverse -176 -183 4.07068 0.299
NP_441634.1_8 Forward -39 -25 6.6861 0.114
NP_440376.1_1 Forward -37 -28 19.4693 0.000692
NP_440376.1_1 Reverse -28 -37 19.4693 0.000692
NP_440376.1_1 Reverse -158 -167 9.83282 0.0339
NP_440376.1_1 Forward -167 -158 9.63616 0.0385
NP_441588.1_4 Forward -165 -155 18.1713 0.0143
NP_441588.1_4 Reverse -30 -40 15.9097 0.0369
NP_442687.1_7 Reverse -27 -37 15.8113 0.0125
NP_442687.1_7 Reverse -276 -286 13.7464 0.0426
NP_442687.1_7 Forward -38 -28 8.92815 0.0994
NP_442687.1_7 Reverse -217 -227 4.89658 0.23
NP_442485.1_3 Forward -39 -20 -5.50708 0.291
NP_441846.1_10 Reverse -16 -35 -23.7966 0.298
NP_440781.1_1 Forward -293 -279 13.2743 0.266
NP_442658.1_1 Reverse -26 -36 18.7607 0.00222
NP_442658.1_1 Forward -39 -29 6.76441 0.214
NP_442658.1_1 Forward -169 -159 6.27276 0.234
NP_442198.1_4 Forward -74 -55 17.8957 0.242
NP_440141.1_8 Reverse -19 -38 5.01433 0.278
NP_441855.2_4 Reverse -20 -39 13.1865 0.173
NP_442782.1_2 Reverse -35 -49 7.37441 0.202
NP_442782.1_2 Forward -233 -219 2.75286 0.274
NP_442496.1_5 Forward -83 -65 4.14905 0.295
NP_441414.1_9 Reverse -28 -47 16.4207 0.00987
NP_441414.1_9 Forward -37 -18 3.24438 0.0596
NP_440720.1_1 Forward -178 -159 9.43923 0.167
NP_442300.1_3 Forward -228 -209 13.0775 0.0529
NP_442300.1_4 Reverse -269 -288 16.9115 0.167
NP_441256.1_2 Reverse -126 -145 14.9458 0.132
NP_441256.1_8 Forward -182 -163 2.75272 0.285
NP_442937.1_5 Forward -42 -23 7.37428 0.254
NP_442937.1_5 Reverse -23 -42 6.68596 0.272
NP_441958.1_5 Forward -38 -28 12.2714 0.00183
NP_441958.1_5 Reverse -27 -37 12.2714 0.00183
NP_441958.1_5 Forward -168 -158 11.3864 0.0074
NP_441958.1_5 Reverse -276 -286 7.15819 0.0362
NP_441958.1_5 Reverse -157 -167 2.83163 0.0372
NP_441958.1_5 Forward -185 -175 0.0783647 0.168
NP_441127.1_5 Forward -257 -238 17.4539 0.274
NP_442486.1_4 Reverse -30 -49 8.25926 0.27
NP_442836.1_5 Reverse -130 -149 3.93269 0.222
NP_439905.1_1 Forward -36 -23 8.9674 0.227
NP_439905.1_1 Forward -285 -272 6.21414 0.295
NP_443001.1_7 Reverse -301 -320 1.67108 0.279
NP_440984.1_7 Reverse -23 -37 18.8791 0.0114
NP_440984.1_7 Forward -42 -28 11.3077 0.122
NP_439990.1_5 Forward -42 -29 10.934 0.128
NP_439990.1_5 Forward -172 -159 9.2624 0.147
NP_442911.1_2 Reverse -18 -37 18.7807 0.00604
NP_442911.1_2 Forward -47 -28 11.7992 0.0131
NP_442911.1_2 Forward -177 -158 -1.37718 0.0844
NP_442911.1_2 Reverse -290 -309 -8.26035 0.231
NP_441580.1_6 Forward -48 -29 -8.26035 0.254
NP_440153.1_2 Reverse -119 -138 20.059 0.112
NP_440153.1_5 Forward -36 -22 3.73617 0.205
NP_440153.1_5 Reverse -29 -43 2.85119 0.219
NP_440153.1_8 Reverse -175 -188 4.64084 0.196
NP_440153.1_8 Forward -145 -132 -2.63565 0.246
NP_443055.1_6 Reverse -20 -38 1.88669 0.224
NP_440993.1_2 Forward -42 -26 5.46674 0.234
NP_440993.1_2 Reverse -23 -39 2.22182 0.269
NP_441099.1_5 Forward -47 -28 -8.35868 0.193
NP_442002.1_9 Forward -310 -303 12.2322 0.185
NP_442002.1_9 Reverse -27 -34 10.7572 0.185
NP_440809.1_9 Forward -259 -241 1.88744 0.118
NP_441294.1_7 Reverse -154 -168 12.3223 0.103
NP_441294.1_7 Reverse -24 -38 9.15464 0.256
NP_441294.1_7 Reverse -171 -185 8.86667 0.274
NP_441646.1_1 Forward -152 -133 2.0644 0.221
NP_441646.1_7 Reverse -124 -138 14.3559 0.256
NP_442438.1_10 Reverse -23 -37 4.81781 0.142
NP_442438.1_10 Forward -42 -28 0.0979218 0.239
NP_441292.1_2 Reverse -266 -285 16.6174 0.0115
NP_441752.1_6 Reverse -164 -183 0.294447 0.26
NP_441000.1_6 Forward -185 -171 4.91614 0.0933
NP_441000.1_6 Forward -38 -24 -3.83532 0.225
NP_441000.1_6 Forward -291 -277 -4.91696 0.254
NP_442771.1_1 Forward -229 -211 -8.04399 0.179
NP_440147.1_4 Forward -39 -26 19.4888 0.00276
NP_440147.1_4 Reverse -275 -288 11.524 0.0326
NP_440147.1_4 Reverse -156 -169 10.8357 0.0353
NP_440147.1_4 Reverse -26 -39 3.46087 0.187
NP_441175.1_7 Reverse -28 -47 25.2705 0.00218
NP_441295.1_4 Forward -42 -23 -3.24547 0.29
NP_441550.1_8 Forward -39 -29 14.6309 0.0132
NP_441550.1_8 Reverse -275 -285 13.7459 0.0216
NP_441550.1_8 Reverse -26 -36 10.501 0.066
NP_441550.1_8 Forward -169 -159 8.23937 0.127
NP_441550.1_8 Reverse -156 -166 5.38779 0.252
NP_441550.1_8 Reverse -216 -226 4.7978 0.283
NP_441916.1_7 Forward -37 -27 18.4663 0.00144
NP_441916.1_7 Reverse -28 -38 10.3048 0.0261
NP_441916.1_7 Reverse -158 -168 9.22315 0.0383
NP_441916.1_7 Forward -167 -157 7.05986 0.0779
NP_441916.1_7 Reverse -175 -185 6.27322 0.102
NP_441916.1_7 Forward -286 -276 5.19158 0.141
NP_441916.1_7 Forward -184 -174 4.20827 0.185
NP_440206.1_9 Forward -384 -365 6.88262 0.296
NP_441041.1_4 Reverse -28 -47 -1.7705 0.103
NP_441041.1_7 Reverse -25 -37 10.1386 0.102
NP_442396.1_5 Forward -41 -28 12.114 0.0913
NP_442004.1_1 Reverse -203 -222 16.1598 0.269
NP_440703.1_9 Forward -145 -132 9.85179 0.212
NP_440703.1_9 Forward -315 -302 5.52525 0.292
NP_441725.1_4 Forward -172 -158 3.44058 0.279
NP_441725.1_5 Forward -36 -26 9.02648 0.0553
NP_441725.1_5 Reverse -219 -229 7.25653 0.103
NP_441725.1_5 Reverse -29 -39 2.04498 0.115
NP_441725.1_5 Reverse -176 -186 -0.314959 0.246
NP_441725.1_5 Reverse -159 -169 -0.806614 0.271
NP_441725.1_5 Reverse -282 -292 -1.10161 0.288
NP_439966.1_7 Reverse -26 -36 17.4824 0.00636
NP_439966.1_7 Forward -169 -159 11.5826 0.0611
NP_439966.1_7 Forward -39 -29 7.25606 0.15
NP_439966.1_9 Reverse -26 -35 10.7178 0.0863
NP_440202.1_8 Reverse -370 -389 10.0981 0.297
NP_442941.1_3 Reverse -29 -39 11.0914 0.0116
NP_442941.1_3 Forward -36 -26 2.53664 0.14
NP_442941.1_3 Forward -166 -156 1.25834 0.15
NP_442941.1_3 Reverse -159 -169 1.25834 0.15
NP_440289.1_2 Reverse -25 -38 10.1474 0.0278
NP_440289.1_2 Forward -230 -217 5.72248 0.0616
NP_440289.1_2 Reverse -172 -185 -4.79893 0.294
NP_441076.1_1 Forward -279 -260 12.9997 0.208
NP_442281.1_1 Reverse -153 -167 14.3553 0.0191
NP_442281.1_1 Reverse -23 -37 9.43874 0.0703
NP_442281.1_1 Forward -42 -28 8.84875 0.075
NP_442281.1_1 Forward -291 -277 2.06395 0.278
NP_441079.1_7 Reverse -48 -67 -0.689632 0.2
NP_440018.1_3 Forward -151 -132 1.27776 0.291
NP_442847.1_3 Reverse -118 -137 7.27514 0.235
NP_442256.1_2 Reverse -26 -44 -7.65067 0.214
NP_442012.1_1 Forward -43 -24 2.85105 0.191
NP_440723.1_4 Reverse -25 -44 -10.227 0.272
NP_441644.1_6 Reverse -28 -38 17.3841 0.00127
NP_441644.1_6 Forward -286 -276 11.3859 0.0502
NP_441644.1_6 Forward -37 -27 10.1076 0.0628
NP_441644.1_6 Reverse -158 -168 9.41933 0.0767
NP_441644.1_6 Forward -167 -157 8.43603 0.0998
NP_442215.1_2 Reverse -26 -42 14.9065 0.0195
NP_442029.1_1 Reverse -206 -225 -19.7651 0.297
NP_442247.1_8 Forward -39 -25 11.2093 0.247
NP_440253.1_2 Forward -37 -19 17.0304 0.0115
NP_440253.1_2 Forward -184 -166 -3.52077 0.294
NP_440929.1_8 Forward -37 -28 19.2726 0.000701
NP_440929.1_8 Reverse -28 -37 19.2726 0.000701
NP_440929.1_8 Forward -167 -158 9.63616 0.0262
NP_440929.1_8 Reverse -158 -167 9.53783 0.0296
NP_442933.1_10 Forward -37 -28 17.601 0.00325
NP_442933.1_10 Reverse -28 -37 17.601 0.00325
NP_442933.1_10 Forward -167 -158 15.1427 0.00958
NP_442933.1_10 Reverse -158 -167 7.96454 0.0937
NP_442933.1_10 Reverse -130 -139 6.29291 0.128
NP_442933.1_10 Forward -184 -175 5.11294 0.204
NP_442933.1_10 Forward -286 -277 4.71961 0.22
NP_441751.2_8 Reverse -159 -173 -4.4253 0.173
NP_441751.2_8 Forward -166 -152 -5.40861 0.206
NP_442926.1_3 Forward -297 -278 2.55606 0.295
NP_442926.1_5 Reverse -213 -232 11.3381 0.219
NP_442554.1_8 Forward -36 -26 16.008 0.0065
NP_442554.1_8 Reverse -29 -39 15.3197 0.00882
NP_442554.1_8 Reverse -159 -169 9.7148 0.0562
NP_442554.1_8 Forward -166 -156 5.48657 0.146
NP_442554.1_8 Forward -285 -275 4.20827 0.193
NP_442554.1_8 Reverse -278 -288 4.20827 0.193
NP_442554.1_8 Forward -226 -216 3.91327 0.203
NP_442554.1_8 Reverse -176 -186 3.61828 0.218
NP_441762.1_7 Forward -38 -26 12.4287 0.0142
NP_441762.1_7 Reverse -27 -39 9.57708 0.0142
NP_441762.1_7 Reverse -157 -169 -7.13918 0.285
NP_442142.1_4 Reverse -155 -168 7.49186 0.137
NP_442142.1_4 Reverse -25 -38 5.91857 0.178
NP_442142.1_4 Forward -40 -27 5.52525 0.188
NP_442142.1_4 Reverse -274 -287 2.37867 0.294
NP_442292.1_1 Reverse -29 -38 18.486 0.00229
NP_442292.1_1 Forward -36 -27 9.63616 0.0183
NP_442292.1_1 Forward -166 -157 8.65285 0.0335
NP_442292.1_1 Reverse -159 -168 7.76787 0.0615
NP_442476.1_6 Forward -36 -22 5.80112 0.131
NP_442476.1_6 Reverse -29 -43 1.47456 0.214
NP_441711.1_4 Forward -46 -27 3.14605 0.255
NP_443009.1_5 Forward -38 -27 18.3477 0.00265
NP_443009.1_5 Reverse -157 -168 4.77807 0.23
NP_443009.1_5 Reverse -276 -287 3.99143 0.268
NP_442301.1_2 Forward -140 -121 15.5349 0.103
NP_441715.1_4 Forward -36 -26 9.32148 0.097
NP_441715.1_4 Reverse -29 -39 7.94484 0.107
NP_440279.1_2 Reverse -213 -232 10.8159 0.146
NP_440835.1_1 Reverse -344 -363 9.43923 0.0387
NP_440183.1_9 Forward -198 -179 -20.3551 0.282
NP_441198.1_5 Reverse -30 -43 14.67 0.206
NP_441198.1_5 Forward -165 -152 12.7034 0.216
NP_440379.1_5 Reverse -121 -140 -5.40875 0.223
NP_440379.1_5 Forward -290 -271 -6.49039 0.236
NP_440379.1_5 Reverse -172 -191 -11.5053 0.297
NP_440464.1_10 Reverse -29 -39 13.0082 0.169
NP_440464.1_10 Forward -166 -156 11.8623 0.275
NP_441468.1_1 Forward -36 -29 15.8704 0.0124
NP_441468.1_1 Reverse -29 -36 15.8704 0.0124
NP_441468.1_1 Reverse -159 -166 6.13563 0.209
NP_441468.1_1 Forward -166 -159 6.0373 0.223
NP_441468.1_1 Forward -183 -176 4.46401 0.224
NP_441468.1_1 Forward -285 -278 3.97235 0.277
NP_441468.1_1 Forward -226 -219 3.97235 0.277
NP_441020.2_6 Forward -39 -22 12.9202 0.0824
NP_441020.2_6 Reverse -26 -43 9.18362 0.179
NP_441020.2_6 Forward -186 -169 8.88863 0.185
NP_441015.1_10 Reverse -23 -42 -5.31042 0.221
NP_441673.1_1 Forward -37 -28 20.8459 0.000698
NP_441673.1_1 Reverse -28 -37 20.8459 0.000698
NP_441673.1_1 Reverse -158 -167 11.1111 0.0121
NP_441673.1_1 Forward -167 -158 11.0128 0.018
NP_441731.1_3 Reverse -128 -147 -3.73712 0.284
NP_441731.1_9 Reverse -351 -368 13.9035 0.223
NP_441826.1_2 Forward -43 -29 6.09611 0.0946
NP_441826.1_2 Reverse -22 -36 -3.93365 0.29
NP_441826.1_5 Forward -130 -111 1.17943 0.295
NP_441330.1_1 Reverse -23 -42 -2.45882 0.0791
NP_442490.1_9 Reverse -16 -35 -6.39206 0.273
NP_442868.1_6 Forward -39 -29 9.81313 0.038
NP_442868.1_6 Reverse -26 -36 8.53483 0.0555
NP_442868.1_6 Reverse -156 -166 0.0783647 0.248
NP_441612.1_2 Reverse -28 -38 8.54929 0.21
NP_442427.1_8 Reverse -19 -38 7.27595 0.216
NP_442808.1_1 Reverse -27 -37 18.4657 0.00201
NP_442808.1_1 Reverse -377 -387 10.8943 0.0481
NP_442808.1_1 Forward -38 -28 8.63269 0.0481
NP_442808.1_1 Forward -168 -158 7.45273 0.0783
NP_442808.1_1 Forward -147 -137 1.45457 0.285
NP_441315.1_2 Forward -155 -137 17.2104 0.213
NP_442542.1_2 Reverse -26 -39 11.9173 0.114
NP_442113.1_3 Forward -151 -132 3.34271 0.254
NP_442050.1_5 Forward -169 -159 13.1559 0.0421
NP_442050.1_5 Forward -305 -295 9.12434 0.193
NP_442050.1_5 Reverse -26 -36 8.23937 0.234
NP_442050.1_5 Forward -39 -29 7.64939 0.243
NP_440038.1_4 Forward -222 -203 2.16274 0.275
NP_442342.1_9 Reverse -128 -144 1.92682 0.296
NP_440558.1_2 Forward -367 -348 -7.37537 0.293
NP_441048.1_4 Reverse -361 -380 8.55425 0.283
NP_441518.1_3 Reverse -148 -167 -3.54046 0.114
NP_441518.1_3 Forward -355 -336 -15.3402 0.291
NP_441878.1_6 Forward -38 -28 10.4031 0.0176
NP_441878.1_6 Reverse -27 -37 10.4031 0.0176
NP_441878.1_6 Forward -185 -175 2.53664 0.0363
NP_441878.1_6 Forward -228 -218 2.14332 0.0501
NP_441878.1_6 Reverse -217 -227 1.35667 0.101
NP_441878.1_6 Reverse -129 -139 0.865012 0.132
NP_441878.1_6 Forward -168 -158 0.668351 0.139
NP_441878.1_6 Reverse -157 -167 0.668351 0.139
NP_441878.1_6 Reverse -276 -286 -0.314959 0.174
NP_441036.1_8 Reverse -27 -37 17.7779 0.000554
NP_441036.1_8 Forward -38 -28 8.33817 0.174
NP_441036.1_8 Reverse -157 -167 7.25653 0.203
NP_441036.1_8 Forward -168 -158 6.37155 0.234
NP_441557.1_5 Forward -37 -28 19.9609 0.000699
NP_441557.1_5 Reverse -28 -37 19.9609 0.000699
NP_441557.1_5 Reverse -158 -167 10.2261 0.0144
NP_441557.1_5 Forward -167 -158 10.1278 0.0188
NP_441557.1_5 Forward -184 -175 -0.491928 0.193
NP_441557.1_5 Reverse -277 -286 -0.885252 0.26
NP_441445.1_1 Reverse -19 -38 2.85105 0.226
NP_441445.1_1 Forward -190 -171 0.687771 0.27
NP_442267.1_4 Forward -192 -173 0.491109 0.285
NP_442066.2_9 Reverse -24 -37 10.639 0.154
NP_442419.1_2 Forward -42 -23 3.53937 0.198
NP_441308.1_8 Reverse -26 -36 9.22315 0.226
NP_441458.1_10 Forward -193 -174 9.14423 0.168
NP_442183.1_1 Forward -37 -23 10.1277 0.0888
NP_442183.1_1 Reverse -158 -172 7.17775 0.147
NP_440440.1_2 Forward -230 -211 13.47 0.282
NP_441574.1_1 Reverse -16 -35 0.491109 0.192
NP_441574.1_1 Reverse -146 -165 -7.17871 0.286
NP_442347.1_2 Reverse -29 -38 12.4878 0.056
NP_442347.1_2 Forward -166 -157 12.2911 0.056
NP_442347.1_2 Forward -36 -27 11.1111 0.056
NP_442645.1_2 Forward -45 -26 -3.24547 0.0487
NP_442645.1_2 Reverse -292 -311 -16.8151 0.242
NP_442645.1_2 Forward -235 -216 -17.3068 0.253
NP_442645.1_2 Reverse -128 -147 -19.6667 0.288
NP_441037.1_4 Reverse -26 -36 16.2838 0.0168
NP_441037.1_4 Forward -39 -29 7.9999 0.237
NP_441037.1_4 Forward -169 -159 6.83041 0.239
NP_441037.1_4 Forward -186 -176 6.63549 0.25
NP_442508.1_9 Reverse -145 -159 18.0925 0.186
NP_441633.1_3 Forward -39 -26 18.3088 0.00715
NP_441633.1_3 Reverse -156 -169 1.10092 0.109
NP_441633.1_3 Reverse -26 -39 -3.71729 0.177
NP_442764.1_6 Forward -165 -147 18.997 0.0676
NP_440136.1_2 Forward -36 -29 15.9687 0.0123
NP_440136.1_2 Reverse -29 -36 15.9687 0.0123
NP_440136.1_2 Reverse -159 -166 6.23397 0.171
NP_440136.1_2 Forward -166 -159 6.13563 0.193
NP_442590.1_9 Reverse -120 -139 4.52268 0.273
NP_442590.1_10 Reverse -130 -149 5.70265 0.258
NP_442998.1_10 Forward -165 -158 15.5754 0.0102
NP_442998.1_10 Forward -35 -28 15.5754 0.0102
NP_442998.1_10 Reverse -30 -37 15.5754 0.0102
NP_442998.1_10 Forward -284 -277 6.23397 0.157
NP_442998.1_10 Reverse -160 -167 5.84064 0.235
NP_442998.1_10 Forward -225 -218 4.16902 0.259
NP_440899.1_2 Reverse -266 -285 5.99684 0.271
NP_440899.1_8 Forward -385 -366 -7.27704 0.244
NP_440299.1_1 Forward -41 -28 22.7331 0.000547
NP_440299.1_1 Reverse -24 -37 10.4418 0.0573
NP_440299.1_1 Forward -171 -158 3.46031 0.243
NP_440299.1_1 Reverse -214 -227 3.06699 0.261
NP_441799.1_1 Forward -41 -27 9.53707 0.0901
NP_441799.1_1 Reverse -24 -38 9.04542 0.1
NP_441799.1_1 Reverse -273 -287 7.07881 0.153
NP_441799.1_1 Reverse -154 -168 4.8172 0.236
NP_441007.1_10 Reverse -23 -36 1.9859 0.202
NP_441007.1_10 Forward -189 -176 -0.37404 0.277
NP_441007.1_10 Forward -42 -29 -0.964025 0.296
NP_442201.1_10 Reverse -17 -36 5.11266 0.0666
NP_442201.1_10 Forward -48 -29 -4.72043 0.152
NP_442201.1_10 Forward -195 -176 -6.58872 0.184
NP_440256.1_1 Forward -40 -21 4.81767 0.0411
NP_440256.1_1 Reverse -274 -293 3.34271 0.0541
NP_440256.1_1 Reverse -259 -278 -7.17871 0.231
NP_440915.1_6 Reverse -24 -38 5.40779 0.0903
NP_440915.1_6 Forward -41 -27 3.44117 0.101
NP_440915.1_6 Forward -171 -157 3.24451 0.104
NP_440915.1_6 Reverse -171 -185 -3.04867 0.29
NP_440997.1_4 Forward -141 -122 10.7175 0.289
NP_441464.1_2 Forward -129 -119 17.2863 0.221
NP_441939.1_3 Reverse -29 -48 9.43923 0.145
NP_439985.1_2 Reverse -302 -321 7.07928 0.287
NP_442993.1_1 Reverse -158 -174 -8.88958 0.176
NP_442386.1_9 Reverse -27 -36 15.7322 0.0144
NP_442386.1_9 Forward -38 -29 13.8639 0.0289
NP_442386.1_9 Reverse -174 -183 5.9975 0.23
NP_442386.1_9 Reverse -378 -387 5.60418 0.245
NP_440570.1_5 Forward -47 -28 1.47442 0.238
NP_441340.1_5 Forward -36 -29 15.6737 0.0124
NP_441340.1_5 Reverse -29 -36 15.6737 0.0124
NP_441340.1_5 Reverse -278 -285 11.3472 0.0526
NP_441340.1_5 Reverse -219 -226 11.0522 0.0749
NP_441340.1_5 Reverse -159 -166 6.23397 0.132
NP_441340.1_5 Forward -166 -159 5.84064 0.208
NP_441340.1_5 Reverse -176 -183 3.97235 0.274
NP_442484.1_2 Forward -48 -29 7.27595 0.156
NP_442484.1_2 Reverse -176 -195 -1.18052 0.287
NP_442240.1_2 Reverse -29 -48 -9.53865 0.137
NP_440586.1_1 Forward -188 -169 -3.14714 0.263
NP_440586.1_8 Reverse -159 -166 14.69 0.026
NP_440586.1_8 Forward -36 -29 13.2151 0.026
NP_440586.1_8 Reverse -29 -36 13.2151 0.026
NP_440586.1_8 Forward -285 -278 5.74197 0.283
NP_442251.1_6 Forward -36 -29 15.2804 0.0124
NP_442251.1_6 Reverse -29 -36 15.2804 0.0124
NP_442251.1_6 Forward -166 -159 12.0355 0.0627
NP_441262.1_3 Reverse -158 -165 14.7888 0.0223
NP_441262.1_3 Reverse -28 -35 14.7888 0.0223
NP_441262.1_3 Forward -37 -30 14.7888 0.0223
NP_440027.1_3 Reverse -171 -189 3.95163 0.263
NP_440027.1_3 Forward -145 -127 3.26332 0.275
NP_443051.1_1 Reverse -27 -36 10.4228 0.00754
NP_443051.1_1 Forward -38 -29 10.4228 0.00754
NP_443051.1_1 Forward -168 -159 9.73449 0.0265
NP_443051.1_1 Reverse -276 -285 5.3096 0.0964
NP_443051.1_1 Reverse -157 -166 0.884706 0.125
NP_443051.1_1 Forward -185 -176 -1.08191 0.281
NP_439937.1_9 Reverse -367 -384 -13.7281 0.287
NP_439937.1_9 Forward -38 -21 -16.0881 0.287
NP_440926.1_5 Forward -195 -176 7.47261 0.276
NP_440836.1_1 Forward -153 -134 7.86593 0.222
NP_440408.1_7 Reverse -277 -296 11.1109 0.232
NP_440408.1_8 Reverse -295 -314 21.3364 0.142
NP_440439.1_1 Reverse -25 -38 2.37923 0.135
NP_440439.1_1 Forward -289 -276 0.60927 0.182
NP_442239.1_8 Forward -190 -171 5.01433 0.287
NP_440372.1_2 Forward -36 -29 16.3621 0.0124
NP_440372.1_2 Reverse -29 -36 16.3621 0.0124
NP_440372.1_2 Reverse -159 -166 6.82395 0.0854
NP_440372.1_2 Forward -166 -159 6.52896 0.188
NP_440316.1_10 Reverse -217 -227 7.94484 0.245
NP_440316.1_10 Forward -185 -175 6.46988 0.257
NP_441803.1_2 Reverse -23 -42 1.57275 0.229
NP_441803.1_2 Forward -144 -125 0.687771 0.247
NP_439977.1_5 Reverse -22 -41 -1.27885 0.245
NP_440139.1_1 Reverse -22 -41 6.58682 0.14
NP_440139.1_1 Reverse -169 -188 5.30853 0.161
NP_440210.1_10 Reverse -72 -91 4.81688 0.296
NP_442384.1_10 Reverse -28 -41 17.7189 0.00567
NP_442384.1_10 Forward -286 -273 15.1623 0.0113
NP_442384.1_10 Forward -37 -24 1.00259 0.271
NP_442114.1_4 Forward -37 -26 12.1534 0.107
NP_441877.1_9 Forward -81 -64 2.79211 0.285
NP_441018.1_7 Reverse -132 -151 13.5691 0.132
NP_441018.1_7 Forward -194 -175 7.66927 0.268
NP_442790.1_4 Forward -176 -157 -15.0452 0.284
NP_442790.1_4 Reverse -149 -168 -15.8318 0.297
NP_442262.1_10 Forward -36 -29 14.1988 0.0123
NP_442262.1_10 Reverse -29 -36 14.1988 0.0123
NP_442262.1_10 Reverse -159 -166 12.9205 0.0422
NP_442262.1_10 Forward -285 -278 12.0355 0.062
NP_442262.1_10 Reverse -219 -226 7.90559 0.266
NP_441689.1_5 Forward -169 -159 5.87944 0.197
NP_441689.1_5 Forward -39 -29 5.78111 0.197
NP_440344.1_10 Reverse -21 -38 0.530496 0.0353
NP_440344.1_10 Reverse -151 -168 -13.1375 0.276
NP_440531.1_6 Reverse -269 -288 2.94938 0.148
NP_440531.1_8 Forward -196 -177 2.0644 0.298
NP_442123.1_3 Forward -37 -18 16.8141 0.0891
NP_441060.1_3 Forward -278 -259 8.75091 0.237
NP_441335.1_4 Reverse -125 -144 8.84924 0.279
NP_441965.1_10 Reverse -25 -41 6.9417 0.159
NP_441965.1_10 Reverse -375 -391 3.79511 0.253
NP_440297.1_9 Forward -226 -216 7.05986 0.15
NP_440297.1_9 Reverse -219 -229 2.14332 0.267
NP_440297.1_9 Reverse -176 -186 0.471689 0.282
NP_440297.1_9 Reverse -29 -39 -0.118297 0.282
NP_440297.1_9 Forward -36 -26 -0.216628 0.282
NP_440297.1_9 Forward -285 -275 -0.511621 0.289
NP_441592.1_4 Reverse -136 -155 -2.26216 0.261
NP_441592.1_4 Forward -233 -214 -2.95047 0.274
NP_441103.1_9 Forward -372 -362 13.2708 0.27
NP_440894.1_10 Reverse -125 -144 5.70265 0.228
NP_440999.1_9 Reverse -171 -185 7.47274 0.086
NP_440999.1_9 Reverse -24 -38 5.30946 0.113
NP_440999.1_9 Forward -149 -135 1.37622 0.166
NP_440888.1_2 Forward -37 -23 18.6818 0.00204
NP_440888.1_2 Reverse -28 -42 13.372 0.0297
NP_440888.1_2 Reverse -158 -172 8.94708 0.142
NP_440600.1_4 Forward -45 -27 -8.04399 0.294
NP_440491.1_1 Reverse -25 -44 8.0865 0.251
NP_442277.1_4 Reverse -166 -185 5.80018 0.172
NP_442033.1_10 Reverse -26 -45 -13.2752 0.284
NP_440575.1_6 Forward -261 -242 21.6314 0.0786
NP_441543.1_2 Forward -36 -27 18.486 0.00236
NP_441543.1_2 Reverse -29 -38 16.9127 0.00359
NP_441543.1_2 Reverse -159 -168 14.0611 0.0149
NP_441543.1_2 Forward -166 -157 7.07956 0.131
NP_441543.1_3 Forward -363 -349 6.19383 0.286
NP_442845.1_2 Forward -43 -29 6.29277 0.212
NP_441834.1_10 Reverse -295 -314 4.03102 0.26
NP_441319.1_8 Reverse -235 -253 6.01734 0.273
NP_441469.1_8 Reverse -27 -36 16.126 0.00797
NP_441469.1_8 Forward -185 -176 10.4228 0.216
NP_441469.1_8 Forward -38 -29 6.48957 0.227
NP_442315.1_3 Forward -49 -30 10.0292 0.172
NP_443064.1_6 Reverse -28 -38 12.5669 0.0796
NP_443064.1_6 Forward -167 -157 11.6943 0.124
NP_443064.1_6 Forward -272 -262 8.88251 0.262
NP_442578.1_5 Forward -209 -190 -0.197208 0.286
NP_442578.1_7 Reverse -159 -166 14.6904 0.026
NP_442578.1_7 Forward -36 -29 14.5921 0.026
NP_442578.1_7 Reverse -29 -36 14.5921 0.026
NP_440710.1_1 Reverse -167 -185 -7.06068 0.232
NP_441462.1_2 Forward -37 -27 11.5831 0.00406
NP_441462.1_2 Reverse -28 -38 11.5831 0.00406
NP_441462.1_2 Reverse -158 -168 10.8948 0.00519
NP_441462.1_2 Reverse -277 -287 7.64985 0.0543
NP_441462.1_2 Forward -167 -157 1.74999 0.0811
NP_441462.1_2 Reverse -175 -185 -0.904945 0.265
NP_441621.1_7 Reverse -26 -40 -3.147 0.188
NP_441621.1_7 Forward -39 -25 -3.34366 0.188
NP_441929.1_3 Forward -378 -359 0.786102 0.298
NP_443062.1_1 Reverse -28 -46 9.521 0.133
NP_443062.1_1 Forward -37 -19 5.71821 0.22
NP_443062.1_6 Forward -45 -26 1.17943 0.278
NP_442204.1_1 Forward -171 -160 0.451995 0.281
NP_442204.1_1 Reverse -309 -320 -0.432984 0.299
NP_441560.1_8 Forward -172 -153 11.6101 0.292
NP_441351.1_8 Reverse -26 -45 3.24438 0.232
NP_442487.1_5 Forward -370 -351 2.9486 0.291
NP_442872.1_1 Forward -21 -2 -7.27704 0.241
NP_440516.1_8 Forward -37 -28 16.9127 0.00442
NP_440516.1_8 Reverse -28 -37 16.9127 0.00442
NP_440516.1_8 Reverse -158 -167 8.45619 0.0364
NP_440516.1_8 Forward -167 -158 7.37455 0.0648
NP_440516.1_8 Reverse -277 -286 -0.393597 0.255
NP_440516.1_8 Reverse -218 -227 -0.590259 0.283
NP_441033.1_2 Reverse -18 -37 1.67108 0.135
NP_442428.1_4 Reverse -27 -46 11.6025 0.131
NP_442428.1_5 Forward -36 -29 15.8704 0.0124
NP_442428.1_5 Reverse -29 -36 15.8704 0.0124
NP_442428.1_5 Reverse -159 -166 6.13563 0.209
NP_442428.1_5 Forward -166 -159 6.0373 0.212
NP_442428.1_5 Forward -183 -176 4.759 0.223
NP_442428.1_5 Forward -285 -278 4.36568 0.271
NP_442428.1_5 Forward -226 -219 4.36568 0.271
NP_440603.1_9 Reverse -301 -320 2.3594 0.278
NP_440673.1_3 Forward -165 -158 12.4288 0.0426
NP_440673.1_3 Forward -35 -28 12.4288 0.0426
NP_440673.1_3 Reverse -30 -37 12.4288 0.0426
NP_440673.1_3 Reverse -138 -145 7.80726 0.244
NP_440673.1_7 Forward -178 -159 5.80098 0.169
NP_440673.1_7 Reverse -17 -36 0.687771 0.264
NP_441052.1_2 Reverse -28 -38 19.9412 0.00106
NP_441052.1_2 Forward -37 -27 10.5014 0.0285
NP_441052.1_2 Forward -167 -157 10.1081 0.0295
NP_441052.1_2 Reverse -158 -168 7.05986 0.0818
NP_441052.1_2 Forward -227 -217 4.60159 0.154
NP_442219.1_8 Reverse -24 -43 12.6122 0.154
NP_442219.1_9 Reverse -29 -38 17.7976 0.00718
NP_442219.1_9 Forward -36 -27 8.35786 0.0681
NP_442219.1_9 Forward -166 -157 7.96454 0.0696
NP_440436.1_4 Forward -36 -27 18.1905 0.00233
NP_440436.1_4 Reverse -29 -38 17.2072 0.00233
NP_440436.1_4 Forward -166 -157 7.57079 0.124
NP_441884.1_8 Reverse -276 -295 0.196116 0.138
NP_441884.1_9 Reverse -25 -44 -13.4719 0.138
NP_441884.1_9 Forward -170 -151 -23.4033 0.284
NP_440314.1_9 Reverse -159 -178 0.884433 0.0952
NP_441719.1_4 Forward -36 -29 16.3621 0.0124
NP_441719.1_4 Reverse -29 -36 16.3621 0.0124
NP_441719.1_4 Reverse -159 -166 13.5105 0.026
NP_441719.1_4 Forward -166 -159 6.52896 0.188
NP_441719.1_6 Reverse -72 -91 7.96345 0.269
NP_441719.1_6 Forward -372 -353 5.70185 0.288
NP_441733.1_10 Reverse -25 -38 7.88576 0.148
NP_441733.1_10 Forward -40 -27 7.09911 0.156
NP_441004.1_1 Forward -43 -24 -15.5368 0.275
NP_442366.1_3 Forward -168 -150 1.00246 0.16
NP_442366.1_3 Reverse -27 -45 -3.71743 0.255
NP_442366.1_5 Forward -40 -30 15.4175 0.0374
NP_442366.1_5 Reverse -155 -165 14.8275 0.0375
NP_441115.1_4 Reverse -27 -45 14.3747 0.0572
NP_441115.1_4 Forward -323 -305 7.98318 0.266
NP_443054.1_2 Forward -39 -25 3.04785 0.24
NP_442308.1_3 Reverse -209 -228 13.5691 0.251
NP_442308.1_4 Reverse -145 -164 -0.39387 0.294
NP_441851.1_10 Reverse -27 -37 16.008 0.00552
NP_441851.1_10 Forward -38 -28 15.8113 0.00552
NP_441851.1_10 Reverse -157 -167 11.8781 0.0602
NP_441851.1_10 Forward -185 -175 7.74818 0.132
NP_441668.1_4 Forward -47 -28 14.8474 0.0528
NP_441668.1_4 Forward -194 -175 7.7676 0.151
NP_442515.1_1 Forward -38 -24 14.6509 0.0276
NP_442515.1_1 Reverse -157 -171 -2.85201 0.281
NP_442515.1_1 Reverse -27 -41 -4.32697 0.298
NP_440593.1_3 Forward -42 -23 1.76941 0.185
NP_440593.1_3 Reverse -23 -42 -2.65548 0.227
NP_441982.1_6 Forward -245 -236 11.1485 0.288
NP_441046.1_2 Forward -48 -29 4.52268 0.228
NP_441046.1_2 Forward -276 -257 -2.16383 0.295
NP_440338.1_4 Reverse -60 -79 4.91521 0.298
NP_441349.1_10 Reverse -148 -167 -4.03212 0.158
NP_440389.1_5 Reverse -21 -40 11.9332 0.277
NP_440432.1_9 Forward -36 -21 9.32134 0.0427
NP_440432.1_9 Forward -166 -151 0.176559 0.159
NP_440432.1_9 Reverse -29 -44 -3.95334 0.194
NP_442843.1_1 Reverse -361 -380 -9.24366 0.264
NP_440474.1_8 Forward -36 -22 16.8135 0.0477
NP_442450.1_5 Forward -39 -29 7.55152 0.13
NP_442450.1_5 Reverse -216 -226 4.69992 0.297
NP_442168.1_5 Forward -36 -17 -3.54046 0.287
NP_440588.1_2 Reverse -304 -323 -6.68705 0.289
NP_440195.1_4 Forward -49 -30 8.45592 0.207
NP_440195.1_5 Reverse -22 -41 1.0811 0.295
NP_442006.1_2 Reverse -19 -36 -15.3008 0.221
NP_442006.1_2 Reverse -352 -369 -16.0874 0.238
NP_442006.1_2 Reverse -307 -324 -16.5791 0.256
NP_442006.1_2 Reverse -149 -166 -16.8741 0.265
NP_441570.1_1 Forward -167 -149 -2.53746 0.0659
NP_441570.1_1 Reverse -28 -46 -7.65067 0.0925
NP_441570.1_1 Forward -309 -291 -17.5821 0.283
NP_441078.1_4 Forward -37 -28 19.6659 0.0007
NP_441078.1_4 Reverse -28 -37 19.6659 0.0007
NP_441078.1_4 Reverse -158 -167 9.93116 0.0203
NP_441078.1_4 Forward -167 -158 9.83282 0.0226
NP_441078.1_4 Forward -227 -218 5.99792 0.0932
NP_441078.1_4 Forward -184 -175 -1.86856 0.272
NP_441078.1_4 Reverse -218 -227 -1.96689 0.282
NP_442729.1_8 Reverse -24 -37 10.1474 0.125
NP_442729.1_8 Forward -41 -28 9.36073 0.125
NP_442729.1_8 Forward -171 -158 7.09911 0.166
NP_440539.1_9 Forward -147 -128 2.3594 0.278
NP_441663.1_7 Forward -40 -21 3.14605 0.298
NP_440707.1_9 Reverse -203 -222 -0.000545616 0.293
NP_442443.1_1 Reverse -203 -222 -4.42544 0.272
NP_440526.1_3 Forward -36 -25 2.51647 0.267
NP_440526.1_3 Reverse -29 -40 1.04151 0.267
NP_440526.1_3 Forward -166 -155 0.64819 0.273
NP_441432.1_8 Forward -38 -29 16.8143 0.00595
NP_441432.1_8 Reverse -27 -36 8.25953 0.0755
NP_441432.1_8 Reverse -157 -166 7.27622 0.101
NP_441432.1_8 Forward -168 -159 6.98123 0.112
NP_442320.1_8 Reverse -22 -36 14.4542 0.0132
NP_442320.1_8 Forward -43 -29 4.32615 0.0511
NP_442320.1_8 Reverse -152 -166 -6.09693 0.265
NP_442320.1_9 Reverse -303 -317 11.7993 0.257
NP_442344.1_7 Forward -36 -17 -6.68705 0.172
NP_441732.1_2 Forward -41 -25 -6.52964 0.0495
NP_441732.1_2 Forward -171 -155 -15.6744 0.155
NP_440313.1_6 Reverse -361 -380 15.7324 0.285
NP_440760.1_1 Reverse -28 -47 14.8474 0.00699
NP_440760.1_1 Reverse -158 -177 -14.7502 0.135
NP_440760.1_1 Reverse -175 -194 -20.8467 0.225
NP_442797.1_1 Reverse -177 -196 -3.14714 0.271
NP_442797.1_7 Forward -228 -210 6.60732 0.206
NP_440199.1_10 Reverse -155 -165 7.25653 0.231
NP_442353.1_4 Forward -151 -132 10.52 0.106
NP_440913.1_1 Reverse -114 -132 5.23069 0.243
NP_440713.1_4 Forward -296 -277 1.47442 0.286
NP_442489.1_2 Forward -96 -77 4.22769 0.223
NP_442489.1_7 Forward -37 -28 20.1576 0.000695
NP_442489.1_7 Reverse -28 -37 20.1576 0.000695
NP_442489.1_7 Forward -167 -158 17.306 0.00302
NP_442489.1_7 Reverse -158 -167 10.4228 0.0151
NP_442489.1_7 Forward -184 -175 -1.37691 0.195
NP_442489.1_7 Forward -286 -277 -1.47524 0.203
NP_442489.1_7 Forward -227 -218 -1.77023 0.247
NP_440386.1_3 Reverse -368 -387 -7.37537 0.274
NP_442079.1_7 Forward -36 -17 5.11266 0.183
NP_440559.1_1 Reverse -29 -38 17.4043 0.00658
NP_440559.1_1 Forward -36 -27 8.75118 0.0586
NP_440559.1_1 Forward -166 -157 7.76787 0.0918
NP_440559.1_1 Reverse -159 -168 5.60459 0.139
NP_441659.2_8 Reverse -28 -38 18.1713 0.00133
NP_441659.2_8 Reverse -175 -185 12.0747 0.0147
NP_441659.2_8 Forward -37 -27 11.9764 0.0147
NP_441659.2_8 Reverse -158 -168 11.3864 0.0184
NP_441659.2_8 Forward -167 -157 8.53483 0.0412
NP_441659.2_8 Forward -286 -276 4.20827 0.142
NP_441659.2_8 Reverse -277 -287 -0.314959 0.298
NP_441022.1_1 Reverse -37 -46 11.4503 0.284
NP_441022.1_1 Forward -112 -103 10.8747 0.284
NP_442913.1_10 Forward -46 -27 2.3594 0.126
NP_442913.1_10 Reverse -19 -38 1.86774 0.133
NP_441040.1_5 Forward -314 -295 3.24438 0.275
NP_442008.1_2 Reverse -203 -222 5.60432 0.226
NP_442776.1_1 Reverse -176 -195 13.3725 0.127
NP_440779.1_5 Forward -37 -20 -5.56602 0.149
NP_440779.1_5 Forward -167 -150 -6.15601 0.164
NP_442346.1_1 Reverse -121 -140 10.0292 0.275
NP_442346.1_5 Forward -38 -28 16.6963 0.00248
NP_442346.1_5 Forward -228 -218 9.61647 0.118
NP_442346.1_5 Reverse -27 -37 9.02648 0.118
NP_442346.1_5 Reverse -157 -167 7.55152 0.165
NP_442346.1_5 Forward -185 -175 7.25653 0.176
NP_442346.1_5 Reverse -276 -286 7.15819 0.178
NP_442346.1_5 Forward -168 -158 6.46988 0.201
NP_440352.1_5 Forward -89 -70 13.9211 0.172
NP_440545.1_3 Forward -41 -24 -4.38605 0.224
NP_440545.1_3 Reverse -154 -171 -4.97604 0.237
NP_441786.1_10 Forward -295 -276 8.94757 0.233
NP_441126.1_1 Forward -75 -56 13.3448 0.223
NP_440459.1_2 Reverse -26 -43 12.7235 0.137
NP_440459.1_2 Forward -46 -29 10.9536 0.185
NP_440459.1_2 Forward -318 -301 7.512 0.288
NP_441653.1_2 Forward -48 -29 12.4199 0.0959
NP_441653.1_2 Forward -36 -17 5.84883 0.235
NP_442603.1_7 Reverse -28 -42 13.2736 0.0897
NP_441888.1_7 Forward -150 -136 9.04604 0.168
NP_441888.1_7 Reverse -170 -184 1.96621 0.232
NP_441948.1_4 Forward -44 -26 -2.3408 0.163
NP_441948.1_4 Reverse -21 -39 -4.79907 0.242
NP_441833.1_4 Forward -36 -29 15.9687 0.0124
NP_441833.1_4 Reverse -29 -36 15.9687 0.0124
NP_441833.1_4 Forward -166 -159 6.52896 0.0924
NP_441833.1_4 Reverse -159 -166 6.23397 0.163
NP_442162.1_9 Forward -36 -29 16.2637 0.0124
NP_442162.1_9 Reverse -29 -36 16.2637 0.0124
NP_442162.1_9 Reverse -159 -166 6.62729 0.142
NP_442162.1_9 Forward -166 -159 6.52896 0.178
NP_442199.1_5 Reverse -20 -39 4.42435 0.106
NP_442140.1_3 Forward -36 -26 17.4829 0.0159
NP_442140.1_3 Reverse -29 -39 12.2714 0.0632
NP_442140.1_3 Forward -285 -275 8.53483 0.119
NP_442140.1_3 Forward -183 -173 3.51995 0.294
NP_442723.1_1 Reverse -321 -340 3.34192 0.278
NP_440875.1_9 Forward -35 -25 9.44274 0.233
NP_440875.1_9 Forward -284 -274 8.08002 0.243
NP_441813.1_5 Reverse -26 -36 10.0098 0.0208
NP_441813.1_5 Forward -39 -29 8.63316 0.0367
NP_441813.1_5 Forward -288 -278 4.50326 0.155
NP_441813.1_5 Reverse -173 -183 -0.708283 0.272
NP_442089.1_1 Forward -40 -21 13.1758 0.0752
NP_440590.1_4 Reverse -29 -42 17.6205 0.00882
NP_440590.1_4 Forward -36 -23 10.344 0.0283
NP_440590.1_4 Reverse -159 -172 4.14919 0.0632
NP_440567.1_1 Forward -36 -22 9.83269 0.0414
NP_440567.1_1 Reverse -29 -43 4.32615 0.123
NP_440567.1_1 Forward -166 -152 1.17956 0.214
NP_442497.1_10 Forward -36 -27 10.4228 0.0087
NP_442497.1_10 Reverse -29 -38 10.4228 0.0087
NP_442497.1_10 Reverse -159 -168 7.86621 0.0695
NP_442497.1_10 Forward -166 -157 0.589713 0.153
NP_442497.1_10 Reverse -176 -185 0.491382 0.162
NP_442497.1_10 Forward -285 -276 0.29472 0.199
NP_442497.1_10 Forward -226 -217 0.29472 0.199
NP_440821.1_4 Reverse -26 -36 18.7612 0.00422
NP_440821.1_4 Forward -39 -29 9.41981 0.0286
NP_440821.1_4 Forward -169 -159 0.963343 0.145
NP_440821.1_4 Reverse -156 -166 -0.314959 0.251
NP_441239.1_9 Reverse -26 -38 16.0669 0.0175
NP_441239.1_9 Forward -288 -276 13.2153 0.0386
NP_441239.1_9 Reverse -173 -185 7.21714 0.169
NP_441239.1_9 Forward -229 -217 6.1355 0.2
NP_441239.1_9 Forward -39 -27 5.93884 0.202
NP_441239.1_9 Forward -169 -157 5.54551 0.217
NP_441239.1_9 Forward -371 -359 3.2839 0.289
NP_440156.1_4 Reverse -68 -78 12.9592 0.176
NP_441727.1_3 Reverse -151 -170 5.60432 0.252
NP_440624.1_5 Reverse -59 -77 14.9943 0.16
NP_441892.1_1 Forward -193 -176 3.57876 0.123
NP_441892.1_1 Reverse -149 -166 1.21881 0.155
NP_442270.1_9 Forward -314 -295 -8.06369 0.216
NP_442643.1_5 Reverse -31 -50 3.53937 0.25
NP_440354.1_7 Reverse -22 -40 10.7372 0.224
NP_440354.1_7 Reverse -130 -148 5.82068 0.297
NP_442138.1_9 Forward -138 -119 13.7649 0.202
NP_442138.1_10 Forward -167 -148 4.62101 0.106
NP_442052.1_8 Forward -186 -176 12.3697 0.271
NP_440546.1_4 Reverse -277 -287 14.5061 0.0459
NP_440546.1_4 Forward -37 -27 11.8882 0.0679
NP_440546.1_4 Forward -286 -276 10.4338 0.109
NP_440546.1_4 Reverse -28 -38 10.046 0.109
NP_440546.1_4 Reverse -218 -228 9.56122 0.131
NP_442041.1_5 Forward -292 -273 -0.197208 0.266
NP_441230.1_5 Reverse -23 -42 1.76941 0.234
NP_440462.1_6 Reverse -26 -36 17.9746 0.00578
NP_440462.1_6 Forward -169 -159 9.81313 0.0429
NP_440462.1_6 Forward -288 -278 5.38824 0.156
NP_440462.1_6 Forward -39 -29 1.35667 0.294
NP_440868.1_4 Reverse -24 -36 9.67541 0.0441
NP_440868.1_4 Forward -41 -29 -0.944332 0.284
NP_441249.1_3 Reverse -26 -45 1.86774 0.278
NP_442479.1_9 Reverse -39 -58 -12.6852 0.287
NP_442402.1_4 Reverse -326 -345 -8.55607 0.283
NP_440696.1_6 Forward -179 -160 11.2092 0.207
NP_442039.1_4 Forward -36 -29 15.1821 0.0124
NP_442039.1_4 Reverse -29 -36 15.1821 0.0124
NP_442039.1_4 Forward -195 -188 6.13563 0.297
NP_441811.1_8 Forward -173 -159 5.80112 0.289
NP_440825.1_7 Forward -166 -156 13.0072 0.152
NP_440825.1_7 Reverse -29 -39 12.9096 0.152
NP_442696.1_2 Forward -38 -20 19.292 0.0392
NP_442837.1_3 Forward -36 -29 15.7721 0.0124
NP_442837.1_3 Reverse -29 -36 15.7721 0.0124
NP_442837.1_3 Forward -166 -159 12.1338 0.0702
NP_442837.1_3 Reverse -159 -166 6.0373 0.25
NP_440160.1_2 Reverse -170 -189 -9.047 0.293
NP_442053.1_1 Forward -37 -28 18.3876 0.0007
NP_442053.1_1 Reverse -28 -37 18.3876 0.0007
NP_442053.1_1 Forward -167 -158 16.3227 0.00389
NP_442053.1_1 Reverse -158 -167 8.65285 0.0741
NP_440505.1_3 Reverse -26 -36 14.1397 0.0235
NP_440505.1_3 Forward -39 -29 9.22315 0.122
NP_440505.1_3 Forward -169 -159 5.5849 0.222
NP_442360.1_5 Forward -315 -305 13.2547 0.28
NP_441959.1_9 Forward -324 -305 13.7658 0.267
NP_441102.1_2 Forward -84 -65 8.75091 0.287
NP_441252.1_6 Forward -312 -305 14.3954 0.168
NP_441203.1_1 Reverse -159 -178 -5.11376 0.0909
NP_441203.1_1 Forward -36 -17 -12.7836 0.145
NP_442532.1_7 Forward -37 -23 5.70279 0.171
NP_441408.2_7 Reverse -26 -45 -1.47551 0.251
NP_441408.2_7 Forward -235 -216 -5.70374 0.299
NP_440914.1_1 Reverse -28 -38 17.5935 0.000537
NP_440914.1_1 Forward -37 -27 8.6151 0.186
NP_440914.1_1 Forward -167 -157 8.51751 0.186
NP_440914.1_1 Reverse -158 -168 6.66328 0.269
NP_440914.1_1 Reverse -379 -389 6.46809 0.279
NP_441011.1_8 Forward -36 -27 16.9127 0.00602
NP_441011.1_8 Reverse -29 -38 8.25953 0.144
NP_441011.1_8 Reverse -242 -251 8.06287 0.16
NP_441011.1_8 Forward -226 -217 8.06287 0.16
NP_441011.1_8 Reverse -159 -168 6.98123 0.18
NP_441011.1_8 Forward -183 -174 5.21127 0.278
NP_442533.1_6 Forward -37 -28 17.2076 0.00137
NP_442533.1_6 Reverse -28 -37 17.2076 0.00137
NP_442533.1_6 Forward -184 -175 11.5045 0.0432
NP_442533.1_6 Forward -167 -158 7.57121 0.0898
NP_442533.1_6 Reverse -158 -167 7.47288 0.0898
NP_442533.1_6 Reverse -277 -286 5.70292 0.132
NP_442533.1_6 Forward -286 -277 3.53964 0.21
NP_442533.1_6 Reverse -136 -145 3.53964 0.21
NP_442533.1_6 Forward -139 -130 2.55633 0.25
NP_440263.1_5 Forward -384 -370 7.17775 0.294
NP_442232.1_3 Forward -192 -173 -14.8485 0.288
NP_442322.1_4 Reverse -179 -196 -9.99156 0.297
NP_441482.1_7 Forward -43 -29 -0.885388 0.0612
NP_441482.1_7 Forward -190 -176 -1.18038 0.0637
NP_441482.1_7 Forward -173 -159 -12.0951 0.29
NP_439944.1_9 Reverse -29 -39 10.5014 0.0887
NP_439944.1_9 Forward -36 -26 10.4031 0.0887
NP_439944.1_9 Reverse -159 -169 8.4365 0.108
NP_440816.1_2 Forward -80 -61 6.82221 0.27
NP_440116.1_5 Reverse -155 -172 8.10198 0.155
NP_440116.1_8 Reverse -29 -48 -0.688862 0.112
NP_440115.1_6 Reverse -274 -284 6.8632 0.167
NP_441680.1_4 Forward -218 -199 6.29264 0.176
NP_441602.1_3 Forward -42 -23 -1.86883 0.231
NP_440317.1_9 Reverse -127 -146 13.4708 0.181
NP_441972.1_5 Reverse -29 -48 14.6508 0.0331
NP_441972.1_5 Forward -166 -147 -1.47551 0.177
NP_441972.1_5 Reverse -176 -195 -2.95047 0.194
NP_441106.1_1 Reverse -27 -36 18.191 0.0028
NP_441106.1_1 Forward -38 -29 9.63616 0.0311
NP_441106.1_1 Forward -168 -159 8.84951 0.0431
NP_441106.1_1 Forward -287 -278 4.81794 0.202
NP_441106.1_1 Reverse -174 -183 4.71961 0.21
NP_441420.1_1 Reverse -157 -176 3.04771 0.166
NP_441420.1_1 Forward -38 -19 -3.3438 0.291
NP_439903.1_6 Reverse -291 -310 1.57197 0.243
NP_439903.1_6 Forward -46 -27 -0.0996487 0.276
NP_439903.1_6 Reverse -25 -44 -1.37794 0.299
NP_439903.1_7 Reverse -127 -146 6.88262 0.281
NP_442588.1_6 Reverse -119 -138 -2.95047 0.296
NP_442306.1_10 Forward -42 -23 -19.5684 0.199
NP_441286.1_1 Forward -38 -26 14.7886 0.00418
NP_441286.1_1 Reverse -157 -169 5.25052 0.0259
NP_441286.1_1 Reverse -27 -39 3.38223 0.0467
NP_441286.1_1 Reverse -217 -229 -6.05754 0.245
NP_441286.1_1 Forward -168 -156 -6.35254 0.26
NP_440670.1_8 Forward -37 -28 18.3876 0.000699
NP_440670.1_8 Reverse -28 -37 18.3876 0.000699
NP_440670.1_8 Reverse -158 -167 9.53783 0.0559
NP_440670.1_8 Forward -167 -158 9.14451 0.0583
NP_441930.1_2 Forward -228 -218 11.3864 0.294
NP_440886.1_7 Reverse -27 -37 17.7774 0.0011
NP_440886.1_7 Forward -38 -28 7.94438 0.0805
NP_440886.1_7 Reverse -174 -184 7.74772 0.0843
NP_442382.1_7 Forward -50 -31 5.30933 0.252
NP_442072.1_9 Reverse -27 -45 -4.11075 0.041
NP_442072.1_9 Forward -38 -20 -21.3187 0.207
NP_442072.1_9 Reverse -157 -175 -22.1053 0.22
NP_441753.1_10 Reverse -19 -38 5.01433 0.193
NP_441808.1_8 Reverse -110 -129 9.83255 0.242
NP_442022.1_4 Reverse -295 -314 6.58763 0.27
NP_440907.2_8 Forward -36 -26 17.4824 0.00685
NP_440907.2_8 Reverse -159 -169 15.9091 0.0161
NP_440907.2_8 Reverse -29 -39 7.64939 0.117
NP_441021.1_1 Reverse -29 -48 -8.26035 0.194
NP_441021.1_1 Reverse -159 -178 -9.34199 0.215
NP_441463.1_3 Reverse -18 -37 -6.49039 0.246
NP_441463.1_6 Forward -39 -25 5.73949 0.287
NP_442842.1_4 Reverse -29 -48 4.22769 0.251
NP_442061.1_8 Forward -246 -232 13.6676 0.28
NP_441626.1_2 Forward -36 -29 15.7721 0.0124
NP_441626.1_2 Reverse -29 -36 15.7721 0.0124
NP_441626.1_2 Reverse -159 -166 6.13563 0.177
NP_441626.1_2 Forward -166 -159 5.93897 0.231
NP_441626.1_6 Forward -146 -128 6.31156 0.267
NP_442211.1_3 Reverse -140 -159 9.22274 0.257
NP_441901.1_1 Forward -46 -27 3.24438 0.218
NP_442794.1_1 Forward -41 -29 19.1152 0.00716
NP_442615.1_1 Reverse -209 -227 11.4255 0.0179
NP_442615.1_1 Reverse -19 -37 5.52568 0.0379
NP_442615.1_1 Reverse -149 -167 -2.0458 0.138
NP_442615.1_1 Forward -46 -28 -2.43913 0.144
NP_442615.1_1 Forward -176 -158 -5.48739 0.215
NP_441962.1_4 Forward -42 -23 -6.78538 0.181
NP_440387.1_1 Reverse -158 -174 17.2665 0.0044
NP_440387.1_1 Reverse -28 -44 13.0382 0.00969
NP_440387.1_1 Forward -37 -21 -0.43312 0.138
NP_441431.1_2 Reverse -172 -186 17.0102 0.0303
NP_441431.1_2 Reverse -25 -39 11.602 0.136
NP_441488.1_8 Forward -42 -28 10.9137 0.146
NP_441836.1_2 Reverse -130 -149 2.55606 0.171
NP_441836.1_2 Forward -292 -273 -0.688862 0.214
NP_441836.1_2 Reverse -22 -41 -3.54046 0.239
NP_441993.1_1 Forward -190 -171 8.28142 0.15
NP_441993.1_1 Forward -43 -24 7.20938 0.172
NP_441993.1_1 Reverse -218 -237 2.33652 0.26
NP_440814.1_4 Forward -46 -27 -12.8819 0.248
NP_440467.1_3 Reverse -176 -195 10.7679 0.296
NP_440114.1_10 Reverse -277 -291 12.4876 0.0814
NP_440114.1_10 Forward -37 -23 11.6026 0.107
NP_440114.1_10 Forward -227 -213 9.5377 0.169
NP_440287.1_5 Reverse -226 -245 8.4551 0.286
NP_440293.1_3 Forward -192 -173 2.94938 0.192
NP_440766.1_4 Forward -41 -27 0.687908 0.271
NP_441237.1_9 Reverse -29 -39 14.828 0.0242
NP_441237.1_9 Forward -166 -156 12.0747 0.139
NP_442930.1_1 Forward -398 -388 14.3359 0.239
NP_442930.1_1 Reverse -67 -77 14.0409 0.239
NP_441133.1_1 Forward -192 -173 13.7658 0.24
NP_442867.1_3 Reverse -218 -237 1.57275 0.223
NP_440457.1_1 Forward -188 -176 3.2839 0.199
NP_440457.1_1 Reverse -273 -285 2.79224 0.205
NP_440457.1_1 Reverse -356 -368 -0.157684 0.254
NP_440798.1_6 Forward -36 -23 12.409 0.0468
NP_442297.1_3 Reverse -22 -41 13.6666 0.183
NP_441984.1_3 Reverse -24 -42 17.0304 0.0928
NP_441984.1_3 Reverse -171 -189 6.50899 0.269
NP_440473.1_1 Forward -289 -270 13.5712 0.188
NP_442509.1_9 Forward -37 -27 16.2041 0.00739
NP_442509.1_9 Reverse -28 -38 8.14104 0.192
NP_440554.1_4 Forward -36 -26 13.943 0.0218
NP_440554.1_4 Reverse -278 -288 7.35486 0.103
NP_440554.1_4 Reverse -159 -169 5.68323 0.135
NP_441845.1_3 Forward -137 -118 17.9932 0.161
NP_441845.1_6 Forward -179 -161 13.3922 0.0973
NP_441885.1_5 Reverse -28 -38 20.9245 0.000538
NP_441885.1_5 Forward -37 -27 11.4848 0.00668
NP_441885.1_5 Forward -167 -157 11.0914 0.00874
NP_441885.1_5 Reverse -158 -168 1.94665 0.0935
NP_441885.1_5 Reverse -277 -287 -1.3966 0.26
NP_440628.1_1 Forward -240 -230 13.6803 0.279
NP_440478.1_4 Forward -41 -22 10.7175 0.267
NP_440478.1_9 Reverse -179 -198 9.63589 0.255
NP_440478.1_10 Reverse -26 -40 8.25939 0.257
NP_442310.1_1 Forward -198 -179 11.7992 0.244
NP_442341.1_7 Reverse -27 -41 17.4042 0.012
NP_442341.1_7 Forward -38 -24 11.6026 0.0534
NP_442341.1_7 Reverse -157 -171 2.45787 0.256
NP_442341.1_7 Forward -168 -154 1.57289 0.286
NP_443000.1_7 Forward -39 -29 10.3048 0.0345
NP_443000.1_7 Reverse -26 -36 2.04498 0.226
NP_443000.1_7 Forward -169 -159 0.963343 0.278
NP_443000.1_7 Reverse -156 -166 0.57002 0.294
NP_441842.1_10 Reverse -21 -35 16.6175 0.0301
NP_441842.1_10 Reverse -151 -165 10.9143 0.148
NP_440275.1_3 Reverse -26 -36 17.9746 0.0082
NP_440275.1_3 Forward -169 -159 9.02648 0.0563
NP_440275.1_3 Forward -39 -29 8.04317 0.0602
NP_440275.1_3 Reverse -275 -285 4.60159 0.182
NP_440091.1_1 Reverse -24 -36 10.8554 0.0429
NP_440091.1_1 Reverse -154 -166 -0.846001 0.293
NP_442354.1_8 Reverse -268 -287 5.70265 0.288
NP_440616.1_9 Forward -90 -71 13.8641 0.123
NP_439962.1_4 Forward -153 -134 -1.37718 0.214
NP_440175.1_4 Reverse -128 -147 -8.85033 0.171
NP_440149.1_8 Forward -37 -18 -0.295539 0.146
NP_440149.1_8 Reverse -28 -47 -1.27885 0.157
NP_440149.1_8 Reverse -130 -149 -5.9004 0.235
NP_440149.1_8 Forward -233 -214 -6.49039 0.253
NP_440149.1_10 Reverse -158 -177 5.01433 0.203
NP_441105.1_3 Forward -195 -176 -4.42544 0.2
NP_442373.1_2 Forward -187 -168 -10.1286 0.272
NP_440216.1_1 Forward -37 -23 15.1426 0.00419
NP_440216.1_1 Reverse -28 -42 -0.787057 0.0284
NP_440216.1_1 Forward -167 -153 -11.3085 0.178
NP_440216.1_1 Forward -184 -170 -11.6035 0.203
NP_440216.1_1 Reverse -158 -172 -12.4884 0.274
NP_440172.1_1 Reverse -28 -38 15.0247 0.00945
NP_440172.1_1 Forward -37 -27 8.73149 0.0586
NP_440172.1_1 Reverse -158 -168 7.84651 0.0718
NP_440172.1_1 Forward -167 -157 5.38824 0.145
NP_442015.1_10 Forward -41 -28 11.229 0.0372
NP_441226.1_7 Forward -36 -29 14.4934 0.0123
NP_441226.1_7 Reverse -29 -36 14.4934 0.0123
NP_441226.1_7 Reverse -278 -285 12.4284 0.0404
NP_441111.1_7 Forward -36 -28 18.7023 0.00294
NP_441111.1_7 Reverse -29 -37 18.7023 0.00294
NP_441111.1_7 Reverse -159 -167 8.96754 0.0463
NP_441111.1_7 Forward -166 -158 8.86921 0.0589
NP_441111.1_7 Reverse -176 -184 -0.668896 0.274
NP_442379.1_10 Forward -236 -219 1.31714 0.223
NP_441766.1_2 Forward -37 -28 17.5026 0.00297
NP_441766.1_2 Reverse -28 -37 17.5026 0.00297
NP_441766.1_2 Reverse -158 -167 7.76787 0.0714
NP_441766.1_2 Forward -167 -158 7.76787 0.0714
NP_441766.1_2 Forward -184 -175 4.91628 0.154
NP_442417.1_5 Reverse -28 -42 9.14437 0.138
NP_440416.1_9 Forward -44 -25 -18.9784 0.267
NP_443052.1_8 Reverse -18 -37 2.85105 0.0539
NP_443052.1_9 Reverse -174 -193 -3.14714 0.245
NP_443052.1_9 Forward -218 -199 -3.83545 0.252
NP_442154.1_1 Reverse -128 -146 -13.8455 0.217
NP_442154.1_1 Forward -183 -165 -17.8771 0.272
NP_442564.1_10 Forward -134 -120 8.55439 0.296
NP_442564.1_10 Forward -317 -303 8.06273 0.296
NP_440261.1_5 Forward -285 -272 12.704 0.0244
NP_440261.1_5 Forward -36 -23 -1.06236 0.0655
NP_440261.1_5 Forward -144 -131 -8.04386 0.201
NP_440261.1_5 Reverse -29 -42 -10.3055 0.201
NP_440988.1_7 Forward -41 -22 0.786102 0.238
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAACAAAATTCTCGGGTTTCCCGGTAAATTCTCCGCTGCCCCTTCATCCCACAGTTGGGAGCTAATGAGGACTAAATCTGCCTGCACCTTGGGCAAACGAAATCCCTTAGTGCAACCGATGGCCCGGAAAGGATTAGCCAAGATCCGGAAACCGTTAGCCGAAAAGAGGAAAGCGCTATGGCCCAACCACTCCACCTGTAAACCAGAGCTAGCTTGGGCGGTGGCTGGTCTGAGTCGATCGCCAATTTGGACTCCAGCAACGGCCAGCAACCCGGCTCCAGCGGTACGAATAAATTTTCGTCGTTTCATGGAAATGGAGAATGGAGAAATTTTTAAGATTCAAGAACTCTAGGACAAACCTTTGGCGATCGCCGCATGGACTCCCAGCATAATAACAACA

CDS

ATGGTTTTGGGCTTTGGGGCAGGGACAAAATTTAATCCCCAATTAACCCTGTCTCAAAACTTAACATCATTAACGGAAATATCCTTTAGAATTTTGGCCAATTGCCGCTTTGACCATTGGTCAATGTTATTAGCCCTGGCAGGGGTTGACGTTTCCCCATACACAACAGAGGATTTTTCAATGATGGAAAGAGACTTACCCAAATATCGCATGGTCTGTACCCTATCCTTTGGGGATATTTATGGCCAAATCATTGTCTGGCTAATTGTAATTTTCCTTTCCCTCGCATCCGCCTTGGCCCTGGCCAGTAGTACCCGGCCGGTCTATGCCCTAGCCACAGTGGGTCTGGTCTTGGTGCTTTCGTTGCCATTTTTACTGTTTAGCTTTGTCACCACCCTATTTAACCATTTGGATTTTGTCCCGGTGGAGTCCGATTAA

Protein

MVLGFGAGTKFNPQLTLSQNLTSLTEISFRILANCRFDHWSMLLALAGVDVSPYTTEDFSMMERDLPKYRMVCTLSFGDIYGQIIVWLIVIFLSLASALALASSTRPVYALATVGLVLVLSLPFLLFSFVTTLFNHLDFVPVESD