Your browser is old and dusty. Try Google Chrome!

Details for sll1915

ORF sll1915
Accession NP_440594.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -97 -83 11.0127 0.256
NP_442711.1_1 Forward -38 -24 10.816 0.264
NP_440795.1_7 Forward -77 -70 10.2655 0.154
NP_441453.1_7 Reverse -110 -117 11.6422 0.298
NP_442877.1_3 Reverse -318 -337 11.3067 0.239
NP_442151.1_6 Reverse -159 -173 5.40779 0.278
NP_442328.1_8 Forward -166 -147 18.6823 0.166
NP_442287.1_1 Reverse -220 -230 14.3359 0.266
NP_442752.1_4 Forward -212 -205 9.47889 0.109
NP_442752.1_4 Reverse -14 -21 5.54565 0.194
NP_440110.1_8 Forward -230 -211 -0.983855 0.232
NP_439979.1_7 Reverse -204 -221 14.6902 0.267
NP_442062.1_8 Forward -94 -84 4.40493 0.217
NP_442062.1_8 Reverse -63 -73 3.22496 0.279
NP_442062.1_8 Forward -251 -241 3.12662 0.285
NP_441859.1_3 Reverse -72 -91 6.29183 0.18
NP_440304.1_4 Reverse -240 -250 6.37155 0.158
NP_440044.1_8 Reverse -257 -276 2.16274 0.155
NP_440393.1_2 Reverse -248 -267 17.109 0.101
NP_440916.1_1 Forward -310 -296 12.1926 0.206
NP_440916.1_1 Reverse -196 -210 7.66941 0.3
NP_441208.1_1 Forward -212 -193 -5.31042 0.281
NP_441208.1_9 Forward -337 -323 8.35772 0.219
NP_442726.1_4 Forward -211 -192 4.22769 0.28
NP_441738.1_2 Forward -309 -302 8.29857 0.176
NP_440538.1_1 Reverse -63 -81 15.5554 0.25
NP_442111.1_4 Forward -266 -252 3.93283 0.226
NP_442111.1_4 Reverse -13 -27 2.2612 0.283
NP_440906.1_5 Forward -141 -134 8.79057 0.149
NP_441130.1_10 Reverse -240 -254 5.89945 0.211
NP_441486.1_1 Reverse -322 -336 0.687908 0.129
NP_440842.1_10 Reverse -239 -253 8.84938 0.251
NP_441012.1_4 Forward -115 -102 7.39411 0.272
NP_443018.1_3 Forward -77 -70 4.36568 0.254
NP_443018.1_3 Reverse -70 -77 4.07068 0.299
NP_440376.1_1 Forward -251 -242 4.32629 0.163
NP_440376.1_1 Forward -334 -325 3.83464 0.19
NP_440376.1_1 Forward -230 -221 1.96635 0.236
NP_441857.1_6 Forward -231 -221 15.0247 0.215
NP_442687.1_7 Reverse -241 -251 7.05986 0.142
NP_441846.1_10 Forward -224 -205 -4.6221 0.172
NP_441846.1_10 Forward -222 -203 -11.3086 0.19
NP_441846.1_10 Forward -216 -197 -21.0434 0.256
NP_441013.1_2 Reverse -68 -86 -4.20908 0.298
NP_441422.1_7 Forward -80 -63 10.8552 0.0597
NP_440360.1_10 Forward -249 -235 2.35953 0.267
NP_442658.1_1 Reverse -240 -250 12.9592 0.0423
NP_442658.1_1 Forward -80 -70 6.0761 0.238
NP_440141.1_3 Forward -90 -71 5.211 0.274
NP_442782.1_2 Forward -84 -70 4.12949 0.257
NP_442205.1_5 Forward -224 -206 17.4237 0.284
NP_441256.1_2 Forward -338 -319 17.8957 0.132
NP_442321.1_1 Reverse -341 -360 -0.39387 0.171
NP_442605.1_4 Forward -135 -116 9.83255 0.275
NP_440203.1_5 Reverse -328 -338 10.9926 0.206
NP_442690.1_1 Forward -139 -120 -16.4218 0.289
NP_440153.1_8 Reverse -319 -332 -3.52063 0.295
NP_442064.1_1 Reverse -198 -217 -13.5702 0.293
NP_442064.1_9 Reverse -377 -396 12.3892 0.17
NP_443055.1_6 Reverse -242 -260 -2.24319 0.291
NP_440993.1_6 Reverse -15 -32 11.8386 0.256
NP_440934.1_2 Reverse -378 -397 -0.295539 0.296
NP_441099.1_5 Reverse -204 -223 -10.3253 0.25
NP_442002.1_1 Forward -221 -203 -4.11075 0.225
NP_442002.1_1 Reverse -345 -363 -6.66736 0.249
NP_442002.1_9 Reverse -301 -308 12.8221 0.185
NP_442002.1_9 Reverse -241 -248 12.2322 0.185
NP_440377.1_1 Reverse -29 -46 12.24 0.26
NP_441916.1_7 Forward -334 -324 2.7333 0.243
NP_441041.1_7 Forward -254 -242 8.77809 0.131
NP_441725.1_4 Forward -193 -179 13.1753 0.0693
NP_441725.1_5 Forward -250 -240 7.64985 0.0904
NP_439966.1_7 Reverse -206 -216 4.7978 0.258
NP_439966.1_7 Forward -304 -294 4.01116 0.295
NP_439966.1_9 Forward -144 -135 7.57121 0.253
NP_440289.1_2 Forward -254 -241 -4.20895 0.283
NP_440289.1_2 Reverse -322 -335 -5.19226 0.3
NP_442281.1_1 Reverse -320 -334 9.34041 0.0717
NP_001035871.2_7 Forward -233 -223 12.6647 0.262
NP_442012.1_1 Reverse -8 -27 1.17943 0.222
NP_440723.1_4 Forward -145 -126 -9.44032 0.272
NP_441556.1_10 Forward -28 -14 10.8058 0.257
NP_441644.1_6 Forward -78 -68 8.23937 0.104
NP_440867.1_10 Reverse -373 -392 3.04771 0.283
NP_442215.1_2 Reverse -100 -116 -5.64466 0.254
NP_440929.1_8 Reverse -242 -251 4.91628 0.162
NP_441751.2_8 Forward -250 -236 -6.09693 0.252
NP_441762.1_7 Reverse -132 -144 5.15219 0.0443
NP_442142.1_4 Forward -305 -292 3.46031 0.255
NP_442142.1_4 Forward -355 -342 2.67367 0.281
NP_440122.1_6 Forward -340 -321 12.0942 0.23
NP_442381.1_8 Reverse -130 -149 -7.96535 0.207
NP_443009.1_2 Forward -381 -362 -4.52377 0.256
NP_443009.1_5 Reverse -241 -252 6.54802 0.157
NP_440357.1_3 Reverse -240 -259 -0.197208 0.29
NP_440158.1_8 Forward -144 -125 9.3409 0.285
NP_441198.1_8 Reverse -131 -141 10.5368 0.265
NP_441468.1_1 Forward -77 -70 4.46401 0.224
NP_441020.2_6 Reverse -240 -257 8.39697 0.2
NP_441673.1_1 Reverse -242 -251 -8.06341 0.254
NP_440265.1_4 Forward -99 -80 16.8577 0.287
NP_441826.1_2 Reverse -319 -333 1.67122 0.144
NP_441826.1_5 Forward -87 -68 4.71934 0.253
NP_441637.1_9 Reverse -187 -205 -1.55415 0.292
NP_442868.1_6 Reverse -240 -250 5.28991 0.154
NP_442227.1_2 Reverse -203 -222 4.81767 0.204
NP_442227.1_2 Reverse -202 -221 3.44104 0.216
NP_442227.1_2 Reverse -204 -223 -2.36049 0.272
NP_442808.1_1 Forward -143 -133 4.89613 0.185
NP_442808.1_1 Reverse -324 -334 3.61784 0.234
NP_442775.1_6 Reverse -338 -357 9.83255 0.289
NP_442542.1_2 Forward -144 -131 4.64084 0.299
NP_442050.1_1 Forward -224 -205 19.764 0.116
NP_442050.1_5 Reverse -240 -250 8.43603 0.234
NP_442050.1_5 Reverse -131 -141 7.94438 0.243
NP_442903.1_2 Reverse -23 -42 5.96782 0.185
NP_441114.1_3 Reverse -104 -113 7.57121 0.231
NP_440558.1_2 Forward -386 -367 -1.47551 0.214
NP_440558.1_2 Reverse -60 -79 -5.01543 0.251
NP_440558.1_2 Reverse -380 -399 -6.29373 0.273
NP_440558.1_2 Forward -121 -102 -7.67036 0.298
NP_441518.1_6 Reverse -324 -343 17.6007 0.128
NP_441878.1_6 Forward -335 -325 1.65166 0.0795
NP_441878.1_6 Forward -252 -242 -6.8048 0.196
NP_441458.1_10 Forward -87 -68 9.73422 0.151
NP_441458.1_10 Reverse -60 -79 4.12936 0.236
NP_442183.1_1 Reverse -133 -147 8.94771 0.105
NP_442645.1_2 Reverse -61 -80 -15.5368 0.203
NP_441037.1_4 Reverse -240 -250 8.29227 0.237
NP_442317.1_6 Reverse -237 -256 5.99764 0.238
NP_441633.1_3 Forward -368 -355 -6.37223 0.248
NP_441633.1_3 Reverse -83 -96 -6.96221 0.283
NP_440136.1_1 Reverse -187 -203 13.6275 0.238
NP_440136.1_2 Forward -141 -134 4.26735 0.218
NP_442998.1_5 Reverse -15 -25 8.53483 0.261
NP_440299.1_1 Reverse -65 -78 12.5067 0.0369
NP_441007.1_10 Forward -256 -243 0.904263 0.212
NP_441007.1_10 Reverse -237 -250 -0.767364 0.293
NP_440256.1_1 Reverse -66 -85 -7.08038 0.228
NP_441229.1_10 Reverse -123 -142 2.45773 0.288
NP_442007.1_8 Reverse -71 -89 11.2281 0.258
NP_441559.1_8 Forward -99 -85 -1.8687 0.186
NP_441559.1_8 Forward -146 -132 -5.21195 0.254
NP_441559.1_9 Forward -214 -195 13.2741 0.192
NP_441296.1_9 Reverse -203 -216 11.5234 0.232
NP_440717.1_3 Forward -363 -349 10.3237 0.231
NP_442866.1_1 Forward -147 -128 -7.76869 0.268
NP_441464.1_8 Reverse -242 -256 7.17775 0.217
NP_441464.1_10 Reverse -291 -305 14.6509 0.166
NP_441464.1_10 Reverse -231 -245 9.04604 0.265
NP_442386.1_9 Forward -143 -134 6.68581 0.219
NP_442386.1_9 Forward -79 -70 5.21086 0.262
NP_440570.1_5 Forward -356 -337 9.43923 0.159
NP_441340.1_5 Reverse -70 -77 3.97235 0.274
NP_442484.1_2 Reverse -203 -222 3.14605 0.21
NP_440168.1_4 Forward -356 -337 -5.40875 0.255
NP_440146.1_2 Forward -84 -70 11.6026 0.3
NP_441254.1_1 Forward -274 -261 11.0318 0.295
NP_441027.1_1 Reverse -192 -206 16.9119 0.205
NP_440684.1_9 Reverse -374 -388 7.66941 0.256
NP_443051.1_1 Reverse -241 -250 -1.08191 0.281
NP_440451.1_1 Forward -93 -74 20.059 0.114
NP_439984.1_7 Reverse -199 -217 -4.99573 0.292
NP_439937.1_9 Reverse -13 -30 1.02145 0.0948
NP_440439.1_1 Forward -145 -132 0.904263 0.168
NP_441138.1_5 Forward -41 -28 9.51548 0.238
NP_441789.1_7 Reverse -205 -224 -2.95123 0.267
NP_440991.1_8 Reverse -168 -187 16.289 0.268
NP_441803.1_2 Forward -147 -128 6.29264 0.155
NP_439977.1_5 Reverse -377 -396 -1.96717 0.266
NP_441572.1_1 Reverse -219 -238 1.0811 0.212
NP_441572.1_7 Forward -174 -155 -5.50708 0.263
NP_441572.1_7 Forward -223 -204 -5.70374 0.269
NP_440948.1_4 Forward -80 -61 8.55425 0.296
NP_441877.1_7 Forward -83 -64 2.9486 0.218
NP_441018.1_7 Forward -344 -325 12.1925 0.167
NP_442529.1_4 Reverse -182 -201 9.3409 0.235
NP_441592.1_4 Reverse -325 -344 -2.85214 0.272
NP_440990.1_10 Reverse -346 -365 15.2408 0.261
NP_441894.1_1 Forward -247 -228 -3.04881 0.155
NP_440888.1_2 Reverse -63 -77 11.307 0.0705
NP_441771.1_4 Reverse -359 -378 -3.63879 0.292
NP_439969.1_3 Forward -28 -9 0.687771 0.265
NP_442033.1_10 Reverse -381 -400 -0.0988766 0.115
NP_441469.1_8 Forward -79 -70 5.11294 0.289
NP_442646.1_7 Reverse -341 -360 2.26107 0.299
NP_443062.1_6 Forward -102 -83 10.6192 0.112
NP_443062.1_6 Reverse -366 -385 6.09597 0.19
NP_441601.1_4 Reverse -203 -222 -2.75381 0.293
NP_441601.1_4 Forward -224 -205 -3.54046 0.293
NP_442204.1_1 Reverse -252 -263 7.53183 0.127
NP_442204.1_6 Reverse -205 -224 8.16093 0.228
NP_442428.1_5 Forward -77 -70 4.759 0.223
NP_440783.1_5 Forward -222 -203 0.0977854 0.209
NP_441867.1_2 Forward -232 -213 -13.1769 0.277
NP_440718.1_2 Forward -83 -64 13.4708 0.216
NP_441052.1_2 Reverse -325 -335 2.14332 0.216
NP_440436.1_4 Reverse -70 -79 4.42421 0.265
NP_441884.1_9 Forward -364 -345 -23.6983 0.284
NP_441733.1_10 Forward -145 -132 4.73917 0.244
NP_441004.1_1 Reverse -64 -83 -13.4719 0.257
NP_441004.1_1 Forward -340 -321 -14.9469 0.271
NP_441004.1_1 Forward -228 -209 -15.9302 0.279
NP_441004.1_1 Forward -339 -320 -16.2252 0.283
NP_441004.1_1 Reverse -287 -306 -16.2252 0.283
NP_441004.1_5 Reverse -289 -303 9.93102 0.248
NP_441004.1_5 Forward -338 -324 6.98109 0.295
NP_442366.1_10 Reverse -379 -391 20.4918 0.0795
NP_442139.1_7 Forward -89 -70 12.2908 0.174
NP_440328.1_8 Reverse -66 -85 14.9579 0.294
NP_443054.1_2 Reverse -240 -254 1.17956 0.251
NP_442586.1_5 Forward -87 -68 14.5524 0.292
NP_441851.1_10 Reverse -241 -251 4.99491 0.233
NP_441851.1_10 Forward -335 -325 4.89658 0.24
NP_441851.1_10 Forward -252 -242 4.69992 0.254
NP_442515.1_1 Reverse -241 -255 2.94952 0.128
NP_442515.1_1 Forward -252 -238 -3.04867 0.285
NP_441396.1_5 Reverse -294 -303 8.75118 0.21
NP_441396.1_5 Reverse -234 -243 8.35786 0.224
NP_440593.1_3 Reverse -320 -339 -6.39206 0.273
NP_440593.1_3 Reverse -58 -77 -7.08038 0.285
NP_441046.1_2 Reverse -363 -382 -0.590531 0.282
NP_441349.1_10 Forward -94 -75 -8.94866 0.28
NP_442006.1_2 Forward -224 -207 -16.3824 0.25
NP_442243.1_1 Reverse -208 -226 9.45814 0.149
NP_440078.1_4 Forward -234 -215 9.63589 0.285
NP_441078.1_4 Reverse -325 -334 -1.96689 0.282
NP_440526.1_3 Reverse -243 -254 7.82632 0.131
NP_440526.1_3 Forward -365 -354 0.943182 0.267
NP_441432.1_8 Forward -169 -160 2.94966 0.28
NP_441432.1_8 Reverse -373 -382 2.55633 0.298
NP_441732.1_5 Reverse -216 -230 13.4709 0.192
NP_440199.1_10 Reverse -322 -332 6.66654 0.287
NP_441057.1_4 Forward -88 -70 -1.84914 0.272
NP_442353.1_4 Forward -84 -65 4.52188 0.205
NP_442353.1_4 Reverse -313 -332 1.6703 0.242
NP_442489.1_7 Forward -334 -325 5.3096 0.0708
NP_442489.1_7 Forward -251 -242 -1.77023 0.247
NP_441040.1_2 Reverse -206 -225 -14.3569 0.285
NP_439956.1_7 Forward -147 -128 8.35759 0.257
NP_442346.1_5 Reverse -241 -251 4.60159 0.281
NP_440352.1_5 Reverse -291 -310 11.9744 0.249
NP_440545.1_3 Reverse -10 -27 1.71047 0.114
NP_440545.1_3 Reverse -65 -82 -4.68105 0.23
NP_440831.1_3 Reverse -380 -399 5.41637 0.28
NP_441923.1_8 Reverse -101 -115 11.8976 0.286
NP_440847.1_3 Forward -182 -168 11.4053 0.263
NP_440847.1_3 Reverse -148 -162 11.012 0.275
NP_442603.1_7 Forward -223 -209 9.83206 0.139
NP_443022.1_6 Reverse -193 -212 18.3873 0.0792
NP_441948.1_4 Reverse -126 -144 -4.01242 0.214
NP_441047.1_2 Reverse -70 -89 3.24438 0.231
NP_440170.1_5 Forward -88 -69 11.9958 0.13
NP_441358.1_2 Forward -223 -204 9.83255 0.244
NP_441895.1_2 Forward -243 -224 -8.26035 0.166
NP_442045.1_5 Reverse -199 -218 5.01433 0.223
NP_440204.1_1 Forward -339 -320 5.11266 0.278
NP_442723.1_1 Reverse -197 -216 7.27514 0.276
NP_441813.1_5 Forward -80 -70 -0.511621 0.247
NP_440594.1_3 Forward -142 -124 18.6037 0.164
NP_440594.1_4 Forward -217 -198 19.0757 0.149
NP_441227.1_10 Reverse -173 -192 9.83255 0.242
NP_440567.1_1 Forward -250 -236 -0.688726 0.298
NP_442497.1_10 Forward -250 -241 0.491382 0.162
NP_442497.1_10 Reverse -243 -252 -1.18024 0.256
NP_440821.1_4 Forward -144 -134 3.51995 0.131
NP_440821.1_4 Reverse -240 -250 0.373358 0.18
NP_440821.1_4 Forward -253 -243 -0.41329 0.257
NP_441239.1_9 Forward -394 -382 9.87208 0.0941
NP_440400.1_1 Forward -302 -283 -2.8529 0.288
NP_442193.1_3 Reverse -64 -83 14.3434 0.299
NP_440876.1_5 Forward -249 -230 7.17762 0.283
NP_442138.1_3 Reverse -324 -343 25.4672 0.00791
NP_440462.1_4 Reverse -249 -263 5.40779 0.29
NP_440462.1_6 Forward -144 -134 5.48657 0.15
NP_442340.1_3 Reverse -65 -84 4.22769 0.113
NP_440868.1_2 Reverse -279 -293 17.5862 0.253
NP_440401.1_5 Forward -29 -15 17.8958 0.16
NP_441249.1_8 Forward -168 -149 4.916 0.253
NP_442479.1_8 Reverse -343 -362 3.04771 0.259
NP_442402.1_4 Reverse -189 -208 -5.90115 0.249
NP_442402.1_4 Forward -31 -12 -8.06442 0.278
NP_440696.1_3 Forward -94 -76 -0.964162 0.249
NP_442923.1_3 Reverse -181 -200 18.3812 0.114
NP_442039.1_7 Reverse -376 -386 15.5163 0.211
NP_442696.1_6 Reverse -81 -100 -12.9802 0.256
NP_442837.1_3 Forward -365 -358 7.11894 0.173
NP_441959.1_5 Forward -255 -236 5.99764 0.271
NP_441959.1_8 Forward -278 -265 8.70929 0.286
NP_440207.2_8 Reverse -64 -83 17.0107 0.258
NP_441252.1_6 Reverse -239 -246 11.9372 0.25
NP_440308.1_6 Forward -225 -206 2.45773 0.296
NP_440914.1_1 Forward -382 -372 7.83437 0.219
NP_442470.1_5 Forward -40 -26 20.7474 0.125
NP_441011.1_8 Reverse -134 -143 9.04618 0.141
NP_441011.1_8 Reverse -294 -303 5.50626 0.256
NP_440724.1_6 Forward -350 -331 7.27595 0.285
NP_442533.1_6 Reverse -325 -334 7.07956 0.0964
NP_442541.1_10 Reverse -382 -396 0.785655 0.298
NP_442232.1_3 Reverse -61 -80 -5.50708 0.165
NP_441482.1_7 Forward -340 -326 -9.04686 0.193
NP_439944.1_9 Forward -250 -240 5.38824 0.254
NP_441028.1_6 Forward -21 -11 6.0761 0.232
NP_442202.1_10 Forward -393 -379 3.24451 0.278
NP_441961.1_1 Forward -101 -82 12.9791 0.226
NP_441602.1_3 Reverse -378 -397 -5.50708 0.288
NP_441972.1_5 Forward -89 -70 2.85105 0.121
NP_441106.1_1 Forward -79 -70 4.71961 0.21
NP_441286.1_1 Forward -252 -240 -5.86088 0.229
NP_442674.1_3 Reverse -125 -144 5.30853 0.269
NP_440886.1_7 Forward -303 -293 6.27276 0.134
NP_440886.1_7 Reverse -324 -334 5.19112 0.194
NP_440828.1_1 Reverse -205 -224 6.68515 0.197
NP_442614.1_2 Forward -206 -192 7.07942 0.275
NP_442382.1_9 Reverse -59 -78 7.76679 0.29
NP_442401.1_4 Forward -346 -336 16.972 0.213
NP_441753.1_10 Forward -221 -202 4.03102 0.203
NP_440907.2_8 Reverse -134 -144 4.10949 0.278
NP_441589.1_5 Forward -79 -60 15.3999 0.267
NP_441460.1_5 Reverse -192 -206 16.9119 0.194
NP_442209.1_6 Reverse -320 -339 12.4875 0.279
NP_441962.1_4 Reverse -237 -256 -11.4069 0.241
NP_440855.1_5 Forward -86 -67 7.07848 0.285
NP_440855.1_5 Reverse -207 -226 3.24359 0.287
NP_440855.1_5 Reverse -71 -90 1.96529 0.295
NP_441431.1_2 Forward -305 -291 5.80051 0.288
NP_441836.1_1 Reverse -231 -250 15.7849 0.142
NP_441836.1_2 Forward -334 -315 -0.197208 0.212
NP_440358.1_8 Reverse -257 -276 2.26107 0.241
NP_442323.1_7 Reverse -97 -116 1.17865 0.289
NP_440293.1_3 Forward -342 -323 -5.40875 0.276
NP_442930.1_1 Forward -272 -262 12.2709 0.239
NP_440213.1_5 Reverse -222 -241 7.27595 0.294
NP_442940.1_2 Reverse -79 -98 -0.688862 0.296
NP_442680.1_5 Reverse -12 -31 3.68677 0.227
NP_441332.1_8 Forward -231 -217 17.6992 0.142
NP_442509.1_9 Reverse -242 -252 10.206 0.191
NP_442784.1_3 Reverse -64 -83 16.9124 0.264
NP_442514.1_10 Forward -124 -105 10.0292 0.253
NP_440554.1_4 Reverse -70 -80 6.07655 0.128
NP_442341.1_7 Forward -335 -321 7.9644 0.0956
NP_441173.1_9 Reverse -123 -131 12.9004 0.206
NP_440507.2_3 Forward -151 -132 7.66846 0.273
NP_440560.1_1 Reverse -28 -47 22.4416 0.0126
NP_440679.1_10 Reverse -286 -305 -20.1584 0.283
NP_441207.1_7 Reverse -262 -276 8.28727 0.29
NP_439962.1_4 Reverse -202 -221 -6.78538 0.285
NP_439962.1_4 Forward -225 -206 -8.16202 0.292
NP_439962.1_4 Reverse -64 -83 -8.35868 0.293
NP_441105.1_3 Forward -89 -70 1.27776 0.115
NP_441105.1_3 Reverse -332 -351 -8.55534 0.274
NP_442373.1_1 Reverse -212 -231 -11.1119 0.29
NP_442373.1_2 Forward -90 -71 -11.9969 0.298
NP_440216.1_6 Reverse -318 -334 17.7581 0.0619
NP_440167.1_3 Reverse -69 -88 7.66927 0.296
NP_442015.1_10 Forward -338 -325 6.31247 0.119
NP_442015.1_10 Reverse -155 -168 -1.06236 0.293
NP_441111.1_7 Forward -250 -242 -0.668896 0.274
NP_440416.1_9 Reverse -62 -81 -1.57384 0.0652
NP_440416.1_9 Reverse -318 -337 -9.63698 0.133
NP_440416.1_9 Reverse -201 -220 -20.4534 0.285
NP_443052.1_9 Reverse -203 -222 10.3242 0.106
NP_443052.1_9 Reverse -71 -90 4.12936 0.156
NP_440072.1_5 Forward -221 -203 -1.35749 0.258
NP_440591.1_9 Forward -158 -140 11.6222 0.0943
NP_442564.1_10 Reverse -330 -344 9.73436 0.296
NP_440261.1_5 Forward -250 -237 -10.2071 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGTCGGGTGGACTGGCCGCCAATGTCAATAATGTGTGCTCCCCCCTGCACCATGGTTTTAGCCTGGTGGATGGCCGTTGGTAGAGAGTTAAATTCGCCCCCATCACTAAAACTGTCCGGCGTAGTATTCAAAATTCCCATCACATAGGTGCGTTTGCCCCAATCAAAAAGGGTTTGGCCCACCGGGAGGGGAGGGGGAAAATAATCACTCAATTGATCCAACTGGTCCATAGGTTATCGGAGGGAAGTTTGGAACGCCGGGATAGCTCTTGGTAGAATGTATCCCAAGGGCAATGCTAGTTGGACGGTGTTTGCTGGCTCCAGCGGTGGCAAAGCCTAATGATCCTAACAATACAATTTTCGCTGATTATTTCGGGTTCTATCCCCCAGTTTCCTAACC

CDS

ATGCCCCTGCATTTCGCCGCCTTGATTCCCATTGACAGCTTGTTTTCCACCCAAGGCATTATGGTGATGCTGTTGGGGGCCTATGCCTTGGCTATGTGGTTATTTCTCACCAGTGCCCCCAAGGTGTACACAGTGATGGTGTCGGACCTGGCGATCGCCAAAGCATTTTATGAAGGTTTGCTGGAGCTAGCCGTGGCGGACGTGCCTCTGCATTATTACTACAACTATGAACAAACCCTAGGTACTGCGGGTTGGGACTCATTTTCCATGGCGGCTAACCCCCAAATTCCCCCCGAGAATCGCTACAGTGCCCAGGACGGGCTTTGGTATCAGTTGAAAAAAAATACCCAACTGCACATCATTGGTGGGGCTAGCTTTGGCAGTAACAATCGCCAACGCCATGTCTGTTTTGACCACGATTGTTTGGAGCAAATTTTTCTGCGGGTGCAATCTCGCCGTCTCCGCTATAAAGTACGCAGTCGCAAGCCGTTGAATTTTTTGGTCAAGGATTACGATGAGCGGGTAATTGAGCTAACGGAAGTGAAAAATTAA

Protein

MPLHFAALIPIDSLFSTQGIMVMLLGAYALAMWLFLTSAPKVYTVMVSDLAIAKAFYEGLLELAVADVPLHYYYNYEQTLGTAGWDSFSMAANPQIPPENRYSAQDGLWYQLKKNTQLHIIGGASFGSNNRQRHVCFDHDCLEQIFLRVQSRRLRYKVRSRKPLNFLVKDYDERVIELTEVKN