Your browser is old and dusty. Try Google Chrome!

Details for sll1911

ORF sll1911
Accession NP_440600.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -324 -338 -0.0987402 0.221
NP_440557.1_1 Reverse -73 -92 -2.36049 0.286
NP_441960.1_3 Forward -81 -62 15.9926 0.181
NP_442151.1_6 Forward -392 -378 5.89945 0.256
NP_441818.1_9 Forward -164 -145 0.0977854 0.191
NP_440150.1_6 Forward -324 -305 0.687771 0.296
NP_442975.1_10 Forward -82 -68 12.9786 0.0459
NP_441250.1_3 Forward -260 -241 5.80098 0.24
NP_442062.1_3 Forward -67 -48 2.75272 0.212
NP_442062.1_3 Reverse -33 -52 -3.63879 0.294
NP_442062.1_8 Forward -81 -71 4.89658 0.193
NP_442974.1_3 Forward -182 -163 22.7139 0.0188
NP_441859.1_5 Forward -230 -211 1.67108 0.296
NP_442602.1_3 Forward -96 -77 -0.885524 0.226
NP_441352.1_4 Forward -233 -214 13.1758 0.238
NP_441161.1_8 Forward -171 -152 18.4857 0.23
NP_441200.1_4 Forward -343 -324 5.40766 0.294
NP_441594.1_6 Reverse -374 -393 8.16093 0.163
NP_441594.1_6 Forward -167 -148 4.12936 0.222
NP_442196.1_10 Forward -179 -160 11.0125 0.235
NP_442475.1_5 Forward -108 -89 16.6174 0.287
NP_441083.1_5 Forward -399 -389 1.84832 0.198
NP_441083.1_5 Forward -392 -382 -0.118297 0.256
NP_439957.1_9 Forward -64 -45 3.29405 0.3
NP_441434.1_1 Forward -62 -48 7.07802 0.288
NP_442675.1_4 Forward -223 -205 -4.01242 0.257
NP_442570.1_3 Forward -190 -171 -8.26035 0.283
NP_442570.1_3 Forward -346 -327 -9.63698 0.3
NP_441025.1_2 Reverse -175 -194 11.7992 0.242
NP_441025.1_6 Reverse -34 -53 2.30291 0.28
NP_441792.1_2 Reverse -79 -92 16.2439 0.288
NP_441716.1_1 Reverse -197 -211 6.6861 0.191
NP_441163.1_1 Forward -393 -376 10.5595 0.209
NP_441533.1_4 Forward -42 -25 15.7128 0.28
NP_440438.2_8 Forward -40 -21 23.5006 0.00683
NP_440438.2_8 Reverse -13 -32 5.211 0.206
NP_440747.1_10 Reverse -200 -212 -12.4491 0.282
NP_441130.1_10 Reverse -201 -215 9.34103 0.126
NP_441486.1_1 Reverse -380 -394 -4.7203 0.205
NP_442330.1_1 Forward -185 -166 19.8623 0.0398
NP_442330.1_9 Forward -265 -246 9.0459 0.237
NP_440403.1_10 Reverse -374 -393 0.58944 0.3
NP_440842.1_4 Forward -50 -31 0.55632 0.265
NP_440842.1_10 Reverse -113 -127 4.62115 0.254
NP_442848.1_4 Reverse -7 -21 9.93102 0.282
NP_443018.1_3 Forward -176 -169 10.2655 0.107
NP_440376.1_1 Reverse -383 -392 4.0313 0.182
NP_441002.1_3 Reverse -193 -212 14.2566 0.228
NP_442687.1_7 Reverse -295 -305 10.3048 0.0994
NP_442687.1_7 Forward -393 -383 3.71661 0.292
NP_441077.1_6 Forward -63 -47 3.38031 0.271
NP_440066.1_5 Forward -393 -374 9.24175 0.256
NP_442485.1_3 Reverse -67 -86 -4.52377 0.282
NP_441846.1_10 Forward -222 -203 -20.3551 0.256
NP_441846.1_10 Forward -159 -140 -22.6167 0.264
NP_441846.1_10 Forward -216 -197 -23.4033 0.285
NP_440571.1_6 Reverse -42 -61 9.02356 0.296
NP_442483.1_6 Forward -274 -255 15.9282 0.173
NP_442658.1_1 Reverse -70 -80 12.9592 0.0423
NP_440141.1_8 Forward -230 -211 10.5209 0.208
NP_442544.1_2 Forward -346 -332 0.294584 0.217
NP_441414.1_9 Forward -212 -193 -9.44032 0.259
NP_440184.1_1 Forward -39 -20 1.0578 0.287
NP_441487.1_9 Forward -393 -374 9.73422 0.0945
NP_442486.1_6 Reverse -149 -168 -5.70374 0.279
NP_442486.1_6 Reverse -215 -234 -6.88371 0.296
NP_442025.1_9 Forward -159 -140 14.5524 0.255
NP_439905.1_1 Forward -80 -67 8.57408 0.232
NP_440984.1_7 Reverse -67 -81 6.29277 0.219
NP_442690.1_1 Forward -66 -47 -5.80207 0.163
NP_442690.1_1 Reverse -34 -53 -17.1101 0.297
NP_443055.1_6 Forward -385 -367 -0.178247 0.254
NP_441348.1_3 Forward -182 -163 6.88262 0.272
NP_442013.1_10 Forward -168 -149 17.6007 0.0968
NP_442013.1_10 Forward -171 -152 13.8641 0.109
NP_442013.1_10 Forward -228 -209 12.8808 0.109
NP_442013.1_10 Forward -240 -221 7.37428 0.204
NP_442013.1_10 Forward -231 -212 5.89931 0.241
NP_442438.1_10 Forward -338 -324 -0.983719 0.287
NP_441110.1_1 Forward -230 -211 10.1275 0.176
NP_440206.1_10 Reverse -68 -87 13.3725 0.293
NP_441041.1_4 Forward -188 -169 -13.8652 0.297
NP_440569.1_6 Reverse -243 -262 18.3873 0.0257
NP_440703.1_9 Forward -123 -110 11.0318 0.192
NP_441725.1_5 Forward -385 -375 3.22496 0.115
NP_439966.1_7 Reverse -140 -150 7.35439 0.15
NP_440260.1_8 Reverse -105 -123 -5.68405 0.276
NP_440260.1_8 Reverse -374 -392 -6.27403 0.289
NP_440177.1_9 Forward -158 -139 10.8159 0.299
NP_440437.1_1 Reverse -312 -331 -3.44213 0.236
NP_441644.1_6 Forward -164 -154 4.40448 0.239
NP_442501.1_1 Reverse -252 -271 7.57094 0.296
NP_442029.1_6 Forward -344 -325 2.55606 0.294
NP_440780.1_1 Forward -37 -18 12.7478 0.234
NP_440430.1_4 Forward -192 -173 16.5182 0.214
NP_442554.1_8 Reverse -169 -179 3.81494 0.209
NP_442970.1_3 Reverse -46 -64 12.678 0.225
NP_441762.1_7 Reverse -382 -394 -7.13918 0.285
NP_442142.1_4 Reverse -152 -165 8.37683 0.116
NP_442142.1_4 Forward -195 -182 8.08184 0.124
NP_442142.1_4 Forward -84 -71 2.67367 0.281
NP_442292.1_1 Forward -391 -382 -0.491928 0.252
NP_440919.1_1 Reverse -12 -31 -6.98204 0.273
NP_442143.1_8 Reverse -160 -179 13.2733 0.223
NP_443009.1_5 Forward -82 -71 3.79477 0.278
NP_441015.1_10 Forward -163 -144 0.392778 0.165
NP_441015.1_10 Forward -332 -313 -1.47551 0.173
NP_441015.1_10 Forward -224 -205 -6.98204 0.26
NP_441015.1_10 Forward -160 -141 -9.83364 0.282
NP_442757.1_7 Forward -237 -218 16.9124 0.154
NP_441826.1_2 Reverse -72 -86 -0.295402 0.208
NP_441764.1_1 Reverse -23 -42 9.0459 0.241
NP_441764.1_4 Reverse -31 -48 17.048 0.0671
NP_442868.1_6 Reverse -381 -391 0.57002 0.217
NP_442719.1_2 Forward -33 -15 -5.97975 0.224
NP_442719.1_2 Reverse -48 -66 -11.8796 0.297
NP_442808.1_1 Forward -262 -252 4.30615 0.2
NP_441101.1_10 Reverse -199 -218 0.491109 0.175
NP_441101.1_10 Reverse -148 -167 -3.63879 0.262
NP_441882.1_6 Reverse -82 -101 -0.197208 0.232
NP_442542.1_2 Forward -214 -201 5.52582 0.262
NP_442542.1_2 Reverse -70 -83 5.23083 0.276
NP_442542.1_9 Reverse -65 -79 9.43874 0.135
NP_440038.1_4 Forward -125 -106 2.16274 0.275
NP_440558.1_2 Forward -264 -245 -6.98204 0.284
NP_441878.1_6 Reverse -71 -81 -7.49312 0.231
NP_441878.1_6 Forward -171 -161 -7.98478 0.285
NP_441445.1_1 Forward -239 -220 1.76941 0.247
NP_440084.1_6 Forward -235 -221 18.2968 0.233
NP_441458.1_8 Forward -48 -29 2.0038 0.295
NP_442444.1_6 Forward -89 -71 12.8239 0.267
NP_442645.1_2 Reverse -375 -394 -14.5535 0.175
NP_442645.1_2 Forward -89 -70 -20.65 0.288
NP_442594.1_8 Forward -224 -205 8.94757 0.201
NP_442590.1_9 Forward -393 -374 5.30933 0.273
NP_441728.2_4 Reverse -47 -66 14.9441 0.228
NP_442998.1_5 Forward -118 -108 12.2714 0.175
NP_442802.1_2 Reverse -373 -392 18.9765 0.203
NP_442201.1_10 Forward -181 -162 -14.4552 0.282
NP_440256.1_1 Forward -84 -65 -7.27704 0.232
NP_441559.1_8 Reverse -103 -117 0.196253 0.169
NP_440915.1_7 Forward -117 -98 11.9958 0.175
NP_441296.1_7 Reverse -60 -79 16.1257 0.267
NP_442866.1_6 Reverse -98 -117 11.7992 0.182
NP_442866.1_9 Reverse -168 -187 19.9606 0.0227
NP_440748.1_5 Forward -383 -364 -0.688862 0.26
NP_442993.1_1 Reverse -72 -88 -5.25134 0.145
NP_442386.1_9 Forward -183 -174 6.19416 0.23
NP_442386.1_9 Forward -393 -384 4.52254 0.297
NP_440168.1_9 Forward -386 -367 0.884433 0.255
NP_440586.1_1 Reverse -242 -261 -3.3438 0.265
NP_440586.1_8 Forward -176 -169 9.08521 0.178
NP_440586.1_8 Forward -163 -156 5.64364 0.297
NP_440684.1_3 Forward -170 -151 22.6156 0.0326
NP_440684.1_3 Forward -230 -211 18.4857 0.173
NP_440684.1_3 Forward -227 -208 17.7974 0.178
NP_440027.1_4 Forward -39 -20 4.31709 0.208
NP_440408.1_7 Forward -221 -202 8.84924 0.267
NP_441789.1_7 Forward -394 -375 -1.8696 0.257
NP_441789.1_7 Forward -265 -246 -4.32786 0.28
NP_441933.1_1 Forward -193 -174 16.2241 0.238
NP_440316.1_10 Forward -339 -329 5.78156 0.281
NP_441803.1_2 Reverse -156 -175 8.65258 0.112
NP_440210.1_9 Forward -39 -20 15.1698 0.127
NP_442035.1_8 Reverse -221 -235 14.8476 0.237
NP_441877.1_7 Forward -397 -378 1.17865 0.242
NP_441877.1_9 Reverse -41 -58 9.28195 0.215
NP_442262.1_10 Forward -176 -169 9.18389 0.211
NP_440531.1_6 Reverse -368 -387 -2.95047 0.26
NP_441060.1_1 Reverse -69 -88 12.2785 0.294
NP_440894.1_10 Reverse -82 -101 5.99764 0.227
NP_442078.1_9 Forward -117 -100 17.1484 0.177
NP_440888.1_2 Forward -81 -67 5.40719 0.28
NP_440600.1_1 Forward -49 -30 23.6338 0.00597
NP_440600.1_2 Forward -127 -109 22.3403 0.0264
NP_440600.1_8 Forward -321 -302 20.649 0.113
NP_440663.1_3 Forward -397 -378 18.0924 0.0351
NP_442845.1_2 Reverse -108 -122 5.70279 0.225
NP_441469.1_8 Forward -393 -384 11.1111 0.181
NP_442315.1_1 Forward -232 -214 6.31233 0.256
NP_442337.1_8 Reverse -83 -102 2.75272 0.217
NP_442337.1_8 Forward -193 -174 -0.39387 0.273
NP_440519.1_8 Reverse -246 -262 3.79511 0.244
NP_442204.1_1 Reverse -179 -190 0.451995 0.281
NP_441560.1_10 Reverse -313 -332 9.53756 0.227
NP_441351.1_8 Forward -394 -375 -0.000545616 0.292
NP_442697.1_2 Forward -170 -151 16.8141 0.118
NP_440255.1_3 Reverse -27 -37 13.9631 0.298
NP_442872.1_1 Reverse -144 -163 -12.7836 0.26
NP_442872.1_1 Reverse -147 -166 -12.8819 0.26
NP_440516.1_8 Forward -212 -203 0.0980582 0.143
NP_440516.1_8 Reverse -383 -392 -0.393597 0.255
NP_441443.1_7 Forward -389 -370 -2.85214 0.28
NP_442120.1_10 Reverse -156 -175 -5.99873 0.203
NP_442120.1_10 Reverse -72 -91 -7.17871 0.217
NP_440673.1_3 Reverse -157 -164 9.38056 0.192
NP_440673.1_3 Reverse -331 -338 6.72562 0.277
NP_440673.1_3 Reverse -4 -11 5.54565 0.288
NP_440865.1_9 Forward -222 -203 -4.91709 0.208
NP_441052.1_2 Reverse -155 -165 5.48657 0.116
NP_441052.1_2 Reverse -221 -231 2.53664 0.201
NP_441052.1_2 Forward -392 -382 1.65166 0.233
NP_440992.1_5 Forward -263 -244 12.7646 0.297
NP_442219.1_8 Reverse -373 -392 12.7089 0.153
NP_440436.1_4 Forward -80 -71 8.75075 0.0995
NP_441719.1_6 Forward -388 -369 5.11187 0.293
NP_441004.1_1 Forward -176 -157 -13.9635 0.263
NP_442813.1_4 Reverse -82 -101 -5.40875 0.299
NP_442366.1_1 Forward -62 -49 14.9656 0.282
NP_439949.1_7 Reverse -257 -271 11.6026 0.284
NP_442206.1_1 Forward -81 -62 -10.9153 0.219
NP_441851.1_10 Forward -183 -173 9.41981 0.114
NP_441195.1_8 Forward -233 -214 9.24257 0.29
NP_441668.1_4 Forward -180 -161 0.0977854 0.247
NP_442515.1_1 Reverse -120 -134 -1.96703 0.268
NP_442689.1_8 Reverse -18 -35 -2.41943 0.235
NP_442689.1_8 Forward -62 -45 -7.33598 0.292
NP_441349.1_10 Forward -343 -324 -9.83364 0.297
NP_442843.1_4 Reverse -373 -391 13.1955 0.278
NP_441124.1_5 Reverse -23 -33 14.6315 0.215
NP_441124.1_5 Forward -57 -47 14.6315 0.215
NP_441124.1_5 Reverse -42 -52 10.0479 0.298
NP_440588.1_2 Reverse -194 -213 1.96607 0.126
NP_440588.1_2 Reverse -287 -306 -6.58872 0.285
NP_440954.1_1 Reverse -246 -265 -4.32711 0.289
NP_442006.1_2 Reverse -63 -80 -6.64766 0.167
NP_442006.1_3 Forward -218 -200 5.42735 0.146
NP_441570.1_1 Forward -164 -146 -17.8771 0.295
NP_440078.1_5 Forward -297 -278 13.4708 0.076
NP_441078.1_4 Reverse -72 -81 -1.57357 0.266
NP_442729.1_5 Forward -165 -155 8.23984 0.248
NP_442348.1_2 Reverse -260 -269 6.98123 0.293
NP_440526.1_3 Reverse -162 -173 0.353199 0.287
NP_441432.1_8 Forward -339 -330 9.24284 0.0755
NP_441432.1_9 Reverse -50 -63 13.3493 0.179
NP_441732.1_5 Forward -122 -108 19.8624 0.0814
NP_440714.1_2 Reverse -270 -288 16.9321 0.167
NP_440760.1_1 Reverse -296 -315 -23.305 0.293
NP_442274.1_6 Forward -292 -273 15.5357 0.167
NP_440199.1_10 Forward -167 -157 10.8948 0.168
NP_439900.1_4 Reverse -157 -171 19.0751 0.136
NP_442510.1_2 Reverse -103 -122 14.2574 0.232
NP_440913.1_1 Reverse -181 -199 6.01734 0.231
NP_440713.1_4 Forward -168 -149 2.65439 0.26
NP_440713.1_4 Forward -192 -173 0.884433 0.3
NP_442489.1_7 Reverse -72 -81 -1.37691 0.195
NP_442489.1_7 Reverse -383 -392 -1.6719 0.235
NP_442489.1_7 Forward -81 -72 -2.06522 0.288
NP_440565.1_3 Forward -395 -376 17.6113 0.192
NP_440386.1_1 Forward -336 -317 -9.24366 0.28
NP_442079.1_6 Forward -125 -106 12.7825 0.283
NP_440559.1_1 Forward -391 -382 4.71961 0.217
NP_441022.1_1 Forward -64 -55 11.834 0.273
NP_441022.1_1 Forward -36 -27 10.8747 0.284
NP_442913.1_10 Reverse -63 -82 -3.3438 0.207
NP_442913.1_10 Reverse -374 -393 -5.31042 0.262
NP_440442.1_1 Forward -173 -154 11.5042 0.157
NP_442346.1_5 Forward -82 -72 4.60159 0.281
NP_440352.1_4 Reverse -18 -32 18.2506 0.173
NP_441629.1_3 Forward -262 -243 6.1935 0.198
NP_440250.1_4 Forward -65 -46 4.22689 0.264
NP_441653.1_2 Forward -199 -180 5.46229 0.245
NP_441653.1_5 Forward -164 -147 17.9351 0.23
NP_440010.1_4 Forward -168 -149 0.686995 0.244
NP_440034.1_3 Reverse -69 -88 17.6202 0.206
NP_440449.1_6 Forward -125 -107 5.33794 0.279
NP_441329.1_2 Reverse -29 -47 21.873 0.0447
NP_441609.1_1 Reverse -47 -66 -0.885524 0.251
NP_441609.1_1 Reverse -356 -375 -2.45882 0.29
NP_440875.1_9 Reverse -170 -180 9.05339 0.233
NP_441813.1_7 Forward -117 -103 8.55376 0.281
NP_440590.1_4 Forward -391 -378 0.0192843 0.173
NP_441239.1_9 Reverse -70 -82 4.46387 0.253
NP_441239.1_9 Forward -179 -167 3.67722 0.279
NP_442270.1_6 Reverse -382 -400 17.6204 0.279
NP_441874.1_1 Forward -174 -160 12.586 0.24
NP_441541.1_1 Reverse -32 -50 -3.53122 0.264
NP_440833.1_6 Forward -293 -279 13.8636 0.157
NP_442216.1_4 Forward -267 -259 8.1805 0.255
NP_442138.1_10 Forward -87 -68 -1.18052 0.171
NP_440675.1_1 Forward -133 -114 13.0775 0.177
NP_441474.1_1 Reverse -145 -164 6.78348 0.212
NP_441474.1_1 Reverse -139 -158 -1.47628 0.262
NP_441848.1_4 Forward -33 -17 7.1687 0.295
NP_441084.1_6 Forward -83 -69 9.73195 0.269
NP_440653.1_10 Forward -176 -157 5.80098 0.22
NP_440653.1_10 Reverse -162 -181 3.24438 0.281
NP_441926.1_3 Reverse -72 -88 3.69678 0.213
NP_440825.1_6 Forward -143 -124 10.0292 0.285
NP_442360.1_5 Reverse -115 -125 13.5497 0.278
NP_441777.1_4 Reverse -47 -66 19.5919 0.127
NP_441408.2_7 Forward -179 -160 -1.96717 0.262
NP_440914.1_1 Reverse -72 -82 11.6404 0.0843
NP_442533.1_1 Forward -161 -142 2.55606 0.105
NP_442533.1_1 Forward -158 -139 -3.83545 0.14
NP_442533.1_1 Forward -230 -211 -5.31042 0.155
NP_442533.1_1 Forward -167 -148 -5.40875 0.155
NP_442533.1_1 Forward -218 -199 -9.44032 0.223
NP_442533.1_6 Reverse -142 -151 2.458 0.255
NP_442533.1_6 Forward -123 -114 1.96635 0.28
NP_442533.1_6 Reverse -206 -215 1.37636 0.3
NP_442541.1_10 Forward -81 -67 0.883986 0.295
NP_442232.1_3 Reverse -243 -262 -15.7335 0.296
NP_441235.1_2 Forward -305 -286 23.303 0.0223
NP_441697.1_5 Reverse -18 -37 2.91208 0.178
NP_441697.1_5 Forward -62 -43 -1.38506 0.206
NP_441697.1_5 Forward -35 -16 -6.44613 0.232
NP_442202.1_10 Forward -118 -104 4.12949 0.278
NP_441527.1_5 Reverse -119 -138 16.5802 0.203
NP_441527.1_5 Forward -119 -100 12.6001 0.297
NP_441527.1_7 Forward -135 -116 7.76679 0.289
NP_439965.1_7 Reverse -208 -227 10.417 0.294
NP_441347.1_9 Reverse -23 -36 13.4123 0.17
NP_441106.1_3 Reverse -20 -39 11.7992 0.217
NP_439903.1_6 Reverse -326 -345 15.2399 0.0664
NP_439903.1_6 Reverse -75 -94 0.392004 0.264
NP_001035870.1_10 Forward -212 -193 19.4619 0.0812
NP_442306.1_10 Reverse -103 -122 -21.7317 0.286
NP_441286.1_1 Forward -165 -153 -1.63265 0.145
NP_441286.1_1 Reverse -202 -214 -6.94252 0.288
NP_441930.1_2 Reverse -376 -386 12.3697 0.262
NP_440886.1_7 Forward -393 -383 5.78111 0.163
NP_442614.1_2 Forward -164 -150 10.4227 0.234
NP_441399.1_6 Forward -123 -104 14.1583 0.185
NP_441905.1_9 Forward -210 -191 7.96426 0.288
NP_441463.1_3 Reverse -151 -170 -2.16383 0.151
NP_441463.1_6 Forward -83 -69 14.2433 0.165
NP_442365.1_7 Reverse -151 -170 -5.9004 0.282
NP_441962.1_4 Reverse -378 -397 -6.88371 0.183
NP_441962.1_9 Forward -115 -96 6.39097 0.258
NP_440634.1_10 Reverse -149 -168 12.4867 0.164
NP_440634.1_10 Reverse -212 -231 9.34008 0.221
NP_440634.1_10 Reverse -215 -234 7.86512 0.239
NP_440634.1_10 Reverse -218 -237 6.48849 0.265
NP_440114.1_10 Reverse -72 -86 14.5526 0.0382
NP_441272.1_7 Reverse -252 -262 14.828 0.2
NP_441237.1_9 Forward -385 -375 10.5014 0.228
NP_442930.1_1 Reverse -46 -56 9.22267 0.289
NP_442930.1_1 Forward -34 -24 9.22267 0.289
NP_440142.1_7 Forward -391 -372 8.55425 0.232
NP_441332.1_6 Forward -393 -383 11.4531 0.26
NP_441332.1_8 Reverse -107 -121 18.0925 0.119
NP_441436.1_2 Forward -218 -199 -1.96717 0.28
NP_440473.1_1 Reverse -152 -171 11.0646 0.283
NP_442509.1_6 Forward -227 -208 7.27595 0.294
NP_442582.1_3 Forward -53 -39 12.712 0.284
NP_442862.1_3 Forward -169 -152 4.75873 0.287
NP_440649.2_4 Forward -307 -289 26.1752 0.00154
NP_441466.1_9 Forward -230 -211 19.2401 0.0927
NP_441756.1_5 Reverse -305 -324 -4.13045 0.292
NP_440423.1_6 Forward -220 -201 -12.1936 0.188
NP_441842.1_10 Reverse -376 -390 10.7177 0.155
NP_440275.1_3 Forward -214 -204 5.19158 0.161
NP_440679.1_10 Forward -228 -209 -12.8819 0.213
NP_440679.1_10 Forward -162 -143 -14.8485 0.248
NP_440679.1_10 Forward -168 -149 -21.0434 0.29
NP_439951.1_1 Forward -212 -193 15.0441 0.3
NP_440175.1_4 Reverse -375 -394 -13.4719 0.247
NP_442373.1_2 Reverse -243 -262 -7.37537 0.233
NP_441730.1_2 Reverse -28 -46 9.0656 0.283
NP_440216.1_9 Forward -175 -166 6.48957 0.289
NP_440216.1_9 Forward -176 -167 5.3096 0.298
NP_440172.1_1 Reverse -72 -82 2.04498 0.286
NP_440172.1_7 Reverse -83 -102 27.0405 0.00144
NP_441008.1_4 Forward -114 -95 16.5165 0.295
NP_442015.1_3 Reverse -145 -164 9.53674 0.296
NP_441111.1_7 Forward -391 -383 -0.472234 0.131
NP_440244.1_8 Forward -37 -18 6.39097 0.27
NP_441766.1_2 Forward -392 -383 5.3096 0.131
NP_443052.1_8 Reverse -62 -81 -5.50708 0.13
NP_442116.1_6 Reverse -29 -46 5.59067 0.293
NP_442403.1_8 Reverse -157 -176 -2.65548 0.278
NP_442403.1_8 Forward -168 -149 -3.04881 0.296
NP_442154.1_1 Reverse -375 -393 -16.6971 0.244
NP_442046.1_8 Reverse -174 -193 12.5858 0.293
NP_440261.1_7 Forward -73 -54 -4.22878 0.217
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACGAGTTCCGCAGTCGCCAATGCGCCCTAGTGGGTCGTAAAAGTCGTACTTCTTACCGCTTAGGCAATGAGGTGGACGTACAGGTGCGCAGTGTGGACTATTACCGTCAACAAATTGACCTTGGAGCGGTTAATAATGCCCCCAAAGACTCCGCCAATATGGATTTTGATGATGATGACGAAGATGGGGACGAGCGGGAGGAACAAGACACCATGGATTGGGATGCCATGGAAGATGGCGATGATGATGAGGGAGGGGCGGTAATTTTCTAGTTGTTGCCTAGGGCCAAAACCTGCAAACCAACGCAGACTAAGGTAAAGGCCATTGTCGCCTGGTCAAAAGTTGTTAAAATTTAACAATTCGCAATAAATTTTAACAATTATCCCAGGAGCAACGATCA

CDS

ATGGCCGGATTATTTGGCTTATTTGGTAAAAAGGCACAGTACGTCGAAGATATTGAAGCCAACCCCAGTCCTCAGCCAGAAAAAAAAGAGGCATTTTTTCTTGAAAGCGACGATGCCAAAAGCTTGGGCAATGCCGAATACATGCGGACTCCCATCAAAATTAAACGGAGTTTTCCTAAAACTCTCAACTCCCAGGGAGGGGAAGTGGTCAAGGAGATTTCTGCCATGGAGGTGAAAAAAATCCAGGCTAATGGTCAACCGGCCCCCAGTACCAAAATGGATTCCGCCCCATCCCAGGCCAACTCTACCCCGGCCAACAACGATCGCCGTTCCAACGACAATAGTTTGGACATGTTCCGCCAGATGGCTAAGGATTTGAAAAAGTAA

Protein

MAGLFGLFGKKAQYVEDIEANPSPQPEKKEAFFLESDDAKSLGNAEYMRTPIKIKRSFPKTLNSQGGEVVKEISAMEVKKIQANGQPAPSTKMDSAPSQANSTPANNDRRSNDNSLDMFRQMAKDLKK