Your browser is old and dusty. Try Google Chrome!

Details for sll1906

ORF sll1906
Accession NP_441204.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -164 -150 2.35953 0.177
NP_441061.1_2 Reverse -278 -292 0.786239 0.199
NP_440795.1_7 Forward -285 -278 14.6904 0.0123
NP_440795.1_7 Reverse -278 -285 14.6904 0.0123
NP_441418.1_6 Reverse -277 -296 -19.1751 0.0854
NP_441418.1_6 Reverse -106 -125 -30.4831 0.28
NP_442291.1_5 Reverse -276 -292 15.3982 0.0222
NP_442291.1_5 Forward -287 -271 -1.80975 0.202
NP_442291.1_7 Forward -145 -131 13.3726 0.211
NP_441453.1_4 Reverse -277 -285 16.539 0.00633
NP_441453.1_4 Forward -286 -278 16.539 0.00633
NP_442151.1_6 Forward -286 -272 9.73436 0.141
NP_442151.1_6 Forward -75 -61 5.40779 0.278
NP_441818.1_1 Reverse -278 -289 18.446 0.0046
NP_441818.1_1 Forward -285 -274 10.1862 0.232
NP_440226.1_1 Forward -286 -267 16.4207 0.0217
NP_440226.1_1 Reverse -277 -296 7.17762 0.111
NP_442173.1_1 Forward -285 -277 15.4574 0.00633
NP_442173.1_1 Reverse -278 -286 15.4574 0.00633
NP_442752.1_4 Forward -286 -279 13.8055 0.0199
NP_442752.1_4 Reverse -277 -284 13.8055 0.0199
NP_442752.1_4 Reverse -66 -73 4.26735 0.293
NP_443027.1_4 Forward -288 -278 11.0914 0.107
NP_443027.1_4 Reverse -64 -74 10.5014 0.128
NP_442975.1_10 Forward -290 -276 4.32555 0.245
NP_442975.1_10 Reverse -273 -287 2.45727 0.274
NP_440784.1_7 Forward -285 -278 15.9687 0.0123
NP_440784.1_7 Reverse -278 -285 15.9687 0.0123
NP_440061.1_9 Reverse -275 -289 12.487 0.0964
NP_442062.1_8 Forward -286 -276 17.3846 0.00193
NP_442062.1_8 Reverse -277 -287 17.3846 0.00193
NP_441859.1_3 Reverse -276 -295 8.06178 0.146
NP_440304.1_4 Forward -288 -278 1.84832 0.299
NP_440304.1_4 Reverse -275 -285 1.84832 0.299
NP_442242.1_4 Forward -285 -278 14.3954 0.0124
NP_442242.1_4 Reverse -278 -285 14.3954 0.0124
NP_440044.1_8 Reverse -278 -297 18.584 0.0159
NP_440044.1_8 Forward -285 -266 -3.73712 0.29
NP_441200.1_6 Forward -127 -110 12.7235 0.273
NP_441619.1_8 Forward -342 -328 6.39049 0.299
NP_441208.1_9 Forward -213 -199 6.29277 0.252
NP_441208.1_9 Reverse -274 -288 4.52282 0.299
NP_441083.1_5 Forward -286 -276 20.3345 0.00053
NP_441083.1_5 Reverse -277 -287 20.3345 0.00053
NP_441738.1_2 Forward -284 -277 15.28 0.0102
NP_441738.1_2 Reverse -279 -286 15.28 0.0102
NP_441558.1_5 Forward -288 -269 7.37428 0.182
NP_440209.1_1 Reverse -277 -285 18.1123 0.00295
NP_440209.1_1 Forward -286 -278 18.1123 0.00295
NP_440209.1_1 Forward -75 -67 2.08437 0.286
NP_442889.1_8 Forward -289 -275 14.4536 0.0523
NP_442889.1_8 Forward -71 -57 10.2254 0.0882
NP_442889.1_8 Reverse -274 -288 3.53891 0.275
NP_442570.1_3 Reverse -148 -167 0.58944 0.206
NP_442570.1_3 Reverse -147 -166 -2.65548 0.212
NP_441716.1_1 Reverse -139 -153 10.7177 0.0936
NP_441716.1_1 Reverse -277 -291 8.45605 0.141
NP_441716.1_1 Forward -286 -272 6.6861 0.191
NP_441163.1_4 Forward -145 -126 12.0492 0.295
NP_440906.1_5 Forward -285 -278 15.8704 0.0124
NP_440906.1_5 Reverse -278 -285 15.8704 0.0124
NP_440747.1_10 Forward -289 -277 16.8536 0.00143
NP_440747.1_10 Reverse -274 -286 14.9853 0.00221
NP_440747.1_10 Forward -151 -139 -12.1541 0.227
NP_441130.1_10 Reverse -275 -289 7.9644 0.144
NP_441130.1_10 Forward -288 -274 5.80112 0.214
NP_441486.1_1 Forward -289 -275 15.1426 0.0061
NP_441486.1_1 Reverse -274 -288 14.6509 0.00628
NP_441486.1_1 Reverse -324 -338 -5.90027 0.266
NP_441014.1_10 Reverse -276 -295 0.0970122 0.246
NP_442848.1_1 Forward -292 -278 -2.36035 0.263
NP_442848.1_1 Reverse -271 -285 -3.73699 0.27
NP_443018.1_3 Forward -285 -278 14.8871 0.0123
NP_443018.1_3 Reverse -278 -285 14.8871 0.0123
NP_443018.1_3 Forward -147 -140 10.2655 0.107
NP_441634.1_8 Forward -288 -274 5.1128 0.114
NP_441634.1_8 Reverse -275 -289 -4.52363 0.295
NP_440376.1_1 Forward -286 -277 19.4693 0.000692
NP_440376.1_1 Reverse -277 -286 19.4693 0.000692
NP_440376.1_1 Reverse -314 -323 0.589713 0.267
NP_441588.1_4 Forward -284 -274 18.1713 0.0143
NP_441588.1_4 Reverse -279 -289 8.73149 0.14
NP_442687.1_7 Forward -287 -277 8.92815 0.0994
NP_442687.1_7 Reverse -276 -286 8.92815 0.0994
NP_442687.1_7 Forward -76 -66 4.99491 0.225
NP_442485.1_3 Forward -159 -140 -2.85214 0.268
NP_441846.1_10 Reverse -150 -169 -23.2067 0.279
NP_442658.1_1 Forward -288 -278 7.94438 0.199
NP_442658.1_1 Reverse -275 -285 6.76441 0.214
NP_442496.1_5 Forward -374 -356 4.6407 0.289
NP_440656.1_8 Forward -297 -278 -4.72043 0.208
NP_442544.1_2 Reverse -313 -327 -0.590395 0.229
NP_441414.1_9 Forward -286 -267 -5.21209 0.171
NP_441414.1_9 Reverse -277 -296 -8.65367 0.242
NP_441487.1_9 Reverse -276 -295 -3.3438 0.299
NP_442937.1_5 Forward -291 -272 10.8159 0.152
NP_442321.1_4 Forward -144 -125 -3.44213 0.276
NP_441958.1_5 Forward -287 -277 12.2714 0.00183
NP_441958.1_5 Reverse -276 -286 12.2714 0.00183
NP_442836.1_5 Forward -292 -273 10.6192 0.104
NP_440203.1_5 Reverse -128 -138 11.6809 0.182
NP_440984.1_7 Forward -291 -277 5.60446 0.248
NP_439990.1_5 Reverse -272 -285 9.95071 0.128
NP_442911.1_2 Reverse -267 -286 -3.04881 0.107
NP_442911.1_2 Forward -263 -244 -6.58872 0.187
NP_442911.1_2 Forward -296 -277 -6.78538 0.192
NP_443055.1_6 Forward -294 -276 5.03327 0.181
NP_440602.1_2 Reverse -272 -291 4.62101 0.263
NP_441913.1_1 Forward -203 -187 15.5624 0.246
NP_440809.1_9 Forward -295 -277 -7.55234 0.225
NP_441294.1_7 Reverse -273 -287 20.6733 0.00181
NP_441294.1_7 Forward -290 -276 17.1217 0.0101
NP_442438.1_10 Reverse -272 -286 1.17956 0.204
NP_441000.1_6 Reverse -276 -290 5.1128 0.0933
NP_441000.1_6 Forward -287 -273 -4.32697 0.237
NP_442771.1_1 Forward -213 -195 -6.86402 0.169
NP_440147.1_4 Reverse -275 -288 18.9972 0.00328
NP_440147.1_4 Forward -288 -275 8.77074 0.0465
NP_441550.1_8 Forward -288 -278 15.1225 0.0132
NP_441550.1_8 Reverse -275 -285 14.6309 0.0132
NP_441916.1_7 Forward -286 -276 10.3048 0.0261
NP_441916.1_7 Reverse -277 -287 10.3048 0.0261
NP_441916.1_7 Reverse -139 -149 1.06167 0.294
NP_441916.1_10 Forward -294 -275 1.27776 0.268
NP_440206.1_4 Forward -158 -139 0.0970122 0.289
NP_441041.1_7 Reverse -274 -286 11.8878 0.0689
NP_441041.1_7 Forward -289 -277 10.8188 0.0864
NP_442396.1_5 Reverse -273 -286 10.7374 0.106
NP_441725.1_5 Forward -285 -275 2.04498 0.115
NP_441725.1_5 Reverse -278 -288 2.04498 0.115
NP_439966.1_7 Forward -288 -278 15.3192 0.0152
NP_439966.1_7 Reverse -275 -285 7.25606 0.15
NP_439966.1_8 Reverse -331 -350 5.89931 0.298
NP_442941.1_3 Reverse -278 -288 19.2529 0.00262
NP_442941.1_3 Forward -285 -275 11.0914 0.0116
NP_440289.1_2 Forward -289 -276 12.6056 0.0139
NP_440289.1_2 Reverse -274 -287 4.54251 0.066
NP_442281.1_1 Forward -291 -277 17.5018 0.00555
NP_442281.1_1 Reverse -353 -367 3.24392 0.238
NP_442281.1_1 Forward -153 -139 2.16228 0.276
NP_441079.1_7 Reverse -324 -343 -1.67294 0.206
NP_440018.1_3 Forward -170 -151 2.0644 0.291
NP_442256.1_2 Reverse -275 -293 -2.0458 0.191
NP_440437.1_1 Forward -81 -62 -3.44213 0.236
NP_442012.1_2 Forward -288 -269 4.42435 0.216
NP_442288.1_5 Forward -273 -259 15.0442 0.228
NP_442982.1_5 Reverse -129 -148 -2.26216 0.286
NP_442982.1_5 Forward -145 -126 -2.45882 0.286
NP_443030.1_3 Reverse -150 -168 3.46073 0.298
NP_441644.1_6 Forward -286 -276 17.3841 0.00127
NP_441644.1_6 Reverse -277 -287 17.3841 0.00127
NP_441644.1_6 Reverse -139 -149 3.32285 0.288
NP_443049.1_6 Reverse -65 -75 13.4952 0.162
NP_440867.1_10 Forward -317 -298 2.94938 0.283
NP_440867.1_10 Reverse -130 -149 2.45773 0.288
NP_442215.1_2 Reverse -123 -139 5.27008 0.0796
NP_442215.1_2 Forward -288 -272 4.28677 0.0853
NP_442215.1_2 Reverse -275 -291 -2.00642 0.191
NP_442215.1_2 Reverse -136 -152 -7.0213 0.284
NP_442029.1_6 Reverse -316 -335 4.916 0.259
NP_440253.1_2 Reverse -277 -295 17.0304 0.0115
NP_440929.1_8 Forward -286 -277 19.2726 0.000701
NP_440929.1_8 Reverse -277 -286 19.2726 0.000701
NP_440929.1_8 Reverse -248 -257 2.06468 0.268
NP_441346.1_7 Forward -216 -197 9.73422 0.28
NP_442933.1_10 Forward -286 -277 17.601 0.00325
NP_442933.1_10 Reverse -277 -286 17.601 0.00325
NP_441751.2_8 Forward -285 -271 4.81781 0.0464
NP_441751.2_8 Reverse -278 -292 4.22782 0.0521
NP_442554.1_8 Reverse -278 -288 16.2046 0.0065
NP_442554.1_8 Forward -285 -275 15.3197 0.00882
NP_442554.1_8 Forward -147 -137 5.38824 0.15
NP_442554.1_8 Reverse -140 -150 3.12662 0.239
NP_442167.1_6 Reverse -260 -276 11.9559 0.229
NP_441762.1_7 Forward -287 -275 0.432302 0.0747
NP_441762.1_7 Reverse -276 -288 -6.74586 0.284
NP_442142.1_4 Forward -289 -276 12.2117 0.0464
NP_442142.1_4 Reverse -274 -287 10.9334 0.0646
NP_442292.1_1 Forward -285 -276 18.486 0.00229
NP_442292.1_1 Reverse -278 -287 18.486 0.00229
NP_442381.1_8 Reverse -274 -293 -5.21209 0.141
NP_443009.1_5 Reverse -276 -287 8.90795 0.0965
NP_443009.1_5 Forward -287 -276 8.90795 0.0965
NP_443009.1_5 Forward -135 -124 4.67974 0.234
NP_441715.1_4 Reverse -278 -288 17.3846 0.0106
NP_441715.1_4 Forward -285 -275 7.94484 0.107
NP_440015.1_9 Forward -286 -268 -1.35749 0.28
NP_440183.1_1 Forward -252 -233 16.8141 0.239
NP_440183.1_9 Reverse -141 -160 -11.2103 0.25
NP_440464.1_10 Forward -285 -275 13.0082 0.169
NP_441468.1_1 Forward -285 -278 15.8704 0.0124
NP_441468.1_1 Reverse -278 -285 15.8704 0.0124
NP_441673.1_1 Forward -286 -277 20.8459 0.000698
NP_441673.1_1 Reverse -277 -286 20.8459 0.000698
NP_441826.1_2 Reverse -271 -285 -4.13031 0.292
NP_442745.1_6 Forward -161 -142 13.5691 0.258
NP_442490.1_9 Reverse -277 -296 -8.16202 0.284
NP_441764.1_8 Reverse -13 -23 13.4162 0.284
NP_442868.1_6 Forward -288 -278 19.2529 0.00563
NP_442868.1_6 Reverse -275 -285 9.81313 0.038
NP_441612.1_2 Reverse -277 -287 8.54929 0.21
NP_441612.1_2 Forward -286 -276 8.54929 0.21
NP_442427.1_8 Reverse -268 -287 11.0125 0.155
NP_442808.1_1 Reverse -276 -286 8.63269 0.0481
NP_442808.1_1 Forward -287 -277 8.63269 0.0481
NP_440145.1_3 Reverse -267 -286 -3.93378 0.214
NP_442050.1_5 Forward -288 -278 14.3359 0.0206
NP_442050.1_5 Reverse -275 -285 7.64939 0.243
NP_442342.1_9 Reverse -137 -153 9.10498 0.171
NP_440346.1_6 Reverse -342 -352 14.2444 0.273
NP_440558.1_2 Forward -143 -124 -6.39206 0.274
NP_441518.1_3 Forward -296 -277 -5.99873 0.131
NP_441878.1_6 Forward -149 -139 10.5014 0.0176
NP_441878.1_6 Forward -287 -277 10.4031 0.0176
NP_441878.1_6 Reverse -276 -286 10.4031 0.0176
NP_441878.1_6 Reverse -138 -148 10.4031 0.0176
NP_441878.1_6 Reverse -125 -135 -7.49312 0.231
NP_441036.1_8 Forward -287 -277 8.33817 0.174
NP_441036.1_8 Reverse -276 -286 8.33817 0.174
NP_441557.1_5 Forward -286 -277 19.9609 0.000699
NP_441557.1_5 Reverse -277 -286 19.9609 0.000699
NP_441445.1_1 Reverse -268 -287 15.5357 0.0437
NP_441445.1_1 Forward -295 -276 10.2259 0.0968
NP_442066.2_9 Reverse -62 -75 12.114 0.154
NP_442066.2_9 Forward -290 -277 8.47575 0.185
NP_441739.1_2 Reverse -255 -271 16.9707 0.0669
NP_442183.1_1 Reverse -277 -291 7.76774 0.131
NP_442397.1_1 Reverse -168 -182 16.0387 0.24
NP_442347.1_2 Forward -285 -276 12.4878 0.056
NP_442347.1_2 Reverse -278 -287 12.4878 0.056
NP_442347.1_2 Forward -74 -65 5.40793 0.23
NP_442645.1_2 Forward -294 -275 -21.83 0.29
NP_442645.1_2 Reverse -269 -288 -22.0267 0.29
NP_441037.1_4 Reverse -275 -285 7.9999 0.237
NP_441633.1_3 Forward -288 -275 3.46087 0.0699
NP_441633.1_3 Reverse -275 -288 1.19926 0.109
NP_440136.1_2 Forward -285 -278 15.9687 0.0123
NP_440136.1_2 Reverse -278 -285 15.9687 0.0123
NP_442998.1_10 Forward -284 -277 15.5754 0.0102
NP_442998.1_10 Reverse -279 -286 15.5754 0.0102
NP_442998.1_10 Forward -328 -321 10.4622 0.0819
NP_442998.1_10 Forward -73 -66 5.93897 0.206
NP_440299.1_1 Reverse -273 -286 10.3434 0.0573
NP_440299.1_1 Reverse -295 -308 4.54195 0.207
NP_440299.1_1 Reverse -317 -330 3.16532 0.256
NP_440299.1_1 Forward -290 -277 2.37867 0.291
NP_440299.1_1 Forward -152 -139 2.37867 0.291
NP_441799.1_1 Reverse -273 -287 14.8469 0.0221
NP_441799.1_1 Forward -290 -276 11.307 0.0591
NP_441007.1_10 Reverse -61 -74 2.77255 0.183
NP_441007.1_10 Forward -291 -278 0.412608 0.23
NP_442334.1_2 Forward -158 -141 -7.43431 0.291
NP_440256.1_1 Reverse -274 -293 10.2259 0.0188
NP_440256.1_1 Forward -289 -270 0.392778 0.0847
NP_441559.1_8 Reverse -144 -158 0.982901 0.159
NP_441559.1_8 Forward -139 -125 -3.63866 0.207
NP_441559.1_8 Reverse -145 -159 -5.21195 0.254
NP_441559.1_8 Forward -140 -126 -5.9986 0.271
NP_441559.1_8 Reverse -196 -210 -6.49025 0.279
NP_441559.1_8 Forward -153 -139 -6.98191 0.281
NP_440915.1_6 Reverse -135 -149 2.35953 0.119
NP_440915.1_6 Forward -290 -276 1.76955 0.131
NP_440915.1_6 Reverse -273 -287 1.67122 0.132
NP_440915.1_6 Forward -152 -138 0.982901 0.148
NP_441464.1_8 Forward -286 -272 3.93283 0.283
NP_441494.1_6 Forward -313 -300 10.049 0.227
NP_442386.1_9 Reverse -276 -285 13.8639 0.0289
NP_442386.1_9 Forward -287 -278 13.8639 0.0289
NP_440570.1_5 Forward -152 -133 -1.67217 0.276
NP_441340.1_5 Forward -285 -278 15.6737 0.0124
NP_441340.1_5 Reverse -278 -285 15.6737 0.0124
NP_442484.1_2 Reverse -266 -285 -1.96717 0.3
NP_442791.1_5 Reverse -148 -167 -6.49039 0.279
NP_442791.1_5 Reverse -269 -288 -11.8003 0.29
NP_440168.1_9 Reverse -124 -143 -5.40875 0.296
NP_440327.1_6 Forward -297 -278 2.65439 0.292
NP_440161.1_3 Forward -275 -256 7.96426 0.282
NP_442714.1_7 Forward -285 -266 -0.39387 0.263
NP_440586.1_8 Forward -285 -278 13.2151 0.026
NP_440586.1_8 Reverse -278 -285 13.2151 0.026
NP_440586.1_8 Reverse -67 -74 12.6251 0.0546
NP_440586.1_8 Forward -147 -140 9.08521 0.178
NP_442251.1_6 Forward -285 -278 15.2804 0.0124
NP_442251.1_6 Reverse -278 -285 15.2804 0.0124
NP_442959.1_5 Forward -36 -17 8.45592 0.224
NP_441262.1_3 Reverse -277 -284 14.7888 0.0223
NP_441262.1_3 Forward -286 -279 14.7888 0.0223
NP_443051.1_1 Reverse -276 -285 10.4228 0.00754
NP_443051.1_1 Forward -287 -278 10.4228 0.00754
NP_443051.1_1 Reverse -65 -74 0.29472 0.195
NP_439937.1_9 Reverse -198 -215 -14.3181 0.287
NP_439937.1_9 Forward -287 -270 -14.8098 0.287
NP_441595.1_5 Reverse -132 -150 7.09898 0.222
NP_440372.1_2 Forward -285 -278 16.3621 0.0124
NP_440372.1_2 Reverse -278 -285 16.3621 0.0124
NP_441946.1_9 Forward -62 -45 12.0007 0.287
NP_442368.1_2 Reverse -295 -314 6.19431 0.263
NP_440139.1_1 Forward -292 -273 5.01354 0.168
NP_441572.1_1 Reverse -275 -294 -3.3438 0.212
NP_441572.1_7 Forward -128 -109 -5.9004 0.276
NP_440267.1_2 Forward -291 -277 12.2903 0.125
NP_442384.1_10 Forward -286 -273 9.06573 0.0574
NP_442384.1_10 Reverse -277 -290 4.54251 0.153
NP_442384.1_10 Reverse -139 -152 1.29759 0.263
NP_442262.1_10 Forward -285 -278 14.1988 0.0123
NP_442262.1_10 Reverse -278 -285 14.1988 0.0123
NP_442262.1_10 Forward -147 -140 9.18389 0.211
NP_441689.1_5 Forward -288 -278 5.78111 0.197
NP_441689.1_5 Reverse -275 -285 5.78111 0.197
NP_440344.1_10 Reverse -270 -287 8.59364 0.0102
NP_440344.1_10 Forward -293 -276 0.333834 0.0363
NP_440531.1_6 Reverse -269 -288 0.392778 0.193
NP_440531.1_6 Forward -294 -275 -5.01543 0.291
NP_442910.1_1 Reverse -270 -289 2.45773 0.118
NP_442065.1_7 Reverse -268 -286 1.49411 0.243
NP_440297.1_9 Forward -285 -275 -0.118297 0.282
NP_440297.1_9 Reverse -278 -288 -0.118297 0.282
NP_440297.1_9 Forward -147 -137 -0.216628 0.282
NP_440297.1_9 Reverse -140 -150 -0.216628 0.282
NP_439926.1_6 Reverse -206 -217 18.6427 0.188
NP_440894.1_10 Forward -80 -61 5.30933 0.235
NP_440894.1_10 Forward -216 -197 4.12936 0.258
NP_440999.1_5 Reverse -300 -319 8.35677 0.291
NP_440999.1_9 Forward -290 -276 1.57289 0.162
NP_440888.1_2 Reverse -277 -291 14.7486 0.0152
NP_440888.1_2 Forward -286 -272 10.5204 0.0919
NP_440888.1_2 Reverse -149 -163 7.57046 0.19
NP_440600.1_4 Forward -294 -276 -2.63579 0.204
NP_439969.1_3 Reverse -134 -153 7.17762 0.155
NP_442033.1_10 Forward -310 -291 -10.522 0.239
NP_442033.1_10 Reverse -137 -156 -12.3902 0.269
NP_441543.1_2 Forward -285 -276 16.9127 0.00359
NP_441543.1_2 Reverse -278 -287 16.9127 0.00359
NP_442845.1_2 Reverse -271 -285 11.5043 0.128
NP_442845.1_2 Reverse -125 -139 4.71948 0.254
NP_441469.1_8 Reverse -125 -134 7.57121 0.227
NP_441469.1_8 Forward -287 -278 6.48957 0.227
NP_441469.1_8 Reverse -276 -285 6.48957 0.227
NP_443064.1_6 Forward -286 -276 12.5669 0.0796
NP_443064.1_6 Reverse -277 -287 12.5669 0.0796
NP_442578.1_7 Forward -285 -278 14.5921 0.026
NP_442578.1_7 Reverse -278 -285 14.5921 0.026
NP_442578.1_7 Reverse -67 -74 12.6255 0.0418
NP_441462.1_2 Forward -286 -276 11.5831 0.00406
NP_441462.1_2 Reverse -277 -287 11.5831 0.00406
NP_441462.1_2 Reverse -66 -76 -1.19994 0.291
NP_441929.1_7 Forward -56 -37 13.9625 0.232
NP_443062.1_1 Reverse -277 -295 14.0063 0.0538
NP_443062.1_6 Reverse -269 -288 10.9142 0.11
NP_443062.1_6 Reverse -326 -345 1.37609 0.276
NP_441601.1_4 Forward -166 -147 -4.42544 0.293
NP_440519.1_8 Forward -214 -198 8.515 0.199
NP_442204.1_1 Forward -152 -141 2.81194 0.266
NP_442204.1_2 Forward -296 -277 9.53756 0.225
NP_442204.1_6 Forward -157 -138 9.24257 0.223
NP_441560.1_10 Reverse -269 -288 5.50599 0.292
NP_440516.1_8 Forward -286 -277 16.9127 0.00442
NP_440516.1_8 Reverse -277 -286 16.9127 0.00442
NP_440516.1_8 Reverse -66 -75 0.786375 0.133
NP_442080.1_4 Forward -137 -118 10.4225 0.267
NP_441033.1_2 Forward -296 -277 -7.08038 0.293
NP_442428.1_5 Forward -285 -278 15.8704 0.0124
NP_442428.1_5 Reverse -278 -285 15.8704 0.0124
NP_441443.1_1 Forward -101 -82 2.55606 0.194
NP_441267.1_1 Reverse -271 -290 2.65439 0.234
NP_441867.1_2 Forward -273 -254 -12.4886 0.258
NP_440673.1_3 Forward -284 -277 12.4288 0.0426
NP_440673.1_3 Reverse -279 -286 12.4288 0.0426
NP_440673.1_3 Forward -73 -66 10.1672 0.149
NP_440718.1_2 Forward -189 -170 11.2092 0.274
NP_441052.1_2 Forward -286 -276 19.9412 0.00106
NP_441052.1_2 Reverse -277 -287 19.9412 0.00106
NP_441052.1_2 Forward -148 -138 0.865012 0.256
NP_442219.1_9 Forward -285 -276 17.7976 0.00718
NP_442219.1_9 Reverse -278 -287 17.7976 0.00718
NP_440436.1_4 Forward -285 -276 17.2072 0.00233
NP_440436.1_4 Reverse -278 -287 17.2072 0.00233
NP_441884.1_9 Forward -118 -99 -23.305 0.284
NP_441884.1_9 Reverse -274 -293 -23.6983 0.284
NP_442864.1_3 Reverse -99 -118 12.5858 0.181
NP_440314.1_9 Reverse -278 -297 -9.83364 0.278
NP_442414.1_8 Forward -325 -306 7.07928 0.293
NP_442907.1_9 Forward -164 -145 -6.29373 0.289
NP_441719.1_2 Reverse -318 -332 12.9639 0.292
NP_441719.1_4 Forward -285 -278 16.3621 0.0124
NP_441719.1_4 Reverse -278 -285 16.3621 0.0124
NP_441719.1_4 Reverse -67 -74 3.77569 0.285
NP_441719.1_6 Reverse -260 -279 4.62021 0.297
NP_441733.1_10 Reverse -63 -76 6.90245 0.166
NP_441004.1_1 Reverse -133 -152 -6.29373 0.184
NP_441004.1_1 Reverse -109 -128 -18.2901 0.299
NP_442366.1_3 Forward -344 -326 -3.22577 0.244
NP_442366.1_3 Reverse -276 -294 -5.58572 0.289
NP_442366.1_5 Reverse -274 -284 14.8275 0.0375
NP_440129.1_10 Forward -293 -279 2.45787 0.253
NP_441115.1_4 Reverse -65 -83 10.1465 0.187
NP_442206.1_3 Forward -159 -141 8.08229 0.286
NP_440328.1_4 Forward -81 -62 2.16274 0.209
NP_443054.1_2 Forward -288 -274 9.04604 0.102
NP_443054.1_2 Forward -136 -122 0.687908 0.256
NP_442308.1_4 Forward -292 -273 3.73603 0.267
NP_441851.1_10 Forward -287 -277 15.8113 0.00552
NP_441851.1_10 Reverse -276 -286 15.8113 0.00552
NP_442515.1_1 Reverse -276 -290 9.73436 0.0603
NP_442515.1_1 Reverse -243 -257 -0.295402 0.217
NP_442515.1_1 Forward -287 -273 -5.01529 0.298
NP_440165.1_5 Reverse -276 -295 2.94938 0.103
NP_441349.1_10 Forward -296 -277 10.5209 0.0232
NP_441349.1_10 Reverse -267 -286 -0.39387 0.0947
NP_441409.1_6 Reverse -271 -290 1.37609 0.0606
NP_440432.1_9 Reverse -278 -293 7.74804 0.0427
NP_442843.1_1 Forward -301 -282 -10.1286 0.276
NP_441124.1_5 Forward -180 -170 12.0532 0.239
NP_442450.1_3 Forward -186 -168 10.2448 0.207
NP_442450.1_5 Forward -77 -67 13.5497 0.115
NP_442450.1_5 Reverse -275 -285 7.55152 0.13
NP_440588.1_2 Reverse -57 -76 -5.31042 0.247
NP_442006.1_2 Forward -100 -83 -17.6607 0.279
NP_441570.1_1 Reverse -277 -295 -2.53746 0.0659
NP_441570.1_1 Forward -286 -268 -15.5171 0.231
NP_441078.1_4 Forward -286 -277 19.6659 0.0007
NP_441078.1_4 Reverse -277 -286 19.6659 0.0007
NP_441078.1_4 Forward -148 -139 -1.6719 0.266
NP_441078.1_4 Reverse -139 -148 -1.77023 0.266
NP_442443.1_1 Reverse -195 -214 -4.03212 0.268
NP_442443.1_1 Reverse -192 -211 -6.58872 0.295
NP_440526.1_3 Forward -285 -274 10.2846 0.0646
NP_440526.1_3 Reverse -278 -289 10.2846 0.0646
NP_441432.1_8 Reverse -276 -285 16.8143 0.00595
NP_441432.1_8 Forward -287 -278 16.8143 0.00595
NP_441432.1_8 Reverse -65 -74 4.22796 0.235
NP_442320.1_8 Forward -292 -278 3.63784 0.0578
NP_442320.1_8 Reverse -271 -285 -2.26202 0.0871
NP_442344.1_7 Reverse -278 -297 -7.96535 0.198
NP_441732.1_2 Reverse -273 -289 -16.5594 0.174
NP_440760.1_1 Forward -286 -267 -16.3235 0.172
NP_440760.1_1 Forward -135 -116 -22.9117 0.274
NP_440199.1_10 Reverse -324 -334 8.04317 0.231
NP_440199.1_10 Forward -289 -279 7.25653 0.231
NP_440199.1_10 Reverse -274 -284 7.25653 0.231
NP_441057.1_4 Reverse -146 -164 -1.65248 0.272
NP_441072.1_2 Reverse -145 -164 6.68596 0.273
NP_442489.1_7 Forward -286 -277 20.1576 0.000695
NP_442489.1_7 Reverse -277 -286 20.1576 0.000695
NP_442489.1_7 Reverse -139 -148 5.21127 0.077
NP_442489.1_7 Forward -148 -139 -1.6719 0.235
NP_440559.1_1 Forward -285 -276 17.4043 0.00658
NP_440559.1_1 Reverse -278 -287 17.4043 0.00658
NP_441659.2_8 Forward -286 -276 18.1713 0.00133
NP_441659.2_8 Reverse -277 -287 18.1713 0.00133
NP_441022.1_1 Forward -188 -179 11.1625 0.284
NP_442913.1_10 Forward -295 -276 4.03102 0.0942
NP_441040.1_2 Reverse -306 -325 -16.2252 0.294
NP_439956.1_7 Reverse -120 -139 10.0292 0.257
NP_440779.1_4 Forward -131 -114 15.5202 0.272
NP_440779.1_5 Reverse -277 -294 -6.15601 0.164
NP_442346.1_5 Forward -287 -277 16.6963 0.00248
NP_442346.1_5 Reverse -276 -286 16.6963 0.00248
NP_442346.1_5 Forward -149 -139 6.8632 0.188
NP_442346.1_5 Reverse -138 -148 6.17489 0.212
NP_440545.1_3 Reverse -135 -152 2.59545 0.0976
NP_440545.1_3 Forward -152 -135 -4.58271 0.229
NP_440025.1_1 Reverse -273 -292 5.70265 0.284
NP_440459.1_2 Reverse -268 -285 9.38028 0.229
NP_440459.1_2 Forward -325 -308 7.31533 0.296
NP_441653.1_2 Forward -297 -278 5.07576 0.248
NP_441943.1_8 Reverse -129 -148 4.81767 0.164
NP_442027.1_1 Forward -218 -200 12.2883 0.268
NP_441888.1_7 Forward -140 -126 6.09611 0.225
NP_441888.1_7 Forward -291 -277 2.2612 0.225
NP_440449.1_6 Reverse -131 -149 12.3409 0.115
NP_441948.1_4 Reverse -270 -288 0.609134 0.136
NP_441833.1_4 Forward -285 -278 15.9687 0.0124
NP_441833.1_4 Reverse -278 -285 15.9687 0.0124
NP_442162.1_9 Forward -285 -278 16.2637 0.0124
NP_442162.1_9 Reverse -278 -285 16.2637 0.0124
NP_442199.1_5 Forward -294 -275 8.25926 0.0719
NP_442140.1_3 Forward -285 -275 12.2714 0.0632
NP_442140.1_3 Reverse -278 -288 10.3048 0.0902
NP_442140.1_3 Reverse -157 -167 3.42162 0.297
NP_440875.1_9 Forward -73 -63 12.7522 0.104
NP_440875.1_9 Reverse -279 -289 7.69067 0.255
NP_441813.1_5 Forward -288 -278 18.1713 0.00743
NP_441813.1_5 Reverse -275 -285 8.63316 0.0367
NP_440590.1_4 Forward -285 -272 11.3273 0.0209
NP_440590.1_4 Reverse -278 -291 4.14919 0.0632
NP_440567.1_1 Forward -285 -271 9.43936 0.0442
NP_440567.1_1 Forward -74 -60 4.22782 0.126
NP_442497.1_10 Forward -285 -276 10.4228 0.0087
NP_442497.1_10 Reverse -278 -287 10.4228 0.0087
NP_440821.1_4 Reverse -275 -285 9.41981 0.0286
NP_440821.1_4 Forward -288 -278 9.41981 0.0286
NP_441239.1_9 Reverse -137 -149 8.79043 0.122
NP_441239.1_9 Forward -150 -138 6.52882 0.185
NP_441239.1_9 Forward -288 -276 5.25052 0.223
NP_441239.1_9 Reverse -275 -287 3.38223 0.285
NP_442643.1_3 Forward -252 -233 -8.65367 0.297
NP_440900.1_4 Reverse -157 -176 17.6042 0.271
NP_440833.1_6 Reverse -254 -268 7.47213 0.278
NP_442138.1_10 Reverse -277 -296 12.7825 0.0359
NP_440546.1_4 Forward -286 -276 10.046 0.109
NP_440546.1_4 Reverse -277 -287 10.046 0.109
NP_441656.1_6 Reverse -292 -311 6.88262 0.252
NP_440462.1_6 Forward -288 -278 9.61647 0.0429
NP_440462.1_6 Reverse -64 -74 6.46988 0.115
NP_440462.1_6 Reverse -275 -285 1.35667 0.294
NP_440868.1_4 Forward -290 -278 7.80712 0.0637
NP_440868.1_4 Reverse -273 -285 6.23383 0.0878
NP_441204.1_1 Forward -295 -276 25.7622 0.013
NP_441474.1_1 Reverse -96 -115 -1.47628 0.262
NP_440341.1_7 Reverse -257 -271 11.6026 0.24
NP_442402.1_10 Reverse -258 -268 13.2542 0.204
NP_442039.1_4 Forward -285 -278 15.1821 0.0124
NP_442039.1_4 Reverse -278 -285 15.1821 0.0124
NP_440825.1_6 Reverse -311 -330 9.3409 0.285
NP_440825.1_7 Forward -285 -275 12.9096 0.152
NP_442837.1_3 Forward -285 -278 15.7721 0.0124
NP_442837.1_3 Reverse -278 -285 15.7721 0.0124
NP_442837.1_3 Forward -74 -67 9.87221 0.106
NP_442053.1_1 Forward -286 -277 18.3876 0.0007
NP_442053.1_1 Reverse -277 -286 18.3876 0.0007
NP_442053.1_1 Forward -75 -66 4.42462 0.249
NP_440505.1_3 Forward -288 -278 18.3679 0.00213
NP_440505.1_3 Reverse -275 -285 9.22315 0.122
NP_440505.1_3 Reverse -148 -158 7.05986 0.165
NP_441102.1_2 Forward -33 -14 5.40766 0.298
NP_441252.1_6 Forward -268 -261 11.6422 0.288
NP_442532.1_4 Forward -273 -255 10.001 0.273
NP_440914.1_1 Forward -286 -276 17.5935 0.000537
NP_440914.1_1 Reverse -277 -287 17.5935 0.000537
NP_440914.1_1 Reverse -248 -258 7.83437 0.219
NP_441011.1_8 Forward -285 -276 8.25953 0.144
NP_441011.1_8 Reverse -278 -287 8.25953 0.144
NP_442533.1_6 Forward -286 -277 17.2076 0.00137
NP_442533.1_6 Reverse -277 -286 17.2076 0.00137
NP_442533.1_6 Reverse -139 -148 6.8829 0.101
NP_442533.1_6 Forward -148 -139 6.78456 0.103
NP_441482.1_7 Forward -292 -278 -12.1934 0.29
NP_439944.1_9 Forward -285 -275 10.5014 0.0887
NP_439944.1_9 Reverse -278 -288 10.5014 0.0887
NP_441697.1_5 Reverse -168 -187 -7.59203 0.247
NP_440116.1_8 Reverse -278 -297 5.01433 0.0669
NP_440116.1_8 Forward -285 -266 -9.44032 0.278
NP_441527.1_8 Reverse -345 -364 5.01433 0.279
NP_440115.1_6 Forward -289 -279 6.8632 0.167
NP_440115.1_6 Reverse -63 -73 4.99491 0.277
NP_439965.1_1 Reverse -268 -287 -6.39206 0.213
NP_441680.1_4 Forward -163 -144 0.196116 0.246
NP_442492.1_2 Reverse -277 -296 0.294447 0.241
NP_441961.1_4 Reverse -148 -167 6.98095 0.27
NP_441106.1_1 Forward -287 -278 9.63616 0.0311
NP_441106.1_1 Reverse -276 -285 9.63616 0.0311
NP_441286.1_1 Forward -287 -275 12.9203 0.00815
NP_441286.1_1 Reverse -276 -288 12.9203 0.00815
NP_440670.1_6 Forward -253 -234 15.5357 0.292
NP_440670.1_8 Forward -286 -277 18.3876 0.000699
NP_440670.1_8 Reverse -277 -286 18.3876 0.000699
NP_441930.1_2 Reverse -125 -135 16.008 0.19
NP_440886.1_7 Forward -287 -277 7.94438 0.0805
NP_440886.1_7 Reverse -276 -286 7.94438 0.0805
NP_440886.1_7 Reverse -263 -273 6.86274 0.113
NP_442614.1_2 Forward -286 -272 12.291 0.165
NP_442614.1_2 Reverse -244 -258 8.75105 0.248
NP_440907.2_8 Forward -285 -275 7.64939 0.117
NP_441021.1_1 Reverse -278 -297 -9.63698 0.218
NP_440841.1_4 Reverse -275 -294 -8.45701 0.25
NP_441463.1_3 Forward -296 -277 9.43923 0.0481
NP_441626.1_2 Forward -285 -278 15.7721 0.0124
NP_441626.1_2 Reverse -278 -285 15.7721 0.0124
NP_442912.1_9 Reverse -157 -176 18.6823 0.105
NP_442362.1_7 Forward -151 -133 14.7688 0.22
NP_442794.1_1 Reverse -273 -285 2.69391 0.286
NP_442615.1_1 Forward -295 -277 7.68896 0.0306
NP_442615.1_1 Reverse -268 -286 5.52568 0.0379
NP_442615.1_1 Reverse -57 -75 -2.14413 0.139
NP_442615.1_1 Reverse -312 -330 -7.45401 0.291
NP_441962.1_4 Forward -313 -294 -9.73531 0.22
NP_441962.1_4 Reverse -272 -291 -13.1769 0.271
NP_441431.1_2 Forward -289 -275 8.16044 0.222
NP_441431.1_2 Reverse -245 -259 6.0955 0.28
NP_441431.1_2 Forward -168 -154 5.89884 0.284
NP_441993.1_1 Reverse -133 -152 1.55686 0.274
NP_441174.1_1 Forward -157 -142 14.3362 0.231
NP_440114.1_10 Reverse -277 -291 10.1277 0.153
NP_440114.1_10 Forward -286 -272 6.6861 0.26
NP_441817.1_3 Forward -297 -278 18.584 0.0383
NP_441552.1_3 Reverse -270 -289 12.1917 0.292
NP_440766.1_4 Forward -277 -263 0.982901 0.259
NP_439988.1_3 Forward -152 -138 4.71948 0.292
NP_441237.1_9 Forward -285 -275 14.828 0.0242
NP_442930.1_1 Reverse -255 -265 9.321 0.287
NP_439910.1_2 Forward -294 -277 -21.6923 0.184
NP_439910.1_2 Reverse -269 -286 -22.2823 0.22
NP_440457.1_1 Forward -152 -140 4.75886 0.154
NP_440457.1_1 Reverse -273 -285 0.825626 0.25
NP_440457.1_1 Forward -290 -278 -0.649339 0.271
NP_442297.1_4 Reverse -273 -292 13.2105 0.255
NP_440473.1_9 Forward -297 -278 -7.27704 0.236
NP_442509.1_9 Forward -286 -276 8.14104 0.192
NP_442509.1_9 Reverse -277 -287 8.14104 0.192
NP_442509.1_9 Forward -323 -313 7.25606 0.229
NP_440524.1_2 Reverse -309 -328 -0.787193 0.27
NP_442514.1_5 Forward -294 -275 -8.85106 0.29
NP_440554.1_4 Reverse -278 -288 8.92815 0.0646
NP_441885.1_5 Forward -286 -276 20.9245 0.000538
NP_441885.1_5 Reverse -277 -287 20.9245 0.000538
NP_442341.1_7 Forward -287 -273 8.35772 0.0881
NP_442341.1_7 Forward -324 -310 7.17775 0.11
NP_442341.1_7 Reverse -276 -290 1.47456 0.288
NP_442341.1_9 Forward -288 -274 10.717 0.133
NP_441756.1_5 Forward -151 -132 1.0811 0.219
NP_441173.1_9 Reverse -260 -268 12.507 0.206
NP_441173.1_9 Reverse -173 -181 12.1137 0.21
NP_443000.1_7 Forward -288 -278 19.9412 0.00223
NP_443000.1_7 Reverse -275 -285 10.3048 0.0345
NP_441842.1_10 Reverse -59 -73 7.17775 0.264
NP_441842.1_10 Forward -293 -279 6.09611 0.299
NP_440275.1_3 Forward -288 -278 15.123 0.0182
NP_440275.1_3 Reverse -275 -285 8.04317 0.0602
NP_440091.1_1 Reverse -273 -285 10.7571 0.0429
NP_440091.1_1 Forward -290 -278 8.88877 0.0567
NP_443060.1_5 Reverse -269 -288 19.8614 0.0357
NP_439962.1_4 Forward -316 -297 -7.96535 0.292
NP_441105.1_3 Forward -297 -278 0.982764 0.118
NP_441105.1_3 Reverse -266 -285 -5.40875 0.219
NP_441105.1_3 Reverse -316 -335 -8.26035 0.269
NP_440216.1_1 Reverse -277 -291 7.9644 0.00737
NP_440216.1_1 Forward -286 -272 -0.393733 0.0284
NP_440172.1_1 Forward -286 -276 15.0247 0.00945
NP_440172.1_1 Reverse -277 -287 15.0247 0.00945
NP_440172.1_1 Reverse -66 -76 4.69992 0.171
NP_440167.1_3 Forward -215 -196 10.5209 0.233
NP_442015.1_10 Forward -290 -277 2.87088 0.187
NP_442015.1_10 Reverse -273 -286 1.59258 0.204
NP_442015.1_10 Forward -152 -139 0.117615 0.241
NP_441226.1_7 Forward -285 -278 14.4934 0.0123
NP_441226.1_7 Reverse -278 -285 14.4934 0.0123
NP_441226.1_7 Forward -164 -157 9.47853 0.147
NP_441111.1_7 Forward -285 -277 18.7023 0.00294
NP_441111.1_7 Reverse -278 -286 18.7023 0.00294
NP_441766.1_2 Forward -286 -277 17.5026 0.00297
NP_441766.1_2 Reverse -277 -286 17.5026 0.00297
NP_440416.1_9 Reverse -282 -301 -6.98204 0.0951
NP_443052.1_8 Forward -296 -277 -0.688862 0.0723
NP_442154.1_1 Forward -26 -8 -12.3706 0.217
NP_440261.1_5 Reverse -140 -153 -6.56889 0.201
NP_440261.1_5 Forward -74 -61 -11.3871 0.259
NP_440261.1_5 Reverse -278 -291 -12.1738 0.272
NP_440261.1_5 Forward -285 -272 -12.3704 0.284
NP_440261.1_5 Forward -147 -134 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGACATAATCTGTTCTCTACGGGACTTGGATCGAGAGAATGGTCAGTTAATTCTTCGGGAGATTATCGATATCTATTGCCAAACGGCGCCGGAACTATTGCAACGGATCAAACTGGCGATCGCCAATCAAGATTGGGGAAATTTGAGTTCGGCCGCCCATACATTGGGTTCTAGCAGTGCTAATTTAGGGGCGGTACTCCTGGCACAACAGGCTAAAACTTTGGAAAATCTGACCCGCCAACGGGACTCCCGGGCCATGGACCCAGGGCATTTCCCGACCTTAGCGGCCAGCTACGAAAGGGTGCAGGGAGAACTGAAAACTATGCTTGATCGCCTCTAGAAAAGTCTTGCTAGGCCTTAGTTGGTTAGAATACGGGATGTTTTCTGTGACAAGGTAGTA

CDS

ATGACCGTTAGCGAATCGATGGCCGGATCCCCGTTGCCCAAATTGCCCCTGGTGACTATGTTCCGTCTGGGGTTATTCCAGATGGGGCTGGGCATTATGTCCCTACTTACCCTGGGGGTACTCAACCGGGTGCTGATTGACGAGCTAGCAGTGTTACCCTGGGTGGCCGCTACGGCGATCGCCATGTATCAATTTGTTAGTCCCTTTAAGGTGTGGTGCGGTCAACTGTCCGACAGTCAGCGGCTGTGGGGTTACCATCGCACTGGCTATGTGTGGCTGGGAGCCCTGGGTTTTACCATATTGTCCTTTATCGCCCTCCAGGTGGTGTGGCAATTGGGGCTAAGTTTGCAAAATAACGGCTGGGGAGCCCTAACCATTTTTTGGAGCATTGTGCTGGGGGCAGTTTTCGCCGCCTACGGGGTCACTCTGAGTTTAAGCTCCACTCCCTTTGCCGCCCTGTTGGTGGACGTATCCGATGAAGATAATCGCTCCAAACTGGTGGGCATTGTCTGGTCCATGTTGATGGTGGGTATCGTGGTGGGGGCCATTGTCAGTTCCCGGCTGTTAAACACCCCTGAAATTTGTGGCCCGGCCCTGTTGAATGCCGATGCCCTGCTAGTGAAAAAAACCGTCGATATTGCCCAACTGCAACGGGGAATTAATCCCGTCTTCATCATCATGCCGGCGATCGTGGTATTCCTGGCCTGGCTCGCCACGGTGGGGGTGGAAAAGAAATATTCCCGCTTTGGCGATCGTTCCGGGGGGCGAGAGGATGAAATTACTTTGGGGCAAGCGCTGAAGGTGTTGACCGCCAGCCGACAAACGGCCATCTTCTTCGGCTTTTTGTTGCTACTAACCCTGAGCCTATTTATGCAGGATGCAGTACTGGAACCCTACGGTGGGGAAGTCTTTAATCTTTGCATTTCCGAAACCACCCAGTTAAACGCCTTTTTTGGCATGGGAACCCTGCTGGGCATTGGCTCCACTGGCTTTTTTGTCGTCCCCCGTTTAGGCAAACAACGCACCACTTCCCTGGGCTGTGCCCTGGCCGCCCTGTGTTTTTCCCTGTTAATTCTGGCGGGATTTCAGCAAAATGTGACCCTGTTAAAATCCGGTTTACTTTTCTTCGGCTTAGCATCGGGCATGATCACCGCTGGAGCCACCAGTTTAATGTTGGACCTCACCGCTGTGGAAACCGCTGGCACTTTTATTGGAGCTTGGGGTTTGGCCCAATCCATTTCCAGAGGCTTAGCCACGGTGGCTGGGGGAACGGTGTTGAACATCGGCAAAGCTTTATTTGCCAATGCGGTATTGGCCTACGGTTTGGTGTTTGCCCTCCAGGCCCTGGGGTTAATTCTCTCCATTTTCCTGCTCAACAAAGTCAATGTGCGGGAATTTCAGGACAATGCCAAAACGGCGATCGCCACGGTGATGGCGGGGGATTTAGACGGCTAA

Protein

MTVSESMAGSPLPKLPLVTMFRLGLFQMGLGIMSLLTLGVLNRVLIDELAVLPWVAATAIAMYQFVSPFKVWCGQLSDSQRLWGYHRTGYVWLGALGFTILSFIALQVVWQLGLSLQNNGWGALTIFWSIVLGAVFAAYGVTLSLSSTPFAALLVDVSDEDNRSKLVGIVWSMLMVGIVVGAIVSSRLLNTPEICGPALLNADALLVKKTVDIAQLQRGINPVFIIMPAIVVFLAWLATVGVEKKYSRFGDRSGGREDEITLGQALKVLTASRQTAIFFGFLLLLTLSLFMQDAVLEPYGGEVFNLCISETTQLNAFFGMGTLLGIGSTGFFVVPRLGKQRTTSLGCALAALCFSLLILAGFQQNVTLLKSGLLFFGLASGMITAGATSLMLDLTAVETAGTFIGAWGLAQSISRGLATVAGGTVLNIGKALFANAVLAYGLVFALQALGLILSIFLLNKVNVREFQDNAKTAIATVMAGDLDG