Your browser is old and dusty. Try Google Chrome!

Details for sll1899

ORF sll1899
Accession NP_441501.1
Symbol ctaB
Category Respiratory terminal oxidases
Definition cytochrome c oxidase folding protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -207 -193 6.98109 0.11
NP_441061.1_2 Reverse -200 -214 -0.000409212 0.219
NP_441061.1_2 Reverse -206 -220 -1.08205 0.249
NP_440795.1_7 Forward -207 -200 14.6904 0.0123
NP_440795.1_7 Reverse -200 -207 14.6904 0.0123
NP_441418.1_6 Forward -208 -189 -0.295539 0.0102
NP_441418.1_6 Reverse -199 -218 -9.83364 0.0294
NP_441418.1_6 Forward -220 -201 -29.1065 0.216
NP_441418.1_6 Forward -331 -312 -30.2865 0.267
NP_442291.1_5 Forward -209 -193 3.10679 0.114
NP_442291.1_5 Reverse -198 -214 -0.531451 0.185
NP_441453.1_1 Reverse -192 -210 2.87 0.282
NP_441453.1_4 Reverse -199 -207 16.539 0.00633
NP_441453.1_4 Forward -208 -200 16.539 0.00633
NP_441960.1_3 Forward -208 -189 12.7459 0.291
NP_442151.1_6 Reverse -199 -213 16.6175 0.0139
NP_441818.1_1 Reverse -200 -211 9.79292 0.232
NP_441818.1_1 Forward -207 -196 9.69459 0.232
NP_440226.1_1 Forward -208 -189 14.1591 0.0325
NP_440226.1_1 Reverse -199 -218 4.12936 0.202
NP_441630.1_3 Forward -216 -197 14.9458 0.0458
NP_441342.1_2 Forward -212 -198 13.6676 0.174
NP_441976.1_2 Reverse -107 -126 10.4217 0.298
NP_442744.1_8 Reverse -174 -193 -5.9004 0.297
NP_442173.1_1 Forward -207 -199 15.4574 0.00633
NP_442173.1_1 Reverse -200 -208 15.4574 0.00633
NP_442752.1_4 Forward -208 -201 13.8055 0.0199
NP_442752.1_4 Reverse -199 -206 13.8055 0.0199
NP_443027.1_4 Reverse -197 -207 14.828 0.0437
NP_441812.1_3 Forward -209 -195 17.8958 0.0479
NP_442975.1_10 Reverse -195 -209 22.32 0.000414
NP_440784.1_7 Forward -207 -200 15.9687 0.0123
NP_440784.1_7 Reverse -200 -207 15.9687 0.0123
NP_440061.1_9 Reverse -197 -211 11.7987 0.105
NP_440061.1_9 Forward -73 -59 6.78381 0.232
NP_440061.1_9 Forward -177 -163 5.80051 0.272
NP_441054.1_3 Reverse -311 -329 18.4383 0.138
NP_441054.1_4 Forward -218 -200 -3.81576 0.285
NP_442062.1_8 Forward -208 -198 19.4496 0.000558
NP_442062.1_8 Reverse -199 -209 17.3846 0.00193
NP_440304.1_4 Reverse -197 -207 10.8948 0.051
NP_440304.1_4 Forward -122 -112 2.83163 0.299
NP_440304.1_4 Forward -210 -200 1.84832 0.299
NP_442242.1_4 Forward -207 -200 14.3954 0.0124
NP_442242.1_4 Reverse -200 -207 14.3954 0.0124
NP_440044.1_8 Reverse -200 -219 7.57094 0.0817
NP_440044.1_8 Forward -207 -188 -3.24547 0.281
NP_441781.1_7 Forward -316 -297 4.42435 0.186
NP_441035.1_3 Reverse -58 -77 1.57275 0.234
NP_441200.1_4 Reverse -358 -377 5.89931 0.291
NP_441935.1_1 Forward -339 -320 8.75091 0.225
NP_441208.1_9 Forward -211 -197 13.7659 0.103
NP_442110.1_7 Reverse -199 -213 -0.0987402 0.274
NP_441925.1_4 Forward -173 -154 -17.6025 0.297
NP_440273.1_1 Forward -56 -37 13.1297 0.243
NP_440769.1_8 Forward -56 -37 15.1424 0.15
NP_441083.1_5 Reverse -199 -209 20.3345 0.00053
NP_441083.1_5 Forward -208 -198 11.3864 0.0159
NP_442827.1_8 Forward -216 -197 5.2102 0.123
NP_441738.1_2 Forward -206 -199 15.28 0.0102
NP_441738.1_2 Reverse -201 -208 15.28 0.0102
NP_441558.1_5 Reverse -197 -216 13.4708 0.0578
NP_440209.1_1 Reverse -199 -207 18.1123 0.00295
NP_440209.1_1 Forward -208 -200 18.1123 0.00295
NP_442889.1_8 Reverse -196 -210 22.615 0.00144
NP_440447.1_5 Forward -132 -122 13.943 0.277
NP_440447.1_5 Reverse -121 -131 13.943 0.277
NP_440178.1_5 Forward -202 -193 18.6826 0.137
NP_440178.1_7 Forward -209 -190 -12.7836 0.124
NP_441792.1_1 Forward -34 -15 6.4893 0.234
NP_441716.1_1 Reverse -174 -188 11.996 0.0868
NP_441327.1_1 Forward -57 -38 13.0554 0.184
NP_441163.1_9 Reverse -190 -209 12.6841 0.272
NP_440906.1_5 Forward -207 -200 15.8704 0.0124
NP_440906.1_5 Reverse -200 -207 15.8704 0.0124
NP_440747.1_10 Forward -211 -199 14.9853 0.00221
NP_440747.1_10 Reverse -196 -208 -2.02597 0.0196
NP_440747.1_10 Forward -380 -368 -11.6624 0.131
NP_441130.1_10 Reverse -197 -211 11.5043 0.106
NP_441486.1_1 Reverse -196 -210 22.5174 0.00162
NP_441486.1_1 Forward -211 -197 19.9608 0.00312
NP_442145.1_4 Reverse -132 -151 9.7875 0.175
NP_440057.1_6 Forward -56 -37 10.5039 0.29
NP_441014.1_8 Forward -182 -163 1.17943 0.214
NP_441014.1_8 Reverse -185 -204 -8.26035 0.283
NP_441014.1_10 Forward -209 -190 19.3698 0.0349
NP_442848.1_1 Reverse -193 -207 -2.95034 0.263
NP_442848.1_4 Forward -229 -215 6.48943 0.284
NP_443018.1_3 Forward -207 -200 14.8871 0.0123
NP_443018.1_3 Reverse -200 -207 14.8871 0.0123
NP_443018.1_3 Reverse -331 -338 7.6106 0.156
NP_441316.1_7 Reverse -197 -212 3.32315 0.141
NP_441634.1_8 Forward -210 -196 5.1128 0.114
NP_440376.1_1 Forward -208 -199 19.4693 0.000692
NP_440376.1_1 Reverse -199 -208 19.4693 0.000692
NP_440376.1_1 Reverse -368 -377 -1.18024 0.294
NP_441857.1_5 Forward -215 -197 6.41066 0.189
NP_441588.1_4 Reverse -201 -211 8.92815 0.14
NP_441588.1_4 Forward -206 -196 6.96153 0.178
NP_442687.1_7 Reverse -198 -208 15.8113 0.0125
NP_442687.1_7 Forward -209 -199 8.92815 0.0994
NP_442687.1_7 Forward -332 -322 4.40493 0.249
NP_442687.1_7 Reverse -165 -175 4.3066 0.255
NP_442485.1_3 Reverse -188 -207 3.93269 0.192
NP_442485.1_3 Forward -210 -191 -2.45882 0.262
NP_442485.1_3 Reverse -179 -198 -3.73712 0.277
NP_442485.1_3 Forward -342 -323 -5.99873 0.297
NP_441846.1_10 Reverse -17 -36 -23.5016 0.289
NP_442958.1_3 Forward -219 -200 3.6377 0.253
NP_440642.1_1 Reverse -309 -328 7.27595 0.266
NP_441950.1_7 Reverse -158 -177 -6.88371 0.274
NP_442296.1_9 Reverse -200 -219 0.687771 0.197
NP_440360.1_10 Forward -173 -159 5.60446 0.227
NP_442658.1_1 Reverse -197 -207 15.9091 0.00966
NP_442658.1_1 Forward -210 -200 6.76441 0.214
NP_440141.1_4 Forward -205 -186 -11.9969 0.298
NP_442782.1_2 Forward -220 -206 4.81781 0.25
NP_442782.1_2 Reverse -247 -261 4.12949 0.257
NP_440656.1_8 Reverse -188 -207 16.6174 0.0174
NP_441414.1_9 Reverse -199 -218 -10.0303 0.275
NP_440184.1_1 Reverse -134 -153 2.68475 0.255
NP_441487.1_9 Reverse -165 -184 1.86774 0.196
NP_441487.1_9 Forward -340 -321 -0.688862 0.262
NP_441958.1_5 Forward -209 -199 12.2714 0.00183
NP_441958.1_5 Reverse -198 -208 12.2714 0.00183
NP_441958.1_5 Reverse -165 -175 -2.28158 0.27
NP_441127.1_1 Forward -339 -325 8.75105 0.288
NP_441127.1_1 Reverse -328 -342 8.25939 0.3
NP_442836.1_5 Forward -214 -195 6.4893 0.178
NP_440203.1_5 Reverse -202 -212 10.9926 0.206
NP_439905.1_1 Reverse -200 -213 11.9173 0.204
NP_440984.1_7 Forward -213 -199 21.0424 0.00311
NP_442690.1_1 Reverse -37 -56 -0.688862 0.127
NP_442690.1_1 Forward -70 -51 -13.9635 0.268
NP_442911.1_2 Reverse -189 -208 -8.85033 0.244
NP_441580.1_6 Reverse -188 -207 -5.40875 0.235
NP_440369.1_8 Forward -360 -341 22.7793 0.023
NP_443055.1_3 Reverse -190 -209 14.5603 0.124
NP_443055.1_6 Reverse -191 -209 9.55647 0.133
NP_443055.1_6 Forward -339 -321 4.14829 0.186
NP_440934.1_1 Forward -222 -203 8.55425 0.233
NP_440602.1_8 Forward -208 -194 15.9292 0.115
NP_441913.1_3 Forward -54 -41 16.1999 0.218
NP_441129.1_8 Reverse -202 -221 8.65258 0.296
NP_441099.1_5 Reverse -189 -208 -4.81876 0.147
NP_441099.1_5 Forward -218 -199 -12.0953 0.294
NP_442002.1_1 Reverse -244 -262 -10.6989 0.298
NP_442002.1_9 Reverse -198 -205 10.7572 0.185
NP_441654.1_5 Forward -56 -37 13.2019 0.258
NP_442598.1_2 Forward -17 -8 14.8477 0.252
NP_442013.1_3 Forward -69 -50 17.8957 0.216
NP_441294.1_7 Reverse -195 -209 16.6418 0.0133
NP_440411.1_10 Reverse -243 -262 15.1413 0.194
NP_442438.1_10 Reverse -194 -208 1.76955 0.188
NP_442438.1_10 Forward -213 -199 1.67122 0.19
NP_441000.1_5 Reverse -332 -351 9.93006 0.214
NP_441000.1_6 Forward -209 -195 5.01447 0.0933
NP_441000.1_6 Reverse -198 -212 -5.50694 0.279
NP_441000.1_6 Reverse -169 -183 -5.60527 0.285
NP_442771.1_1 Forward -185 -167 -5.78238 0.166
NP_442771.1_1 Reverse -172 -190 -6.56903 0.168
NP_442771.1_1 Reverse -320 -338 -8.83064 0.208
NP_441674.1_10 Reverse -321 -339 -0.865831 0.29
NP_440147.1_4 Forward -210 -197 10.049 0.0355
NP_440147.1_4 Reverse -197 -210 3.46087 0.187
NP_440147.1_4 Forward -341 -328 -0.472371 0.287
NP_441550.1_8 Forward -210 -200 14.6309 0.0132
NP_441550.1_8 Reverse -197 -207 6.0761 0.214
NP_441550.1_8 Reverse -164 -174 6.0761 0.214
NP_441916.1_7 Forward -208 -198 18.4663 0.00144
NP_441916.1_7 Reverse -199 -209 10.3048 0.0261
NP_441916.1_7 Forward -179 -169 4.69992 0.163
NP_441916.1_7 Forward -175 -165 3.71661 0.203
NP_441916.1_7 Reverse -174 -184 1.06167 0.294
NP_441916.1_10 Reverse -191 -210 0.786102 0.275
NP_441041.1_4 Forward -208 -189 -1.37718 0.1
NP_441041.1_7 Reverse -196 -208 10.916 0.0864
NP_442396.1_5 Forward -212 -199 11.7207 0.0913
NP_440569.1_8 Reverse -368 -387 7.96426 0.28
NP_442004.1_6 Reverse -199 -213 7.47274 0.159
NP_441725.1_5 Forward -207 -197 11.2881 0.0247
NP_441725.1_5 Reverse -200 -210 2.04498 0.115
NP_441725.1_5 Forward -330 -320 -0.314959 0.246
NP_439966.1_7 Reverse -197 -207 18.4657 0.00473
NP_439966.1_7 Forward -210 -200 7.25606 0.15
NP_439966.1_9 Reverse -197 -206 0.983037 0.253
NP_440202.1_8 Reverse -191 -210 19.5326 0.177
NP_442941.1_3 Forward -207 -197 11.4848 0.0116
NP_442941.1_3 Reverse -200 -210 11.0914 0.0116
NP_440289.1_2 Reverse -196 -209 21.3571 0.00262
NP_440289.1_2 Forward -334 -321 -0.669033 0.206
NP_440289.1_2 Reverse -319 -332 -3.32397 0.267
NP_440983.1_5 Reverse -202 -221 -8.16202 0.294
NP_440260.1_8 Forward -217 -199 -5.38906 0.273
NP_442281.1_1 Reverse -194 -208 20.7467 0.00192
NP_442281.1_1 Forward -213 -199 8.3571 0.0823
NP_441079.1_7 Reverse -38 -57 -0.886293 0.2
NP_442575.1_8 Reverse -241 -260 -2.75381 0.242
NP_442256.1_2 Reverse -197 -215 -5.38906 0.214
NP_001035871.2_7 Reverse -318 -328 12.0747 0.272
NP_440437.1_1 Reverse -193 -212 2.45773 0.133
NP_441457.1_7 Reverse -155 -174 2.45773 0.255
NP_441556.1_4 Reverse -187 -206 18.2961 0.109
NP_441556.1_4 Reverse -190 -209 13.1865 0.201
NP_441556.1_4 Forward -348 -329 10.4871 0.279
NP_441556.1_10 Forward -213 -199 18.2034 0.0841
NP_440498.1_1 Reverse -190 -208 4.83737 0.114
NP_440498.1_1 Forward -217 -199 -0.570838 0.218
NP_441644.1_6 Reverse -199 -209 17.3841 0.00127
NP_441644.1_6 Forward -208 -198 10.1076 0.0628
NP_441644.1_6 Reverse -330 -340 7.0594 0.137
NP_441644.1_6 Forward -166 -156 4.69947 0.228
NP_442501.1_2 Reverse -328 -347 -0.000545616 0.222
NP_442215.1_2 Reverse -197 -213 5.17175 0.0796
NP_442215.1_2 Forward -210 -194 -2.00642 0.191
NP_440253.1_2 Forward -208 -190 18.407 0.00894
NP_440929.1_8 Forward -208 -199 19.2726 0.000701
NP_440929.1_8 Reverse -199 -208 19.2726 0.000701
NP_440929.1_8 Forward -377 -368 5.40793 0.138
NP_442933.1_3 Reverse -39 -58 15.6125 0.267
NP_442933.1_10 Forward -208 -199 17.601 0.00325
NP_442933.1_10 Reverse -199 -208 17.601 0.00325
NP_442933.1_10 Reverse -174 -183 8.1612 0.0885
NP_441751.2_8 Reverse -175 -189 1.57289 0.103
NP_441751.2_8 Forward -207 -193 -2.55701 0.132
NP_439922.1_3 Reverse -133 -152 11.3154 0.198
NP_442554.1_8 Reverse -200 -210 15.3197 0.00882
NP_442554.1_8 Forward -207 -197 13.8447 0.0145
NP_441762.1_7 Reverse -198 -210 9.57708 0.0142
NP_441762.1_7 Forward -209 -197 2.89058 0.0676
NP_442142.1_4 Reverse -196 -209 15.85 0.0264
NP_442142.1_4 Forward -211 -198 5.62358 0.187
NP_442142.1_4 Forward -186 -173 2.57534 0.286
NP_442142.1_9 Forward -206 -187 7.07928 0.254
NP_442292.1_1 Reverse -200 -209 18.486 0.00229
NP_442292.1_1 Forward -207 -198 9.63616 0.0183
NP_441024.1_5 Reverse -43 -62 17.3048 0.123
NP_442476.1_6 Reverse -200 -214 5.80112 0.131
NP_443009.1_5 Forward -209 -198 18.3477 0.00265
NP_443009.1_5 Forward -184 -173 3.40144 0.296
NP_442301.1_2 Reverse -189 -208 4.42355 0.279
NP_442408.2_1 Forward -208 -189 -0.197208 0.205
NP_442408.2_1 Forward -331 -312 -7.37537 0.299
NP_441715.1_4 Forward -207 -197 16.303 0.0117
NP_441715.1_4 Reverse -200 -210 7.94484 0.107
NP_440357.1_3 Reverse -197 -216 4.03102 0.242
NP_440158.1_8 Reverse -243 -262 11.4058 0.249
NP_442076.1_5 Reverse -89 -108 9.3409 0.209
NP_440183.1_9 Reverse -332 -351 -21.0434 0.296
NP_440379.1_5 Forward -208 -189 -9.63698 0.264
NP_440464.1_10 Reverse -200 -210 13.0082 0.169
NP_441468.1_1 Forward -207 -200 15.8704 0.0124
NP_441468.1_1 Reverse -200 -207 15.8704 0.0124
NP_441020.2_6 Forward -210 -193 14.8868 0.0469
NP_441015.1_10 Reverse -155 -174 -6.29373 0.245
NP_441673.1_1 Forward -208 -199 20.8459 0.000698
NP_441673.1_1 Reverse -199 -208 20.8459 0.000698
NP_441673.1_1 Reverse -368 -377 -7.86675 0.187
NP_441673.1_1 Forward -377 -368 -7.96508 0.206
NP_441826.1_2 Reverse -193 -207 1.27789 0.157
NP_441826.1_2 Forward -214 -200 -4.03198 0.291
NP_441637.1_9 Forward -232 -214 -1.45582 0.292
NP_442490.1_1 Reverse -298 -317 17.5024 0.218
NP_442490.1_9 Forward -220 -201 -6.58872 0.273
NP_442868.1_6 Forward -210 -200 9.81313 0.038
NP_442868.1_6 Reverse -197 -207 0.963343 0.205
NP_441056.1_1 Forward -208 -189 -3.04881 0.224
NP_442677.1_7 Reverse -183 -193 17.8763 0.237
NP_441612.1_2 Reverse -199 -209 8.54929 0.21
NP_442361.1_3 Reverse -193 -206 7.88576 0.285
NP_442808.1_1 Reverse -198 -208 18.4657 0.00201
NP_442808.1_1 Forward -209 -199 8.63269 0.0481
NP_442808.1_1 Reverse -183 -193 5.28945 0.162
NP_440568.1_4 Forward -150 -131 6.88182 0.159
NP_442542.1_2 Reverse -164 -177 8.47575 0.154
NP_442542.1_9 Reverse -192 -206 10.717 0.111
NP_442542.1_9 Forward -215 -201 4.91554 0.28
NP_442542.1_9 Forward -248 -234 4.52221 0.294
NP_442050.1_5 Reverse -197 -207 9.12434 0.193
NP_442050.1_5 Forward -210 -200 7.64939 0.243
NP_442342.1_9 Reverse -322 -338 4.28677 0.25
NP_441114.1_3 Reverse -332 -341 17.1093 0.113
NP_440558.1_2 Reverse -108 -127 -5.21209 0.254
NP_441518.1_3 Reverse -189 -208 13.9625 0.0309
NP_441878.1_6 Forward -332 -322 10.4031 0.0176
NP_441878.1_6 Forward -209 -199 10.4031 0.0176
NP_441878.1_6 Reverse -198 -208 10.4031 0.0176
NP_441878.1_6 Reverse -321 -331 2.53664 0.0363
NP_441878.1_6 Reverse -173 -183 1.55333 0.0937
NP_441878.1_6 Forward -184 -174 -0.216628 0.169
NP_441878.1_6 Forward -340 -330 -7.39479 0.222
NP_441878.1_6 Forward -176 -166 -7.88644 0.278
NP_441036.1_8 Reverse -198 -208 17.7779 0.000554
NP_441036.1_8 Reverse -367 -377 11.3864 0.123
NP_441036.1_8 Forward -209 -199 8.33817 0.174
NP_441557.1_5 Forward -208 -199 19.9609 0.000699
NP_441557.1_5 Reverse -199 -208 19.9609 0.000699
NP_441445.1_1 Reverse -190 -209 3.73603 0.208
NP_441445.1_1 Forward -217 -198 2.0644 0.243
NP_441445.1_8 Reverse -233 -252 -11.5053 0.277
NP_441308.1_8 Reverse -197 -207 10.1081 0.22
NP_442183.1_1 Forward -208 -194 19.4691 0.00583
NP_441870.1_7 Forward -358 -339 13.5691 0.291
NP_441574.1_1 Forward -220 -201 -4.81876 0.254
NP_441238.1_10 Forward -324 -310 14.4542 0.236
NP_442347.1_2 Reverse -200 -209 12.4878 0.056
NP_442347.1_2 Forward -207 -198 11.1111 0.056
NP_442347.1_2 Forward -266 -257 4.42462 0.284
NP_442645.1_2 Forward -216 -197 -21.83 0.29
NP_442645.1_9 Forward -187 -168 18.1907 0.108
NP_441037.1_4 Reverse -245 -255 8.6821 0.237
NP_441037.1_4 Forward -210 -200 7.9999 0.237
NP_441037.1_4 Forward -222 -212 7.70752 0.237
NP_441037.1_4 Reverse -197 -207 7.02532 0.237
NP_441633.1_3 Forward -210 -197 8.47575 0.0377
NP_441633.1_3 Forward -41 -28 0.510939 0.122
NP_441633.1_3 Reverse -197 -210 -3.71729 0.177
NP_440136.1_2 Forward -207 -200 15.9687 0.0123
NP_440136.1_2 Reverse -200 -207 15.9687 0.0123
NP_442590.1_9 Reverse -329 -348 4.62101 0.273
NP_442590.1_10 Reverse -240 -259 7.96426 0.216
NP_442590.1_10 Reverse -167 -186 6.78429 0.237
NP_442998.1_5 Forward -313 -303 13.8447 0.157
NP_442998.1_5 Forward -49 -39 9.51814 0.238
NP_442998.1_10 Forward -206 -199 15.5754 0.0102
NP_442998.1_10 Reverse -201 -208 15.5754 0.0102
NP_440899.1_2 Reverse -188 -207 6.1935 0.269
NP_440299.1_1 Forward -212 -199 10.2451 0.058
NP_440299.1_1 Forward -187 -174 6.90188 0.127
NP_440299.1_1 Reverse -195 -208 2.28034 0.292
NP_441799.1_1 Forward -212 -198 22.1234 0.00284
NP_441799.1_1 Reverse -195 -209 8.75042 0.106
NP_440977.1_5 Forward -55 -42 17.1282 0.141
NP_442802.1_2 Reverse -183 -202 17.1082 0.203
NP_441007.1_5 Reverse -331 -350 11.4058 0.214
NP_441007.1_10 Forward -213 -200 8.86907 0.108
NP_442334.1_2 Forward -193 -176 -5.46769 0.205
NP_442334.1_2 Forward -315 -298 -14.0225 0.297
NP_440256.1_1 Forward -211 -192 13.7658 0.00982
NP_440256.1_1 Forward -380 -361 -1.37718 0.103
NP_440256.1_1 Reverse -196 -215 -8.26035 0.256
NP_442961.1_1 Reverse -135 -152 17.747 0.268
NP_440456.1_9 Forward -374 -355 11.2092 0.145
NP_441559.1_8 Reverse -107 -121 -6.78525 0.279
NP_441559.1_8 Reverse -363 -377 -7.17857 0.287
NP_440915.1_5 Forward -210 -191 15.3958 0.28
NP_440915.1_6 Forward -343 -329 -1.67204 0.243
NP_440915.1_6 Reverse -170 -184 -2.16369 0.26
NP_440915.1_6 Reverse -195 -209 -3.147 0.29
NP_441296.1_7 Reverse -162 -181 12.5858 0.29
NP_440717.1_3 Forward -36 -22 8.55376 0.264
NP_442785.1_7 Forward -379 -365 11.2093 0.228
NP_442785.1_7 Reverse -197 -211 10.7177 0.228
NP_441704.1_8 Forward -219 -200 9.53674 0.179
NP_442031.1_5 Forward -222 -203 9.3409 0.185
NP_440306.1_8 Reverse -54 -73 0.981987 0.204
NP_440695.1_5 Forward -220 -201 -2.26216 0.298
NP_441939.1_3 Reverse -200 -219 7.47261 0.201
NP_442993.1_1 Forward -208 -192 1.73016 0.0502
NP_440677.1_1 Forward -217 -198 9.14423 0.187
NP_442386.1_9 Reverse -198 -207 15.7322 0.0144
NP_442386.1_9 Forward -209 -200 13.8639 0.0289
NP_441340.1_5 Forward -207 -200 15.6737 0.0124
NP_441340.1_5 Reverse -200 -207 15.6737 0.0124
NP_441340.1_9 Forward -50 -40 9.12288 0.236
NP_441947.1_4 Reverse -188 -207 10.5209 0.296
NP_442484.1_2 Forward -219 -200 7.57094 0.15
NP_440168.1_9 Forward -210 -191 -5.60541 0.296
NP_440327.1_6 Forward -205 -186 3.93269 0.276
NP_442506.1_2 Forward -219 -200 13.5691 0.125
NP_440586.1_8 Forward -207 -200 13.2151 0.026
NP_440586.1_8 Reverse -200 -207 13.2151 0.026
NP_442251.1_6 Forward -207 -200 15.2804 0.0124
NP_442251.1_6 Reverse -200 -207 15.2804 0.0124
NP_442959.1_5 Forward -58 -39 11.2092 0.224
NP_440684.1_9 Reverse -193 -207 8.94771 0.221
NP_441262.1_3 Reverse -199 -206 14.7888 0.0223
NP_441262.1_3 Forward -208 -201 14.7888 0.0223
NP_440027.1_3 Forward -182 -164 3.65664 0.267
NP_443051.1_1 Reverse -198 -207 10.4228 0.00754
NP_443051.1_1 Forward -209 -200 10.4228 0.00754
NP_443051.1_5 Forward -56 -37 5.89931 0.256
NP_441232.1_10 Forward -219 -200 4.03102 0.208
NP_439937.1_9 Forward -377 -360 -12.8431 0.276
NP_439937.1_9 Reverse -302 -319 -15.8914 0.287
NP_439937.1_9 Reverse -180 -197 -16.678 0.287
NP_440408.1_7 Reverse -199 -218 14.4541 0.165
NP_440626.1_1 Reverse -200 -219 11.7983 0.204
NP_440439.1_1 Forward -211 -198 2.57589 0.131
NP_440439.1_1 Reverse -196 -209 1.19926 0.159
NP_440439.1_1 Reverse -365 -378 1.00259 0.164
NP_441522.1_2 Reverse -192 -210 11.6222 0.187
NP_440372.1_2 Forward -207 -200 16.3621 0.0124
NP_440372.1_2 Reverse -200 -207 16.3621 0.0124
NP_441138.1_5 Forward -17 -4 9.61097 0.238
NP_441181.1_6 Forward -207 -189 6.11567 0.219
NP_440819.1_5 Forward -50 -42 8.08256 0.185
NP_440316.1_10 Forward -340 -330 16.9913 0.153
NP_441803.1_2 Reverse -194 -213 0.884433 0.243
NP_440139.1_1 Reverse -193 -212 3.9319 0.194
NP_441572.1_1 Forward -210 -191 -1.18052 0.212
NP_440267.1_2 Reverse -194 -208 9.43874 0.156
NP_442384.1_10 Reverse -199 -212 17.1289 0.00642
NP_441018.1_7 Forward -212 -193 7.96426 0.259
NP_442262.1_10 Forward -207 -200 14.1988 0.0123
NP_442262.1_10 Reverse -200 -207 14.1988 0.0123
NP_442262.1_10 Reverse -331 -338 8.8889 0.219
NP_441689.1_5 Reverse -197 -207 8.53436 0.132
NP_441689.1_5 Forward -210 -200 5.78111 0.197
NP_440163.1_10 Reverse -196 -206 15.2213 0.0762
NP_440344.1_10 Reverse -192 -209 16.9518 0.00338
NP_440344.1_10 Forward -215 -198 -12.7442 0.264
NP_440282.1_10 Forward -218 -199 -3.44213 0.239
NP_440282.1_10 Reverse -312 -331 -9.93197 0.29
NP_440531.1_6 Forward -216 -197 9.3409 0.0783
NP_440531.1_6 Reverse -191 -210 0.491109 0.191
NP_442123.1_3 Forward -208 -189 15.3391 0.123
NP_442910.1_7 Forward -192 -173 -6.49039 0.21
NP_441335.1_8 Forward -350 -331 8.06259 0.264
NP_441965.1_7 Reverse -330 -349 18.8781 0.153
NP_441965.1_10 Reverse -196 -212 18.2498 0.0308
NP_440297.1_9 Forward -207 -197 9.32148 0.0917
NP_440297.1_9 Forward -330 -320 1.06167 0.282
NP_440297.1_9 Reverse -200 -210 -0.118297 0.282
NP_441896.1_3 Forward -217 -198 -1.47551 0.26
NP_440990.1_8 Forward -333 -314 17.7974 0.216
NP_440999.1_9 Reverse -195 -209 4.62115 0.116
NP_440999.1_9 Reverse -107 -121 -2.45868 0.27
NP_440888.1_2 Forward -208 -194 14.5519 0.0168
NP_440888.1_2 Reverse -199 -213 9.04542 0.139
NP_442892.1_9 Forward -22 -8 14.8469 0.293
NP_440600.1_4 Forward -216 -198 -5.58572 0.28
NP_440179.1_6 Reverse -200 -219 3.04771 0.286
NP_440491.1_1 Reverse -286 -305 9.64582 0.206
NP_440491.1_1 Reverse -196 -215 9.25599 0.218
NP_440575.1_1 Forward -44 -25 -3.34455 0.294
NP_440575.1_1 Forward -45 -26 -3.73788 0.299
NP_441759.1_2 Reverse -191 -210 3.93269 0.166
NP_441543.1_2 Forward -207 -198 18.486 0.00236
NP_441543.1_2 Reverse -200 -209 16.9127 0.00359
NP_442845.1_2 Forward -214 -200 7.66941 0.195
NP_441551.1_5 Reverse -364 -380 5.95771 0.291
NP_442710.1_7 Forward -57 -38 -4.82 0.272
NP_441469.1_8 Reverse -198 -207 16.126 0.00797
NP_441469.1_8 Forward -209 -200 6.48957 0.227
NP_443064.1_6 Reverse -199 -209 12.5669 0.0796
NP_442578.1_7 Forward -207 -200 14.5921 0.026
NP_442578.1_7 Reverse -200 -207 14.5921 0.026
NP_440148.1_6 Reverse -136 -150 16.6434 0.255
NP_441462.1_2 Forward -208 -198 11.5831 0.00406
NP_441462.1_2 Reverse -199 -209 11.5831 0.00406
NP_441621.1_7 Reverse -188 -202 -4.7203 0.242
NP_441929.1_3 Forward -47 -28 15.5357 0.0716
NP_443062.1_1 Forward -208 -190 12.1537 0.0851
NP_443062.1_6 Forward -216 -197 8.94757 0.135
NP_440936.1_1 Reverse -134 -153 14.6508 0.12
NP_442204.1_6 Forward -199 -180 5.99764 0.269
NP_442872.1_1 Reverse -182 -201 0.294447 0.184
NP_440516.1_8 Forward -208 -199 16.9127 0.00442
NP_440516.1_8 Reverse -199 -208 16.9127 0.00442
NP_440516.1_8 Forward -339 -330 -0.491928 0.262
NP_441785.1_1 Forward -208 -194 14.3866 0.161
NP_441033.1_2 Reverse -189 -208 -10.3253 0.293
NP_442428.1_5 Forward -207 -200 15.8704 0.0124
NP_442428.1_5 Reverse -200 -207 15.8704 0.0124
NP_440673.1_2 Forward -218 -199 10.7798 0.198
NP_440673.1_2 Forward -121 -102 8.63366 0.264
NP_440673.1_3 Forward -206 -199 12.4288 0.0426
NP_440673.1_3 Reverse -201 -208 12.4288 0.0426
NP_440673.1_3 Reverse -332 -339 8.98723 0.203
NP_440673.1_3 Forward -109 -102 6.92228 0.277
NP_441714.1_3 Forward -215 -197 16.0463 0.138
NP_441052.1_2 Reverse -199 -209 19.9412 0.00106
NP_441052.1_2 Forward -208 -198 10.5014 0.0285
NP_442219.1_9 Reverse -200 -209 17.7976 0.00718
NP_442219.1_9 Forward -207 -198 8.35786 0.0681
NP_440436.1_4 Forward -207 -198 18.1905 0.00233
NP_440436.1_4 Reverse -200 -209 17.2072 0.00233
NP_441884.1_9 Reverse -196 -215 14.4541 0.0078
NP_441893.1_10 Reverse -184 -203 9.43923 0.289
NP_441719.1_4 Forward -207 -200 16.3621 0.0124
NP_441719.1_4 Reverse -200 -207 16.3621 0.0124
NP_441004.1_4 Forward -342 -332 15.8113 0.154
NP_441004.1_5 Forward -74 -60 9.93102 0.248
NP_441004.1_5 Forward -343 -329 6.6861 0.298
NP_442813.1_4 Forward -331 -312 -8.85033 0.299
NP_442366.1_3 Forward -209 -191 -3.42244 0.247
NP_442366.1_5 Forward -211 -201 17.2858 0.0141
NP_440129.1_10 Reverse -192 -206 3.73617 0.189
NP_440296.1_10 Reverse -196 -215 -4.81876 0.213
NP_441115.1_4 Reverse -57 -75 7.88485 0.269
NP_443054.1_2 Forward -210 -196 3.24451 0.24
NP_443054.1_2 Reverse -320 -334 1.96621 0.245
NP_443054.1_2 Reverse -197 -211 1.76955 0.245
NP_443054.1_2 Forward -72 -58 -0.590395 0.299
NP_441851.1_10 Reverse -198 -208 16.008 0.00552
NP_441851.1_10 Forward -209 -199 15.8113 0.00552
NP_442814.1_10 Reverse -340 -359 3.73603 0.269
NP_442622.1_1 Forward -209 -190 -1.7705 0.177
NP_442622.1_8 Forward -208 -190 -19.1554 0.296
NP_441501.1_1 Forward -261 -242 28.8095 0.000426
NP_441501.1_2 Forward -204 -185 15.9291 0.208
NP_441501.1_4 Forward -225 -206 18.3873 0.148
NP_441501.1_5 Forward -381 -362 22.713 0.0569
NP_441501.1_6 Forward -341 -322 14.2574 0.272
NP_442856.1_7 Reverse -190 -209 -5.01543 0.27
NP_441668.1_4 Reverse -260 -279 0.294447 0.244
NP_442515.1_1 Forward -209 -195 2.75286 0.13
NP_442515.1_1 Reverse -198 -212 2.35953 0.137
NP_442515.1_1 Reverse -321 -335 -3.147 0.287
NP_441046.1_2 Reverse -152 -171 1.17943 0.26
NP_442689.1_8 Forward -66 -49 -5.36936 0.271
NP_442689.1_8 Reverse -41 -58 -7.72931 0.292
NP_441409.1_6 Forward -214 -195 -9.63698 0.189
NP_442314.1_1 Forward -350 -332 1.88744 0.231
NP_440432.1_9 Forward -207 -192 9.61633 0.0419
NP_440432.1_9 Reverse -167 -182 0.0782283 0.16
NP_440432.1_9 Forward -330 -315 -2.77337 0.175
NP_442843.1_1 Reverse -103 -122 -9.047 0.264
NP_442843.1_1 Forward -207 -188 -10.1286 0.276
NP_439960.1_10 Forward -218 -200 -3.22577 0.269
NP_440474.1_8 Forward -207 -193 14.7486 0.0595
NP_442450.1_5 Reverse -197 -207 9.32148 0.115
NP_442450.1_5 Forward -210 -200 7.55152 0.13
NP_440588.1_2 Forward -217 -198 -1.27885 0.155
NP_440588.1_2 Forward -195 -176 -3.3438 0.185
NP_440195.1_5 Reverse -324 -343 7.7676 0.175
NP_442006.1_2 Reverse -190 -207 -8.22096 0.192
NP_442006.1_2 Forward -348 -331 -10.1876 0.197
NP_441570.1_1 Forward -208 -190 9.75391 0.0103
NP_441570.1_1 Reverse -199 -217 -7.45401 0.0895
NP_441570.1_1 Forward -331 -313 -9.61729 0.142
NP_441078.1_4 Forward -208 -199 19.6659 0.0007
NP_441078.1_4 Reverse -199 -208 19.6659 0.0007
NP_441078.1_4 Reverse -322 -331 6.39124 0.0775
NP_441078.1_4 Forward -331 -322 -1.77023 0.266
NP_442388.1_4 Reverse -101 -120 10.6184 0.26
NP_442348.1_2 Forward -235 -226 14.356 0.159
NP_440526.1_3 Forward -207 -196 1.92649 0.267
NP_440526.1_3 Reverse -200 -211 0.943182 0.267
NP_441432.1_8 Forward -209 -200 16.8143 0.00595
NP_441432.1_8 Reverse -198 -207 8.25953 0.0755
NP_441432.1_8 Forward -340 -331 3.83464 0.243
NP_441432.1_9 Forward -93 -80 9.66489 0.269
NP_442320.1_8 Reverse -193 -207 12.8809 0.016
NP_441732.1_2 Reverse -195 -211 -6.7263 0.0495
NP_441732.1_2 Forward -212 -196 -17.4444 0.258
NP_442447.1_6 Reverse -112 -126 17.3348 0.228
NP_442003.1_4 Reverse -200 -219 10.8159 0.288
NP_440760.1_7 Forward -46 -27 9.24175 0.172
NP_442797.1_1 Reverse -331 -350 3.34271 0.203
NP_441131.1_5 Forward -340 -321 1.47442 0.263
NP_440199.1_10 Reverse -196 -206 14.533 0.0861
NP_440461.1_3 Forward -194 -175 14.1591 0.297
NP_441057.1_4 Forward -203 -185 3.26407 0.244
NP_442400.1_1 Forward -211 -192 -6.09707 0.299
NP_442400.1_10 Forward -56 -43 11.9983 0.222
NP_442489.1_7 Forward -208 -199 20.1576 0.000695
NP_442489.1_7 Reverse -199 -208 20.1576 0.000695
NP_442489.1_7 Reverse -174 -183 5.21127 0.077
NP_442489.1_7 Reverse -322 -331 -1.37691 0.195
NP_442079.1_7 Forward -207 -188 4.12936 0.198
NP_440559.1_1 Reverse -200 -209 17.4043 0.00658
NP_440559.1_1 Forward -207 -198 8.75118 0.0586
NP_441659.2_8 Reverse -199 -209 18.1713 0.00133
NP_441659.2_8 Forward -208 -198 11.9764 0.0147
NP_441659.2_8 Forward -175 -165 1.25834 0.245
NP_441022.1_1 Reverse -36 -45 15.9587 0.163
NP_440363.1_9 Reverse -322 -340 12.6055 0.265
NP_442913.1_10 Reverse -190 -209 -5.40875 0.264
NP_441040.1_2 Forward -210 -191 -15.5368 0.286
NP_441040.1_2 Reverse -165 -184 -16.0285 0.292
NP_441968.1_1 Forward -50 -42 14.1787 0.286
NP_442008.1_2 Forward -380 -361 6.4893 0.219
NP_440779.1_5 Forward -208 -191 -5.95935 0.157
NP_442346.1_5 Forward -209 -199 16.6963 0.00248
NP_442346.1_5 Reverse -198 -208 9.02648 0.118
NP_442346.1_5 Reverse -246 -256 7.74818 0.159
NP_442346.1_5 Reverse -173 -183 5.97822 0.219
NP_442346.1_10 Forward -210 -191 -1.67217 0.294
NP_440545.1_3 Forward -187 -170 -5.66436 0.256
NP_440545.1_3 Forward -212 -195 -6.05768 0.268
NP_440545.1_3 Forward -192 -175 -7.04099 0.295
NP_440545.1_5 Forward -344 -327 4.95539 0.244
NP_441856.1_3 Reverse -196 -215 -3.24547 0.279
NP_440025.1_1 Forward -212 -193 12.9791 0.147
NP_440831.1_3 Reverse -183 -202 6.9696 0.268
NP_440010.1_10 Forward -343 -324 12.6841 0.19
NP_442603.1_7 Reverse -199 -213 11.2087 0.119
NP_441888.1_7 Reverse -194 -208 2.35953 0.225
NP_441050.1_3 Reverse -103 -117 15.6342 0.289
NP_441948.1_4 Forward -215 -197 0.117479 0.136
NP_441948.1_4 Reverse -192 -210 -2.14413 0.16
NP_441833.1_4 Forward -207 -200 15.9687 0.0124
NP_441833.1_4 Reverse -200 -207 15.9687 0.0124
NP_442162.1_9 Forward -207 -200 16.2637 0.0124
NP_442162.1_9 Reverse -200 -207 16.2637 0.0124
NP_440671.1_4 Reverse -193 -207 8.55439 0.195
NP_440224.1_1 Forward -219 -200 3.83436 0.132
NP_442943.1_1 Forward -55 -40 3.48843 0.267
NP_440772.1_8 Reverse -193 -212 8.65258 0.258
NP_442199.1_5 Reverse -191 -210 -4.91709 0.233
NP_442140.1_3 Reverse -200 -210 12.2714 0.0632
NP_442140.1_3 Forward -207 -197 8.33817 0.119
NP_440875.1_9 Forward -206 -196 8.37203 0.233
NP_441813.1_5 Reverse -197 -207 17.188 0.00979
NP_441813.1_5 Forward -210 -200 8.63316 0.0367
NP_440590.1_4 Reverse -200 -213 9.75405 0.0335
NP_440590.1_4 Forward -207 -194 -3.81562 0.255
NP_440567.1_1 Reverse -200 -214 14.1593 0.019
NP_440567.1_1 Forward -207 -193 5.80112 0.0959
NP_442497.1_10 Forward -207 -198 10.4228 0.0087
NP_442497.1_10 Reverse -200 -209 10.4228 0.0087
NP_440821.1_4 Reverse -197 -207 19.0562 0.00399
NP_440821.1_4 Forward -210 -200 9.41981 0.0286
NP_440227.1_2 Forward -57 -41 8.22001 0.29
NP_441239.1_9 Reverse -197 -209 13.3137 0.037
NP_441239.1_9 Forward -333 -321 8.6921 0.125
NP_441239.1_9 Reverse -328 -340 8.00379 0.145
NP_441239.1_9 Forward -210 -198 5.93884 0.202
NP_441239.1_9 Forward -177 -165 3.2839 0.289
NP_440156.1_4 Reverse -38 -48 11.6809 0.176
NP_440706.1_1 Forward -212 -193 -4.81876 0.262
NP_441892.1_1 Reverse -190 -207 -1.73112 0.212
NP_441892.1_1 Reverse -313 -330 -3.00942 0.231
NP_441892.1_1 Forward -192 -175 -5.95935 0.294
NP_440665.1_1 Forward -205 -186 -14.4552 0.262
NP_442325.1_3 Reverse -101 -111 18.3674 0.273
NP_442270.1_9 Forward -219 -200 -8.85033 0.226
NP_441017.1_6 Reverse -195 -209 12.487 0.217
NP_440833.1_6 Reverse -109 -123 7.86545 0.278
NP_441526.1_8 Forward -202 -183 -3.14714 0.277
NP_440949.1_7 Reverse -191 -210 10.1267 0.246
NP_440354.1_7 Forward -214 -196 6.01734 0.294
NP_442138.1_10 Forward -208 -189 2.3594 0.12
NP_442052.1_7 Forward -198 -184 16.4209 0.16
NP_440546.1_4 Forward -208 -198 11.8882 0.0679
NP_440546.1_4 Reverse -199 -209 10.046 0.109
NP_440462.1_6 Reverse -197 -207 15.418 0.0142
NP_440462.1_6 Forward -210 -200 1.35667 0.294
NP_440868.1_4 Forward -212 -200 17.7386 0.0124
NP_440868.1_4 Reverse -195 -207 8.49544 0.0602
NP_440868.1_4 Reverse -166 -178 -0.354346 0.263
NP_441497.1_3 Reverse -101 -120 -8.65367 0.294
NP_442479.1_9 Reverse -37 -56 -11.4069 0.275
NP_441474.1_1 Reverse -189 -208 7.27514 0.212
NP_442402.1_4 Reverse -54 -73 -9.73604 0.292
NP_442402.1_4 Reverse -135 -154 -9.9327 0.295
NP_441848.1_4 Forward -55 -39 14.6171 0.164
NP_442039.1_4 Forward -207 -200 15.1821 0.0124
NP_442039.1_4 Reverse -200 -207 15.1821 0.0124
NP_441811.1_8 Forward -214 -200 5.60446 0.294
NP_442679.1_1 Reverse -3 -22 -4.72043 0.283
NP_440825.1_6 Forward -349 -330 7.27595 0.285
NP_440825.1_7 Reverse -200 -210 12.9096 0.152
NP_442696.1_2 Forward -209 -191 13.3922 0.129
NP_442837.1_3 Forward -207 -200 15.7721 0.0124
NP_442837.1_3 Reverse -200 -207 15.7721 0.0124
NP_440160.1_3 Reverse -187 -206 11.11 0.209
NP_442053.1_1 Forward -208 -199 18.3876 0.0007
NP_442053.1_1 Reverse -199 -208 18.3876 0.0007
NP_442053.1_1 Reverse -368 -377 4.32629 0.254
NP_440505.1_3 Reverse -197 -207 13.8447 0.0247
NP_440505.1_3 Forward -210 -200 9.22315 0.122
NP_441252.1_6 Forward -342 -335 14.3954 0.168
NP_441252.1_6 Forward -73 -66 11.6422 0.288
NP_440914.1_1 Reverse -199 -209 17.5935 0.000537
NP_440914.1_1 Forward -208 -198 8.6151 0.186
NP_441011.1_8 Forward -207 -198 16.9127 0.00602
NP_441011.1_8 Reverse -200 -209 8.25953 0.144
NP_442533.1_1 Reverse -15 -34 -16.2252 0.263
NP_442533.1_6 Forward -208 -199 17.2076 0.00137
NP_442533.1_6 Reverse -199 -208 17.2076 0.00137
NP_442533.1_6 Reverse -322 -331 4.91628 0.165
NP_442533.1_6 Reverse -166 -175 3.04799 0.228
NP_442232.1_3 Forward -191 -172 -15.3402 0.291
NP_442322.1_4 Forward -379 -362 -9.69657 0.296
NP_442229.1_1 Forward -210 -196 8.25877 0.184
NP_443016.1_1 Forward -345 -326 -7.57203 0.277
NP_441482.1_7 Reverse -193 -207 -10.9151 0.222
NP_439944.1_9 Reverse -200 -210 10.5014 0.0887
NP_439944.1_9 Forward -207 -197 10.3048 0.0887
NP_440816.1_7 Forward -187 -168 10.8159 0.218
NP_441028.1_6 Reverse -116 -126 5.68278 0.243
NP_440115.1_6 Forward -211 -201 8.33817 0.13
NP_440115.1_6 Reverse -27 -37 5.68323 0.227
NP_439965.1_7 Forward -206 -187 10.125 0.294
NP_440608.1_6 Reverse -200 -219 6.48849 0.238
NP_440572.1_5 Forward -157 -138 12.7825 0.235
NP_441170.1_4 Forward -217 -199 4.83737 0.232
NP_441972.1_5 Reverse -200 -219 6.88262 0.0823
NP_441106.1_1 Reverse -198 -207 18.191 0.0028
NP_441106.1_1 Forward -209 -200 9.63616 0.0311
NP_440429.1_9 Forward -331 -312 0.0977854 0.297
NP_439903.1_6 Reverse -196 -215 -0.492971 0.282
NP_442306.1_10 Forward -213 -194 -20.2567 0.202
NP_440797.1_2 Reverse -188 -207 11.9854 0.284
NP_441286.1_1 Forward -209 -197 14.4936 0.00418
NP_441286.1_1 Reverse -198 -210 3.38223 0.0467
NP_441286.1_1 Forward -40 -28 -6.5492 0.267
NP_440670.1_8 Forward -208 -199 18.3876 0.000699
NP_440670.1_8 Reverse -199 -208 18.3876 0.000699
NP_441930.1_2 Forward -340 -330 14.828 0.19
NP_441930.1_3 Reverse -37 -56 6.23263 0.263
NP_440886.1_7 Reverse -198 -208 17.7774 0.0011
NP_440886.1_7 Forward -209 -199 7.94438 0.0805
NP_440886.1_7 Reverse -183 -193 5.48612 0.181
NP_440083.1_9 Forward -52 -33 15.8987 0.278
NP_442614.1_2 Reverse -199 -213 15.3392 0.0773
NP_441753.1_10 Reverse -190 -209 5.211 0.186
NP_441403.1_4 Forward -353 -335 5.32902 0.299
NP_442022.1_4 Forward -202 -183 9.0459 0.264
NP_440907.2_8 Forward -207 -197 7.84605 0.117
NP_440907.2_8 Reverse -200 -210 7.64939 0.117
NP_441021.1_1 Reverse -200 -219 -8.35868 0.195
NP_441021.1_2 Reverse -178 -197 3.93269 0.291
NP_441021.1_8 Reverse -194 -212 8.08229 0.181
NP_441021.1_8 Forward -213 -195 4.14905 0.225
NP_440841.1_4 Reverse -20 -39 -0.787193 0.142
NP_441463.1_3 Reverse -189 -208 9.93088 0.0481
NP_442842.1_10 Forward -26 -7 1.43621 0.254
NP_441626.1_2 Forward -207 -200 15.7721 0.0124
NP_441626.1_2 Reverse -200 -207 15.7721 0.0124
NP_442365.1_5 Reverse -175 -194 10.7175 0.183
NP_442365.1_7 Forward -212 -193 -0.000545616 0.177
NP_442794.1_1 Forward -212 -200 2.59558 0.287
NP_442794.1_6 Reverse -310 -324 15.2409 0.178
NP_442615.1_1 Forward -217 -199 5.42735 0.0386
NP_440387.1_1 Reverse -199 -215 3.50012 0.0568
NP_440387.1_1 Forward -208 -192 -1.12144 0.142
NP_440387.1_3 Reverse -186 -200 16.3225 0.228
NP_441431.1_2 Reverse -327 -341 12.2903 0.123
NP_441431.1_2 Reverse -196 -210 9.24208 0.19
NP_442224.1_1 Reverse -182 -201 13.8641 0.0895
NP_440114.1_10 Forward -208 -194 15.7325 0.0234
NP_440114.1_10 Forward -339 -325 8.06273 0.217
NP_440114.1_10 Reverse -199 -213 7.37441 0.236
NP_440492.1_8 Reverse -2 -21 16.9115 0.21
NP_441510.2_6 Reverse -189 -208 13.7649 0.233
NP_441510.2_7 Reverse -193 -207 12.3887 0.28
NP_439988.1_3 Forward -343 -329 7.27608 0.277
NP_441237.1_9 Reverse -200 -210 14.828 0.0242
NP_442930.1_1 Reverse -37 -47 12.1726 0.239
NP_442930.1_1 Reverse -38 -48 11.4843 0.258
NP_439910.1_2 Reverse -191 -208 -11.7609 0.0788
NP_442867.1_8 Reverse -332 -351 11.9958 0.197
NP_440457.1_1 Forward -343 -331 0.628964 0.25
NP_440457.1_1 Reverse -162 -174 0.137309 0.25
NP_440457.1_1 Reverse -195 -207 0.0389777 0.25
NP_440457.1_1 Reverse -26 -38 0.0389777 0.25
NP_440457.1_1 Reverse -170 -182 -0.74767 0.273
NP_440457.1_1 Forward -187 -175 -0.846001 0.278
NP_442940.1_2 Reverse -199 -218 -0.983855 0.296
NP_440798.1_1 Reverse -37 -55 13.1509 0.294
NP_440798.1_6 Reverse -200 -213 6.60746 0.14
NP_441436.1_2 Reverse -15 -34 -5.40875 0.294
NP_442509.1_5 Forward -180 -163 20.2942 0.0487
NP_442509.1_9 Forward -208 -198 16.2041 0.00739
NP_442509.1_9 Reverse -199 -209 8.14104 0.192
NP_440524.1_2 Forward -109 -90 4.32602 0.198
NP_440734.1_9 Reverse -328 -347 12.6841 0.234
NP_440554.1_4 Forward -207 -197 14.6313 0.02
NP_442862.1_3 Reverse -39 -56 6.72535 0.263
NP_441845.1_6 Reverse -187 -205 0.707465 0.274
NP_441885.1_5 Reverse -199 -209 20.9245 0.000538
NP_441885.1_5 Forward -208 -198 11.4848 0.00668
NP_440898.1_5 Forward -208 -189 8.65258 0.279
NP_442341.1_7 Reverse -198 -212 13.9626 0.0326
NP_442341.1_7 Forward -209 -195 10.0294 0.0682
NP_442341.1_9 Reverse -197 -211 13.1753 0.0878
NP_441756.1_5 Forward -226 -207 -3.83545 0.29
NP_440423.1_6 Reverse -191 -210 -5.99873 0.138
NP_440423.1_10 Forward -215 -196 9.63589 0.26
NP_443000.1_7 Forward -210 -200 10.3048 0.0345
NP_443000.1_7 Reverse -197 -207 8.73149 0.0437
NP_440507.2_3 Forward -340 -321 11.5033 0.179
NP_441842.1_1 Reverse -201 -214 16.0466 0.0502
NP_441842.1_10 Forward -215 -201 14.6509 0.0547
NP_441842.1_10 Reverse -192 -206 12.1926 0.107
NP_441842.1_10 Reverse -122 -136 8.25939 0.23
NP_441842.1_10 Reverse -23 -37 6.09611 0.299
NP_440275.1_3 Reverse -197 -207 8.4365 0.0602
NP_440275.1_3 Forward -210 -200 8.04317 0.0602
NP_440091.1_1 Reverse -195 -207 18.3285 0.0114
NP_442275.1_1 Forward -376 -357 3.14605 0.284
NP_442275.1_1 Forward -340 -321 0.491109 0.285
NP_440679.1_10 Forward -206 -187 3.14605 0.092
NP_442451.1_2 Reverse -103 -122 -6.88371 0.232
NP_441635.1_6 Reverse -43 -62 13.0775 0.24
NP_440149.1_8 Reverse -199 -218 11.6025 0.0404
NP_440149.1_8 Forward -208 -189 4.916 0.0794
NP_440149.1_8 Forward -120 -101 -7.37537 0.283
NP_441875.1_4 Forward -261 -242 14.6499 0.197
NP_440216.1_1 Forward -208 -194 6.29277 0.0156
NP_440216.1_1 Reverse -199 -213 0.491246 0.0284
NP_440216.1_1 Forward -183 -169 -2.75368 0.0574
NP_440216.1_1 Forward -377 -363 -11.1118 0.163
NP_440216.1_1 Reverse -163 -177 -11.3085 0.178
NP_440172.1_1 Reverse -199 -209 15.0247 0.00945
NP_440172.1_1 Forward -208 -198 8.73149 0.0586
NP_442371.1_1 Forward -50 -40 14.3359 0.191
NP_441008.1_4 Reverse -184 -203 16.7111 0.295
NP_440249.1_2 Reverse -34 -44 16.4008 0.194
NP_442015.1_10 Forward -212 -199 10.4424 0.0391
NP_442015.1_10 Reverse -195 -208 0.904263 0.216
NP_441226.1_7 Forward -207 -200 14.4934 0.0123
NP_441226.1_7 Reverse -200 -207 14.4934 0.0123
NP_441226.1_7 Reverse -167 -174 9.77352 0.131
NP_441111.1_7 Forward -207 -199 18.7023 0.00294
NP_441111.1_7 Reverse -200 -208 18.7023 0.00294
NP_441766.1_2 Forward -208 -199 17.5026 0.00297
NP_441766.1_2 Reverse -199 -208 17.5026 0.00297
NP_440416.1_1 Forward -208 -189 -12.3902 0.272
NP_440416.1_9 Forward -32 -13 -16.9135 0.226
NP_440416.1_9 Forward -215 -196 -18.7818 0.264
NP_440416.1_9 Reverse -192 -211 -21.83 0.297
NP_443052.1_8 Reverse -189 -208 -0.295539 0.0688
NP_443052.1_8 Forward -341 -322 -11.0136 0.221
NP_442116.1_6 Forward -56 -39 11.6067 0.197
NP_442116.1_6 Forward -55 -38 6.73658 0.271
NP_442403.1_8 Forward -206 -187 3.34271 0.226
NP_440591.1_9 Reverse -163 -181 5.32902 0.25
NP_442154.1_1 Forward -201 -183 3.26407 0.0653
NP_442154.1_1 Forward -207 -189 -15.1238 0.218
NP_442154.1_1 Forward -216 -198 -15.3205 0.218
NP_440261.1_5 Reverse -200 -213 6.90245 0.0316
NP_440261.1_5 Forward -174 -161 -4.40561 0.147
NP_440261.1_5 Reverse -175 -188 -5.09393 0.185
NP_440988.1_10 Reverse -197 -211 8.09365 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGGACTGACTTTTTGGTGTACCAGGCGCACTCCGGCCCTAAATCCCTTTTTGCGCCAGTTGGGCAATGGGGCCCTAGCCCTTTTGGGGGGACAGATCCTATTGGGAGTTGCTACGCTAAAGCTCCATTTACAAATTGAACCCCTAACCGTAGCCCACCATACAGTGGGAATTTGTCTCTGGGCTACCCTGTTGGCGATCGCCGTTTTGGCGGTGCGGGACCATCGACCGACGGCCCCCATTACATCCTGATGATAAAAATCTTTAAGTCTCCCTAGGGAGGGAAATTTCTGCCGTTGCGGTTAAACTAACTGCCATTTTTTGTCCAGTTGGGGAATACTCGCTTAAAATTCAGGAAAAATTTTTGATCTCCCCCCTGCTTACCCTTTCTTTTGATTCTCT

CDS

ATGGTTACTTCGACAAAAATCCATCGCCAACACGATTCCATGGGGGCGGTGTGCAAAAGTTATTATCAGTTAACCAAACCGAGAATTATCCCCCTCTTGCTGATTACCACCGCTGCTTCCATGTGGATTGCCTCGGAAGGTCGGGTGGATTTACCCAAATTGCTGATCACTCTGCTGGGAGGAACCCTTGCAGCCGCTTCAGCCCAAACCCTGAACTGTATTTACGACCAAGACATTGACTATGAAATGCTCCGCACCAGGGCCCGACCCATCCCAGCCGGAAAAGTGCAACCCCGCCATGCGTTGATTTTCGCCCTAGCCTTAGGGGTACTTTCGTTCGCTCTTTTGGCCACCTTTGTCAATGTACTAAGCGGTTGCCTAGCATTATCCGGCATTGTCTTTTACATGTTGGTCTATACCCATTGGCTGAAACGACACACGGCCCAAAACATTGTCATCGGTGGGGCTGCGGGTTCCATTCCCCCCTTGGTGGGCTGGGCCGCTGTTACGGGGGATTTAAGCTGGACTCCCTGGGTACTGTTTGCGCTAATTTTTCTTTGGACTCCCCCCCACTTTTGGGCCCTGGCTTTGATGATCAAGGATGATTATGCCCAGGTGAATGTCCCCATGTTGCCGGTAATTGCGGGGGAGGAAAAAACCGTTAGCCAAATCTGGTACTACTCACTGTTGGTGGTGCCTTTCAGTTTGCTGCTAGTTTATCCTCTGCACCAGTTGGGCATACTTTATCTGGCGATCGCCATTATTTTGGGGGGACAATTTCTGGTCAAAGCTTGGCAACTCAAACAGGCTCCCGGCGATCGGGATTTGGCTAGGGGATTGTTCAAGTTCTCCATTTTTTACCTAATGTTGCTCTGCCTGGCCATGGTGATTGACAGTTTGCCCGTCACCCATCAGTTGGTGGCCCAAATGGGAACTTTACTGTTGGGTTAA

Protein

MVTSTKIHRQHDSMGAVCKSYYQLTKPRIIPLLLITTAASMWIASEGRVDLPKLLITLLGGTLAAASAQTLNCIYDQDIDYEMLRTRARPIPAGKVQPRHALIFALALGVLSFALLATFVNVLSGCLALSGIVFYMLVYTHWLKRHTAQNIVIGGAAGSIPPLVGWAAVTGDLSWTPWVLFALIFLWTPPHFWALALMIKDDYAQVNVPMLPVIAGEEKTVSQIWYYSLLVVPFSLLLVYPLHQLGILYLAIAIILGGQFLVKAWQLKQAPGDRDLARGLFKFSIFYLMLLCLAMVIDSLPVTHQLVAQMGTLLLG