Your browser is old and dusty. Try Google Chrome!

Details for sll1892

ORF sll1892
Accession NP_441513.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -284 -298 3.14618 0.168
NP_440557.1_1 Reverse -188 -207 0.0977854 0.265
NP_440557.1_1 Reverse -146 -165 -1.96717 0.28
NP_441418.1_6 Forward -292 -273 -30.1882 0.262
NP_442272.1_1 Reverse -162 -180 16.3311 0.186
NP_441453.1_4 Forward -292 -284 6.80426 0.121
NP_441453.1_4 Reverse -283 -291 6.11594 0.121
NP_442151.1_6 Reverse -283 -297 9.73436 0.141
NP_441818.1_1 Reverse -284 -295 12.4478 0.125
NP_440226.1_1 Forward -292 -273 10.4225 0.0622
NP_441630.1_3 Forward -257 -238 -0.39387 0.287
NP_442623.1_3 Reverse -1 -20 -11.1119 0.224
NP_440150.1_2 Reverse -285 -304 9.14342 0.221
NP_442173.1_1 Reverse -284 -292 12.0158 0.0316
NP_442173.1_1 Forward -291 -283 10.7375 0.0611
NP_442752.1_4 Forward -292 -285 13.8055 0.0199
NP_442752.1_4 Reverse -27 -34 5.84064 0.166
NP_443027.1_4 Forward -156 -146 7.35486 0.24
NP_443027.1_4 Reverse -281 -291 5.97822 0.294
NP_441812.1_3 Forward -293 -279 7.66941 0.268
NP_442975.1_10 Reverse -279 -293 4.42388 0.245
NP_441225.1_4 Reverse -177 -196 -4.13045 0.261
NP_440784.1_7 Forward -291 -284 6.23397 0.241
NP_440784.1_7 Reverse -284 -291 6.13563 0.241
NP_442909.1_7 Reverse -284 -298 11.307 0.131
NP_440061.1_9 Reverse -281 -295 7.47213 0.205
NP_442062.1_8 Forward -292 -282 9.32148 0.0633
NP_441900.1_2 Reverse -239 -257 -4.30813 0.288
NP_441859.1_3 Reverse -282 -301 2.06362 0.267
NP_439918.1_2 Reverse -12 -31 -3.24547 0.251
NP_439918.1_2 Reverse -196 -215 -3.73712 0.261
NP_442110.1_7 Reverse -283 -297 -0.295402 0.281
NP_441925.1_2 Reverse -92 -111 6.09597 0.262
NP_441925.1_4 Forward -218 -199 -15.2425 0.263
NP_441083.1_5 Reverse -283 -293 9.7148 0.0231
NP_441083.1_5 Forward -292 -282 -0.904945 0.283
NP_441434.1_7 Reverse -285 -299 6.3911 0.225
NP_441738.1_2 Reverse -285 -292 15.28 0.0102
NP_441738.1_2 Forward -34 -27 8.20023 0.181
NP_441558.1_5 Forward -393 -374 4.42435 0.281
NP_440209.1_1 Forward -292 -284 8.57422 0.0425
NP_442889.1_8 Reverse -280 -294 8.94708 0.107
NP_440056.1_9 Reverse -371 -390 17.9714 0.152
NP_440178.1_7 Forward -392 -373 -21.9284 0.246
NP_440178.1_7 Reverse -381 -400 -22.9117 0.282
NP_441025.1_5 Reverse -290 -304 20.1574 0.179
NP_440906.1_5 Forward -291 -284 6.23397 0.234
NP_440906.1_5 Reverse -284 -291 6.13563 0.241
NP_440747.1_10 Forward -295 -283 -11.9574 0.178
NP_441130.1_10 Reverse -281 -295 8.25939 0.139
NP_441486.1_1 Reverse -280 -294 1.08123 0.119
NP_441486.1_1 Reverse -286 -300 -6.29359 0.288
NP_441486.1_1 Forward -295 -281 -6.29359 0.288
NP_441695.1_8 Forward -391 -377 12.4876 0.232
NP_442848.1_1 Forward -298 -284 14.3559 0.021
NP_442848.1_5 Forward -392 -374 -2.24246 0.284
NP_443018.1_3 Reverse -284 -291 11.7405 0.0655
NP_443018.1_3 Forward -291 -284 5.44732 0.193
NP_441634.1_8 Forward -294 -280 -4.03198 0.295
NP_440376.1_1 Forward -292 -283 5.99792 0.111
NP_440376.1_1 Reverse -382 -391 4.52295 0.156
NP_440376.1_1 Reverse -283 -292 -0.196935 0.285
NP_441588.1_4 Reverse -285 -295 8.63316 0.14
NP_442687.1_7 Forward -392 -382 4.89658 0.23
NP_441846.1_10 Reverse -12 -31 -21.6334 0.256
NP_441422.1_7 Reverse -281 -298 -0.354483 0.167
NP_441950.1_7 Reverse -43 -62 1.0811 0.175
NP_442198.1_7 Reverse -286 -305 7.66846 0.298
NP_440184.1_5 Forward -302 -283 23.8939 0.0191
NP_442937.1_5 Forward -297 -278 12.6841 0.103
NP_442937.1_5 Reverse -140 -159 10.6192 0.157
NP_442321.1_4 Forward -394 -375 -7.27704 0.284
NP_441958.1_5 Forward -293 -283 0.865012 0.12
NP_441127.1_1 Forward -249 -235 10.816 0.242
NP_442836.1_5 Forward -298 -279 3.14605 0.243
NP_442690.1_1 Reverse -89 -108 -6.39206 0.166
NP_442911.1_2 Forward -164 -145 -5.80207 0.167
NP_443055.1_6 Forward -44 -26 -0.866561 0.268
NP_443055.1_6 Forward -391 -373 -2.43985 0.295
NP_440993.1_2 Reverse -278 -294 4.77842 0.249
NP_440496.1_1 Forward -190 -171 2.65439 0.266
NP_440602.1_8 Forward -292 -278 13.9626 0.164
NP_439975.1_2 Reverse -42 -60 13.7855 0.128
NP_441294.1_7 Reverse -279 -293 13.7621 0.0568
NP_442438.1_10 Forward -159 -145 7.47274 0.0933
NP_442431.1_10 Reverse -139 -157 -0.0791831 0.284
NP_441000.1_6 Forward -293 -279 -5.01529 0.257
NP_441550.1_8 Forward -294 -284 15.5158 0.0132
NP_440206.1_4 Reverse -378 -397 3.04693 0.282
NP_440569.1_10 Reverse -291 -310 11.4109 0.219
NP_441725.1_5 Forward -291 -281 0.275027 0.192
NP_441725.1_5 Reverse -383 -393 -0.314959 0.246
NP_441725.1_5 Reverse -284 -294 -0.806614 0.271
NP_439966.1_7 Reverse -281 -291 14.9258 0.0177
NP_439966.1_7 Forward -294 -284 5.09279 0.243
NP_439966.1_9 Forward -294 -285 0.884706 0.253
NP_442941.1_3 Reverse -284 -294 1.16001 0.15
NP_440289.1_2 Reverse -280 -293 2.47756 0.096
NP_441514.1_1 Reverse -87 -97 14.2496 0.274
NP_442281.1_1 Reverse -278 -292 10.717 0.055
NP_442281.1_1 Forward -297 -283 2.06395 0.278
NP_440437.1_1 Forward -160 -141 -3.3438 0.234
NP_440498.1_1 Reverse -274 -292 -2.24246 0.238
NP_442982.1_5 Reverse -266 -285 9.0459 0.12
NP_440453.1_2 Reverse -198 -212 13.7659 0.298
NP_441644.1_6 Reverse -283 -293 7.74772 0.117
NP_441644.1_6 Forward -391 -381 6.17443 0.165
NP_443049.1_6 Forward -293 -283 11.8361 0.24
NP_440867.1_10 Reverse -381 -400 10.3242 0.25
NP_440253.1_2 Forward -292 -274 2.57575 0.136
NP_440929.1_8 Reverse -283 -292 14.651 0.0105
NP_440929.1_8 Forward -292 -283 7.66954 0.0624
NP_441751.2_8 Reverse -284 -298 -6.68692 0.277
NP_442926.1_7 Forward -117 -98 11.7008 0.207
NP_442554.1_8 Reverse -284 -294 8.23984 0.0776
NP_442554.1_8 Forward -291 -281 8.1415 0.0785
NP_442554.1_8 Forward -390 -380 7.55152 0.0893
NP_442554.1_8 Forward -153 -143 6.17489 0.125
NP_442554.1_8 Reverse -383 -393 3.12662 0.239
NP_442554.1_8 Reverse -1 -11 2.04498 0.285
NP_441762.1_7 Reverse -282 -294 -5.46756 0.212
NP_442142.1_4 Forward -157 -144 4.64028 0.214
NP_442292.1_1 Reverse -284 -293 8.65285 0.0335
NP_442292.1_1 Forward -291 -282 -0.68859 0.268
NP_443009.1_5 Forward -293 -282 7.53132 0.126
NP_441198.1_8 Forward -11 -1 10.6345 0.254
NP_440464.1_10 Forward -80 -70 12.2442 0.242
NP_441468.1_1 Forward -291 -284 6.13563 0.209
NP_441468.1_1 Reverse -284 -291 6.0373 0.223
NP_441015.1_10 Reverse -140 -159 -0.39387 0.169
NP_441673.1_1 Forward -292 -283 1.37636 0.114
NP_441673.1_1 Reverse -283 -292 1.1797 0.163
NP_441826.1_2 Forward -298 -284 4.22782 0.104
NP_441826.1_2 Reverse -283 -297 -0.197071 0.204
NP_441826.1_2 Reverse -139 -153 -0.295402 0.208
NP_442868.1_6 Forward -294 -284 7.74818 0.0697
NP_442808.1_1 Reverse -282 -292 10.4026 0.0481
NP_441882.1_6 Reverse -173 -192 1.57275 0.2
NP_440145.1_3 Forward -302 -283 -5.01543 0.257
NP_442050.1_1 Forward -197 -178 8.06259 0.255
NP_442342.1_9 Forward -399 -383 5.07341 0.241
NP_441114.1_3 Reverse -291 -300 7.27622 0.247
NP_441878.1_6 Forward -392 -382 10.7964 0.0176
NP_441878.1_6 Reverse -381 -391 1.55333 0.0937
NP_441036.1_8 Reverse -282 -292 7.45319 0.197
NP_441557.1_5 Reverse -283 -292 7.57121 0.049
NP_441557.1_5 Forward -292 -283 1.08137 0.0794
NP_441557.1_8 Forward -60 -50 11.9759 0.236
NP_440738.1_1 Forward -292 -273 9.93088 0.15
NP_442183.1_1 Forward -292 -278 16.3225 0.0151
NP_442397.1_9 Reverse -283 -302 0.982764 0.299
NP_442347.1_2 Reverse -284 -293 10.3245 0.058
NP_442594.1_8 Reverse -40 -59 2.94938 0.291
NP_441633.1_3 Reverse -281 -294 -2.04567 0.171
NP_440136.1_2 Forward -291 -284 6.23397 0.171
NP_440136.1_2 Reverse -284 -291 6.13563 0.193
NP_442590.1_9 Reverse -380 -399 4.32602 0.273
NP_442998.1_10 Reverse -285 -292 15.5754 0.0102
NP_440899.1_8 Forward -94 -75 -8.35868 0.254
NP_441007.1_10 Forward -297 -284 2.96921 0.183
NP_440256.1_1 Forward -295 -276 -6.49039 0.213
NP_441270.1_5 Reverse -202 -221 10.9448 0.296
NP_441395.1_6 Reverse -161 -180 14.6576 0.299
NP_440915.1_6 Forward -296 -282 4.71948 0.0953
NP_442158.1_4 Reverse -125 -135 11.1898 0.28
NP_441464.1_10 Reverse -199 -213 11.7993 0.216
NP_441464.1_10 Reverse -198 -212 11.111 0.231
NP_440306.1_5 Forward -180 -161 7.47261 0.121
NP_442993.1_1 Forward -292 -276 2.12349 0.0502
NP_442993.1_1 Forward -391 -375 -2.79306 0.119
NP_442386.1_9 Reverse -282 -291 10.619 0.121
NP_441340.1_5 Forward -291 -284 13.5105 0.0314
NP_441340.1_5 Reverse -284 -291 5.84064 0.208
NP_441271.1_1 Forward -298 -280 11.5231 0.239
NP_442714.1_5 Forward -118 -99 0.786102 0.253
NP_440586.1_8 Reverse -284 -291 9.47853 0.146
NP_440586.1_8 Forward -291 -284 5.74197 0.283
NP_440192.1_5 Reverse -144 -163 3.83436 0.271
NP_442959.1_5 Forward -356 -337 6.19431 0.262
NP_441262.1_3 Forward -292 -285 14.7888 0.0223
NP_443051.1_1 Forward -293 -284 7.47288 0.0571
NP_439937.1_8 Forward -198 -179 0.392778 0.235
NP_439937.1_8 Forward -112 -93 -4.03212 0.276
NP_439937.1_9 Reverse -239 -256 -9.00826 0.179
NP_439937.1_9 Forward -62 -45 -17.3663 0.298
NP_440372.1_2 Forward -291 -284 13.8055 0.0214
NP_440372.1_2 Reverse -284 -291 6.52896 0.188
NP_442783.1_8 Forward -382 -363 14.8466 0.266
NP_441181.1_6 Forward -195 -177 3.55906 0.274
NP_441789.1_7 Reverse -284 -303 -3.83621 0.28
NP_440316.1_10 Forward -299 -289 6.27322 0.264
NP_441803.1_2 Forward -390 -371 -1.27885 0.297
NP_441572.1_1 Forward -294 -275 -6.68705 0.294
NP_440221.1_8 Reverse -146 -165 11.6025 0.295
NP_441604.1_4 Forward -306 -287 -4.6221 0.235
NP_441877.1_5 Reverse -88 -107 0.982764 0.276
NP_441877.1_7 Reverse -278 -297 3.44025 0.218
NP_442262.1_10 Reverse -284 -291 13.2155 0.0213
NP_440344.1_10 Reverse -276 -293 -7.04099 0.115
NP_440297.1_9 Reverse -383 -393 9.51814 0.0917
NP_440297.1_9 Reverse -1 -11 0.0783647 0.282
NP_440297.1_9 Forward -291 -281 -0.118297 0.282
NP_440297.1_9 Reverse -146 -156 -0.216628 0.282
NP_440350.1_1 Reverse -56 -75 -5.80207 0.294
NP_441896.1_3 Forward -301 -282 -1.86883 0.268
NP_440888.1_2 Reverse -283 -297 8.94708 0.142
NP_440888.1_2 Reverse -243 -257 6.48882 0.232
NP_442277.1_4 Forward -220 -201 2.85027 0.237
NP_442033.1_6 Forward -391 -372 18.584 0.112
NP_441543.1_2 Reverse -284 -293 7.07956 0.131
NP_442845.1_2 Forward -298 -284 7.27608 0.195
NP_440208.1_8 Forward -371 -352 18.879 0.213
NP_441178.1_6 Forward -228 -209 2.26028 0.27
NP_441469.1_8 Forward -10 -1 11.1111 0.181
NP_441469.1_8 Forward -155 -146 10.8161 0.195
NP_441469.1_8 Reverse -282 -291 6.68623 0.227
NP_442578.1_7 Forward -291 -284 6.0373 0.18
NP_441462.1_2 Forward -292 -282 0.963343 0.109
NP_442204.1_5 Forward -302 -283 8.16093 0.122
NP_442204.1_5 Reverse -42 -61 1.17943 0.241
NP_440544.1_5 Forward -141 -134 14.5681 0.264
NP_440516.1_8 Forward -292 -283 9.53783 0.0136
NP_440516.1_8 Reverse -283 -292 5.01461 0.118
NP_441785.1_1 Reverse -283 -297 12.4475 0.245
NP_442428.1_5 Forward -291 -284 6.13563 0.209
NP_442428.1_5 Reverse -284 -291 6.0373 0.212
NP_442120.1_10 Forward -391 -372 -11.8986 0.265
NP_442120.1_10 Forward -104 -85 -15.4385 0.294
NP_440673.1_3 Reverse -285 -292 12.4288 0.0426
NP_441052.1_2 Forward -154 -144 2.14332 0.216
NP_441052.1_2 Reverse -283 -293 1.55333 0.238
NP_442219.1_9 Reverse -284 -293 7.96454 0.0696
NP_440436.1_4 Reverse -284 -293 7.57079 0.124
NP_440436.1_7 Reverse -168 -187 5.89931 0.255
NP_441719.1_4 Forward -291 -284 6.82395 0.0855
NP_441719.1_4 Reverse -284 -291 6.52896 0.188
NP_441733.1_10 Forward -295 -282 11.524 0.106
NP_440296.1_10 Reverse -10 -29 -13.9635 0.269
NP_442206.1_10 Forward -292 -277 1.65152 0.222
NP_443054.1_2 Forward -393 -379 3.8345 0.24
NP_443054.1_2 Reverse -281 -295 1.76955 0.245
NP_441966.1_8 Reverse -370 -388 6.01734 0.0979
NP_441851.1_10 Forward -293 -283 5.97822 0.19
NP_441851.1_10 Reverse -282 -292 4.60159 0.259
NP_441683.1_7 Reverse -41 -60 -7.08038 0.272
NP_440463.1_6 Reverse -280 -299 10.8159 0.195
NP_440463.1_8 Reverse -174 -193 7.11264 0.267
NP_442689.1_8 Reverse -93 -110 -6.25434 0.28
NP_440389.1_1 Forward -388 -369 12.29 0.149
NP_440432.1_9 Forward -153 -138 -6.11662 0.284
NP_440474.1_8 Forward -291 -277 6.88214 0.215
NP_441477.1_8 Forward -385 -366 13.6675 0.296
NP_440431.1_3 Forward -386 -367 -9.14533 0.241
NP_440588.1_2 Reverse -178 -197 -1.67217 0.156
NP_442006.1_2 Forward -193 -176 -17.0707 0.269
NP_442006.1_2 Forward -113 -96 -17.7591 0.282
NP_441078.1_4 Forward -292 -283 0.196389 0.205
NP_441078.1_4 Reverse -283 -292 -0.000272808 0.205
NP_441078.1_4 Forward -391 -382 -1.37691 0.254
NP_441078.1_4 Reverse -382 -391 -1.47524 0.266
NP_440526.1_3 Reverse -284 -295 10.3829 0.0646
NP_440526.1_3 Forward -153 -142 1.3365 0.267
NP_441432.1_8 Forward -293 -284 14.0611 0.0258
NP_441432.1_8 Reverse -381 -390 3.44131 0.245
NP_442320.1_8 Forward -298 -284 5.80112 0.0316
NP_442320.1_8 Reverse -277 -291 3.73617 0.0578
NP_440760.1_1 Reverse -283 -302 -9.34199 0.0832
NP_440199.1_10 Forward -295 -285 7.35486 0.231
NP_440281.1_6 Reverse -272 -291 10.5209 0.268
NP_441072.1_2 Forward -303 -284 7.07928 0.259
NP_442489.1_7 Forward -292 -283 0.688044 0.152
NP_442489.1_7 Reverse -283 -292 0.688044 0.152
NP_442489.1_7 Forward -391 -382 -1.37691 0.195
NP_442489.1_7 Reverse -382 -391 -1.47524 0.203
NP_440565.1_2 Reverse -385 -399 17.7494 0.225
NP_440565.1_7 Reverse -371 -390 11.7992 0.152
NP_440565.1_7 Forward -381 -362 0.786102 0.246
NP_440559.1_1 Reverse -284 -293 7.76787 0.0918
NP_440559.1_1 Forward -291 -282 5.11294 0.151
NP_441659.2_8 Reverse -283 -293 5.48657 0.106
NP_441659.2_8 Forward -391 -381 -0.216628 0.292
NP_441040.1_2 Forward -92 -73 -6.39206 0.181
NP_441040.1_5 Forward -303 -284 4.32602 0.25
NP_441800.1_3 Reverse -1 -19 3.85406 0.289
NP_442346.1_5 Reverse -144 -154 9.02648 0.118
NP_442346.1_5 Forward -392 -382 6.66654 0.195
NP_442346.1_5 Forward -293 -283 6.27322 0.208
NP_442346.1_5 Reverse -381 -391 4.79825 0.272
NP_440545.1_3 Reverse -141 -158 -4.97604 0.237
NP_440459.1_2 Forward -400 -383 11.7402 0.166
NP_440010.1_10 Reverse -178 -197 1.67108 0.295
NP_442137.1_1 Reverse -373 -392 7.57094 0.245
NP_442551.1_4 Reverse -380 -395 -2.38005 0.259
NP_440847.1_3 Reverse -168 -182 12.5853 0.24
NP_441888.1_8 Forward -376 -357 10.4225 0.28
NP_441050.1_5 Reverse -207 -225 -3.71743 0.299
NP_441833.1_4 Reverse -284 -291 6.52896 0.0924
NP_441833.1_4 Forward -291 -284 6.23397 0.163
NP_442162.1_9 Forward -291 -284 12.9205 0.0282
NP_442162.1_9 Reverse -284 -291 12.9205 0.0282
NP_440671.1_4 Reverse -277 -291 11.5043 0.132
NP_440671.1_4 Forward -298 -284 8.16106 0.202
NP_441044.1_9 Forward -104 -85 7.17762 0.0901
NP_442199.1_5 Reverse -275 -294 -3.14714 0.201
NP_442140.1_3 Reverse -284 -294 11.4848 0.0757
NP_442723.1_1 Forward -61 -42 8.25844 0.273
NP_441671.1_10 Reverse -371 -390 6.98095 0.205
NP_440875.1_9 Reverse -285 -295 8.66404 0.233
NP_441813.1_5 Reverse -281 -291 13.2547 0.0178
NP_440590.1_4 Reverse -284 -297 11.4257 0.0202
NP_440567.1_1 Reverse -284 -298 -0.000409212 0.261
NP_442497.1_10 Reverse -284 -293 0.589713 0.153
NP_442497.1_10 Forward -291 -282 -1.18024 0.256
NP_440821.1_4 Reverse -281 -291 8.63316 0.0454
NP_440821.1_4 Forward -294 -284 8.23984 0.053
NP_441239.1_9 Reverse -281 -293 12.0354 0.0512
NP_441239.1_9 Reverse -380 -392 9.47875 0.105
NP_441239.1_9 Forward -156 -144 3.67722 0.279
NP_441892.1_1 Forward -400 -383 -2.22277 0.219
NP_442270.1_9 Forward -303 -284 -10.3253 0.253
NP_440863.1_4 Reverse -168 -187 16.6165 0.267
NP_440949.1_7 Reverse -275 -294 12.29 0.214
NP_442138.1_10 Forward -292 -273 -2.0655 0.191
NP_442052.1_8 Forward -300 -290 15.0247 0.253
NP_441537.1_3 Reverse -346 -360 13.5686 0.271
NP_440462.1_6 Reverse -281 -291 3.81494 0.228
NP_442340.1_3 Reverse -177 -196 -6.58872 0.223
NP_442402.1_10 Reverse -243 -253 11.9759 0.23
NP_441848.1_7 Forward -225 -206 -4.72118 0.298
NP_441848.1_9 Forward -52 -41 18.741 0.109
NP_441084.1_6 Forward -322 -308 9.8289 0.263
NP_440696.1_6 Reverse -198 -217 5.70265 0.266
NP_442023.1_2 Forward -192 -173 3.53937 0.296
NP_442039.1_4 Forward -291 -284 11.6422 0.0747
NP_442837.1_3 Forward -291 -284 6.0373 0.25
NP_442837.1_3 Reverse -284 -291 6.0373 0.25
NP_440160.1_2 Forward -391 -372 10.5209 0.126
NP_442053.1_1 Reverse -283 -292 7.07956 0.105
NP_440505.1_3 Forward -294 -284 15.0247 0.0149
NP_440914.1_1 Reverse -283 -293 6.56569 0.273
NP_441011.1_8 Forward -291 -282 5.70292 0.237
NP_442533.1_1 Reverse -36 -55 -16.1268 0.263
NP_442533.1_6 Forward -391 -382 7.27622 0.0928
NP_442533.1_6 Reverse -382 -391 7.17789 0.0948
NP_442533.1_6 Reverse -283 -292 4.42462 0.179
NP_442533.1_6 Forward -154 -145 4.12963 0.191
NP_442541.1_1 Reverse -190 -209 16.0274 0.11
NP_442541.1_10 Forward -391 -377 1.67063 0.282
NP_442541.1_10 Forward -225 -211 1.5723 0.283
NP_442541.1_10 Reverse -382 -396 0.687325 0.3
NP_442232.1_3 Reverse -44 -63 -13.5702 0.282
NP_441482.1_7 Forward -298 -284 -8.5552 0.193
NP_439944.1_9 Reverse -284 -294 9.32148 0.1
NP_441028.1_6 Reverse -179 -189 5.78111 0.243
NP_441028.1_6 Forward -142 -132 4.89613 0.275
NP_440116.1_8 Reverse -284 -303 -8.65367 0.256
NP_441527.1_4 Reverse -265 -284 -0.143661 0.145
NP_441527.1_4 Forward -183 -164 -7.78302 0.237
NP_440115.1_6 Forward -295 -285 9.81313 0.115
NP_441602.1_3 Forward -297 -278 -5.01543 0.277
NP_441972.1_5 Reverse -284 -303 -7.4737 0.249
NP_441815.1_6 Forward -224 -205 -0.39464 0.292
NP_441286.1_1 Reverse -282 -294 1.02229 0.0996
NP_441286.1_1 Forward -293 -281 -4.09092 0.149
NP_440670.1_8 Forward -292 -283 16.0277 0.00443
NP_440670.1_8 Reverse -283 -292 12.5861 0.0253
NP_440886.1_7 Reverse -282 -292 7.64939 0.0865
NP_441753.1_10 Forward -400 -381 6.39097 0.186
NP_441753.1_10 Reverse -274 -293 1.37609 0.269
NP_440907.2_8 Reverse -284 -294 9.12434 0.113
NP_442264.1_2 Reverse -141 -158 6.23369 0.265
NP_441021.1_1 Reverse -284 -303 -8.752 0.2
NP_440962.1_5 Forward -283 -273 16.9913 0.261
NP_441463.1_3 Reverse -273 -292 -7.4737 0.258
NP_442061.1_5 Reverse -35 -53 16.4374 0.293
NP_441626.1_2 Forward -291 -284 12.2322 0.0511
NP_441626.1_2 Reverse -284 -291 5.93897 0.231
NP_442794.1_1 Forward -269 -257 5.25052 0.227
NP_441962.1_4 Forward -297 -278 2.85105 0.102
NP_440387.1_1 Reverse -283 -299 -5.84132 0.254
NP_441488.1_8 Forward -297 -283 10.2254 0.146
NP_441488.1_8 Reverse -383 -397 8.3571 0.195
NP_441836.1_2 Reverse -178 -197 -3.44213 0.238
NP_441993.1_1 Reverse -376 -395 2.62889 0.256
NP_441174.1_1 Reverse -201 -216 11.7796 0.247
NP_442352.1_1 Reverse -178 -191 14.4877 0.251
NP_440358.1_2 Forward -89 -72 14.4927 0.194
NP_440114.1_10 Forward -292 -278 13.8643 0.0481
NP_440114.1_10 Forward -391 -377 6.48943 0.269
NP_440766.1_4 Forward -296 -282 13.2743 0.0414
NP_442103.1_8 Reverse -383 -397 20.5508 0.12
NP_439910.1_2 Reverse -275 -292 -3.20608 0.0362
NP_440502.1_3 Forward -276 -266 13.9847 0.278
NP_440457.1_1 Forward -296 -284 7.61046 0.101
NP_441984.1_3 Reverse -279 -297 5.52568 0.282
NP_442509.1_9 Forward -292 -282 9.71433 0.192
NP_441871.1_6 Reverse -76 -95 10.9142 0.18
NP_442514.1_5 Forward -63 -44 -7.57277 0.276
NP_440185.1_9 Forward -255 -238 13.0185 0.264
NP_440554.1_4 Forward -291 -281 6.17489 0.126
NP_440554.1_4 Reverse -284 -294 3.42162 0.23
NP_441885.1_5 Reverse -283 -293 1.25834 0.11
NP_441885.1_5 Forward -292 -282 0.0783647 0.183
NP_442341.1_7 Reverse -282 -296 10.521 0.0625
NP_441173.1_9 Reverse -235 -243 10.9338 0.242
NP_443000.1_7 Forward -294 -284 0.668351 0.293
NP_441842.1_10 Forward -256 -242 12.4876 0.101
NP_441842.1_10 Forward -299 -285 7.17775 0.264
NP_440275.1_3 Forward -294 -284 15.123 0.0182
NP_440091.1_1 Reverse -279 -291 8.59377 0.0631
NP_440091.1_1 Forward -296 -284 1.02229 0.218
NP_442275.1_3 Reverse -211 -230 12.9791 0.274
NP_441875.1_3 Forward -392 -373 16.2232 0.252
NP_440216.1_1 Reverse -382 -396 -12.6851 0.296
NP_440216.1_9 Forward -73 -64 6.39124 0.289
NP_440172.1_1 Reverse -283 -293 2.24165 0.279
NP_440167.1_3 Reverse -135 -154 7.7676 0.294
NP_442015.1_10 Reverse -279 -292 0.60927 0.221
NP_441226.1_7 Forward -291 -284 12.7234 0.0312
NP_441226.1_7 Reverse -284 -291 11.5435 0.0757
NP_441111.1_7 Reverse -284 -292 8.86921 0.0589
NP_441766.1_2 Reverse -283 -292 12.6844 0.0158
NP_440416.1_9 Reverse -381 -400 -19.8634 0.279
NP_443052.1_8 Reverse -273 -292 -4.72043 0.121
NP_442116.1_6 Reverse -126 -143 6.35461 0.28
NP_442154.1_1 Reverse -382 -400 -17.2871 0.251
NP_442154.1_1 Reverse -198 -216 -17.5821 0.26
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCGCCAGAGGGCCAAGGCCTCTTCCCAGGAACTTTGGGCCGCTTGAAAATCTGTTAGGTTACCCTGCTGATAATGCTTGAGACCCTGATTAAAATATTGCTGAGCAGTGGCGATCGGAGTTTTACTTTCTCCTTTCAAGATGACTTCTGGGGGAGACTGGGCTAAAGATATATAACTCCATTTCCCGCCCCCCAAAACACAAACTGTGACCACGGAGGCAAAGGTTAAGTTGAACAAAAAACGCACTGCCATGACCACTTTTTCTCCAATAAAATACGTTGATAAACGGCTAAGATGGAAGCGAAAATTTTCCTGTGTCGTCTAGCCCCAAAGAAAAACGACTTTCCCCCCCCCTAACCAATTTTACGTTCCCCTACAGATCCTTTCCCGGTGCCATGCC

CDS

ATGATTACCCCACCCAGCTCACCCAAAGCCAAATTTCTTAAACTAAGTGCCATCGGTGCTTCTGCGCCCTTACTCGCCCTGGGATGGGCCGTGGCCCCCAGCCAAGCCCAAATCAGCCAAGCAGTGGTGCAGGAAATCATTGACGGTCCCCAGGTTTACATCGAAGAAATCCAGGCAAAAGTGGATGACCAAGCGGAATTTGGCCAGGTCATAGTGACCAAAAAAGCCAGAGCCGGAATATTGTTTAATAATGGGGCGTCAGGAAGATTGAGCGAAAATGCCAGCGTAATTGTCGGTCAATGCGTAGAGTTGGAACGGGGTAAGTTGCTGGCCAGTGGTCCTGTCAATGGTTGTATGGCGGGGGTCAGTGTGGCGGTGACTGGCACAGTGTATGTCATGGAAAGGAATGAAGGTCAATCGGGGGAAATTAAGGTTCTGGAGGGGGCGGTGTTGGTTAGTGATCCGGAAAATCCACAGCAAAGAACTCGGGTTAAAGCGGGGGAAAAGGTCAGTGTTTTGGAGGGCATCCTCGGTTCTGTGATTCCCATGACTCCGGAGGAGTTAGTCGCCCTTTTGAGTGGTAGTTTGTTCAATGGCTTCAGCATTCCGATCACTCCGGATGGAGCCTTGCAGAGTATGTGCTCCAACCTTTTGCCCGGGCTGAGTTGTTCCACCGGCGGAGTGAACTACTCTCCCCCTATCCCCAGTTTGCCGGTGCCCATTCCTTTCCCCAGCTTTGGTTTCTAA

Protein

MITPPSSPKAKFLKLSAIGASAPLLALGWAVAPSQAQISQAVVQEIIDGPQVYIEEIQAKVDDQAEFGQVIVTKKARAGILFNNGASGRLSENASVIVGQCVELERGKLLASGPVNGCMAGVSVAVTGTVYVMERNEGQSGEIKVLEGAVLVSDPENPQQRTRVKAGEKVSVLEGILGSVIPMTPEELVALLSGSLFNGFSIPITPDGALQSMCSNLLPGLSCSTGGVNYSPPIPSLPVPIPFPSFGF