Your browser is old and dusty. Try Google Chrome!

Details for sll1890

ORF sll1890
Accession NP_441516.1
Symbol
Category Cobalamin, heme, phycobilin and porphyrin
Definition cobalt-chelatase subunit CobN-like protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -234 -241 10.6589 0.143
NP_441418.1_6 Reverse -353 -372 -20.945 0.133
NP_441418.1_6 Forward -355 -336 -29.6965 0.234
NP_441453.1_4 Forward -355 -347 5.52596 0.127
NP_441453.1_4 Reverse -346 -354 3.85433 0.284
NP_441453.1_7 Reverse -340 -347 12.9205 0.23
NP_441623.1_1 Forward -147 -129 -3.02911 0.254
NP_442151.1_6 Reverse -233 -247 5.70279 0.266
NP_441818.1_9 Reverse -296 -315 -2.36049 0.203
NP_441818.1_9 Reverse -347 -366 -9.34199 0.29
NP_441098.1_3 Reverse -40 -59 -6.31045 0.28
NP_440150.1_1 Reverse -358 -377 -1.67217 0.201
NP_442752.1_4 Forward -342 -335 6.52896 0.154
NP_442062.1_8 Reverse -346 -356 6.37155 0.127
NP_441900.1_2 Reverse -199 -217 -4.50479 0.288
NP_442762.1_10 Forward -182 -163 -10.1286 0.257
NP_441208.1_1 Forward -342 -323 -5.99873 0.287
NP_441208.1_9 Forward -121 -107 6.78443 0.229
NP_441082.1_10 Forward -284 -271 8.47575 0.272
NP_441083.1_5 Forward -321 -311 3.22496 0.178
NP_441083.1_5 Forward -355 -345 -0.904945 0.283
NP_439957.1_4 Reverse -37 -56 17.994 0.0347
NP_442115.2_7 Reverse -163 -180 8.20031 0.204
NP_441434.1_1 Reverse -83 -97 10.9932 0.233
NP_441738.1_2 Forward -319 -312 8.29857 0.176
NP_441558.1_5 Reverse -286 -305 7.7676 0.17
NP_440410.1_6 Reverse -267 -286 20.8447 0.114
NP_441327.1_1 Reverse -54 -73 6.23167 0.25
NP_441624.1_7 Forward -51 -37 6.78443 0.275
NP_440851.1_3 Forward -68 -49 3.24438 0.245
NP_441854.1_10 Reverse -332 -351 5.30933 0.259
NP_441486.1_1 Forward -358 -344 -6.29359 0.288
NP_442145.1_4 Forward -98 -79 5.20389 0.259
NP_440944.1_2 Forward -231 -212 -4.03212 0.296
NP_440470.1_5 Reverse -73 -92 6.44528 0.279
NP_441014.1_5 Forward -353 -335 10.2456 0.263
NP_442848.1_5 Forward -314 -296 1.59244 0.276
NP_442848.1_5 Reverse -274 -292 -3.02911 0.29
NP_442848.1_9 Forward -370 -351 -0.787193 0.28
NP_443018.1_3 Forward -354 -347 10.6589 0.0967
NP_443018.1_3 Forward -147 -140 7.11894 0.16
NP_443018.1_3 Reverse -347 -354 4.16902 0.278
NP_440376.1_1 Reverse -313 -322 1.86802 0.238
NP_440376.1_1 Reverse -312 -321 -0.0986038 0.285
NP_440376.1_1 Reverse -102 -111 -0.295266 0.286
NP_441857.1_5 Forward -362 -344 7.68896 0.189
NP_442687.1_7 Reverse -345 -355 13.7464 0.0426
NP_441077.1_6 Reverse -64 -80 3.2839 0.271
NP_441077.1_6 Forward -102 -86 1.64498 0.299
NP_442485.1_3 Reverse -263 -282 -6.1954 0.299
NP_441846.1_10 Forward -229 -210 -16.9135 0.256
NP_441846.1_10 Reverse -287 -306 -22.3217 0.259
NP_441013.1_2 Forward -360 -342 2.18243 0.242
NP_442658.1_1 Forward -357 -347 7.35439 0.214
NP_442782.1_2 Forward -123 -109 6.3911 0.226
NP_442782.1_2 Reverse -372 -386 3.93283 0.257
NP_443061.1_5 Forward -167 -148 13.3725 0.293
NP_442321.1_1 Forward -357 -338 4.52268 0.112
NP_441958.1_5 Reverse -345 -355 7.15819 0.0362
NP_441127.1_1 Forward -171 -157 8.06273 0.3
NP_440984.1_7 Forward -302 -288 5.01447 0.276
NP_441580.1_6 Forward -366 -347 2.26107 0.117
NP_440827.1_3 Forward -360 -341 11.4058 0.268
NP_442002.1_9 Forward -323 -316 11.1505 0.185
NP_441646.1_1 Forward -372 -353 -1.47551 0.287
NP_442438.1_10 Forward -360 -346 4.12949 0.152
NP_440147.1_4 Reverse -344 -357 15.2606 0.0186
NP_441550.1_8 Reverse -344 -354 13.2542 0.0267
NP_441916.1_7 Forward -355 -345 5.19158 0.141
NP_441916.1_10 Forward -389 -370 1.0811 0.27
NP_440345.1_3 Reverse -54 -68 16.3407 0.175
NP_441041.1_4 Forward -355 -336 -7.37537 0.186
NP_442396.1_5 Reverse -261 -274 13.0973 0.0913
NP_440703.1_9 Reverse -270 -283 9.36014 0.216
NP_440289.1_2 Forward -261 -248 -4.11062 0.28
NP_441678.1_9 Forward -183 -164 -3.83545 0.288
NP_442281.1_1 Forward -360 -346 13.7653 0.0241
NP_442281.1_1 Reverse -341 -355 4.91554 0.176
NP_442281.1_1 Forward -159 -145 3.34225 0.235
NP_441079.1_7 Reverse -63 -82 4.62021 0.152
NP_441079.1_7 Reverse -82 -101 -2.55791 0.22
NP_441079.1_7 Forward -85 -66 -4.62285 0.25
NP_441079.1_7 Reverse -64 -83 -5.31116 0.264
NP_442847.1_3 Reverse -341 -360 7.76679 0.235
NP_001035871.2_7 Reverse -39 -49 12.0747 0.272
NP_442500.1_8 Reverse -64 -78 14.8059 0.156
NP_442012.1_1 Reverse -340 -359 -0.197208 0.253
NP_441644.1_6 Forward -355 -345 11.3859 0.0502
NP_441644.1_6 Forward -297 -287 4.69947 0.228
NP_441795.1_5 Reverse -93 -112 6.88262 0.245
NP_442215.1_2 Forward -357 -341 -3.48138 0.216
NP_442933.1_1 Forward -70 -51 7.4002 0.253
NP_442933.1_6 Reverse -77 -96 19.3367 0.107
NP_442933.1_10 Forward -355 -346 4.71961 0.22
NP_442926.1_1 Forward -355 -336 2.85105 0.17
NP_442554.1_8 Forward -354 -344 3.32329 0.23
NP_442554.1_8 Reverse -347 -357 2.92996 0.249
NP_441762.1_7 Reverse -345 -357 -6.05754 0.268
NP_442142.1_4 Reverse -343 -356 3.06699 0.268
NP_442292.1_5 Forward -213 -194 7.47261 0.152
NP_442476.1_6 Reverse -266 -280 -0.197071 0.29
NP_443009.1_5 Reverse -345 -356 7.82632 0.118
NP_442408.2_1 Forward -355 -336 -3.14714 0.241
NP_440357.1_6 Forward -362 -343 2.94938 0.296
NP_440158.1_1 Reverse -62 -81 15.517 0.0997
NP_440158.1_1 Reverse -80 -99 10.9334 0.227
NP_441468.1_1 Forward -354 -347 3.97235 0.277
NP_441020.2_6 Forward -357 -340 7.61033 0.225
NP_441876.1_9 Forward -301 -291 13.0576 0.267
NP_441826.1_2 Reverse -340 -354 -3.73699 0.286
NP_441826.1_5 Reverse -341 -360 7.7676 0.221
NP_441637.1_9 Reverse -304 -322 -3.52077 0.296
NP_442719.1_2 Reverse -201 -219 -3.32482 0.2
NP_442719.1_2 Reverse -240 -258 -5.58642 0.219
NP_441517.1_3 Reverse -77 -96 26.0938 0.00157
NP_441517.1_3 Reverse -59 -78 18.7159 0.146
NP_442808.1_1 Forward -156 -146 1.5529 0.282
NP_442808.1_1 Forward -356 -346 1.25791 0.289
NP_441290.1_3 Reverse -346 -365 15.6341 0.187
NP_440145.1_4 Forward -296 -286 15.7125 0.188
NP_441906.1_2 Reverse -161 -180 0.195343 0.3
NP_440558.1_2 Reverse -266 -285 -4.91709 0.249
NP_441878.1_6 Reverse -268 -278 -0.0199663 0.163
NP_441878.1_6 Reverse -345 -355 -0.314959 0.174
NP_441878.1_6 Forward -172 -162 -6.90313 0.198
NP_441557.1_5 Reverse -346 -355 -0.885252 0.26
NP_441590.1_4 Forward -374 -355 4.62021 0.28
NP_442267.1_4 Forward -179 -160 13.0775 0.088
NP_442066.2_4 Reverse -346 -365 -1.37718 0.191
NP_440084.1_8 Forward -99 -85 9.27434 0.29
NP_442830.1_5 Forward -156 -142 2.8506 0.251
NP_442397.1_9 Forward -119 -100 1.37609 0.283
NP_442444.1_6 Forward -389 -371 14.0813 0.224
NP_442590.1_10 Forward -355 -336 10.2259 0.183
NP_441728.2_4 Reverse -76 -95 12.1748 0.273
NP_442998.1_5 Forward -324 -314 16.4996 0.149
NP_442998.1_5 Forward -388 -378 12.0747 0.176
NP_442998.1_5 Forward -211 -201 11.0914 0.196
NP_442998.1_5 Reverse -108 -118 7.55152 0.289
NP_442998.1_10 Forward -353 -346 6.23397 0.157
NP_440899.1_8 Reverse -213 -232 4.12936 0.119
NP_440299.1_1 Reverse -342 -355 8.37683 0.0945
NP_440299.1_1 Reverse -368 -381 4.93527 0.193
NP_442333.2_5 Forward -366 -347 -14.4552 0.275
NP_440256.1_1 Reverse -343 -362 4.52268 0.0435
NP_440256.1_1 Reverse -285 -304 -9.34199 0.278
NP_441559.1_8 Reverse -196 -210 -5.31028 0.259
NP_440915.1_6 Forward -359 -345 11.3077 0.0263
NP_440915.1_6 Reverse -284 -298 -0.983719 0.217
NP_440733.1_2 Reverse -65 -83 17.859 0.102
NP_440733.1_2 Forward -83 -65 11.1745 0.293
NP_440717.1_3 Reverse -336 -350 10.0287 0.241
NP_441866.1_6 Reverse -262 -281 8.16011 0.26
NP_441464.1_10 Reverse -351 -365 7.9644 0.287
NP_440306.1_8 Reverse -194 -213 -1.67294 0.236
NP_442993.1_1 Reverse -194 -210 -11.7412 0.257
NP_442993.1_1 Forward -171 -155 -12.4295 0.271
NP_442993.1_1 Reverse -193 -209 -13.0195 0.283
NP_442386.1_9 Forward -356 -347 10.8157 0.116
NP_442054.1_3 Forward -330 -311 3.73603 0.0992
NP_441750.1_1 Reverse -347 -366 -6.29373 0.234
NP_441340.1_5 Reverse -347 -354 11.3472 0.0526
NP_442327.1_3 Forward -95 -76 8.73709 0.224
NP_442484.1_2 Reverse -335 -354 12.0942 0.0788
NP_439976.1_1 Forward -317 -305 15.7714 0.28
NP_442240.1_2 Reverse -136 -155 -20.65 0.295
NP_440586.1_8 Forward -354 -347 5.74197 0.283
NP_443051.1_1 Reverse -345 -354 5.3096 0.0964
NP_439937.1_9 Forward -323 -306 -6.84499 0.157
NP_439937.1_9 Reverse -311 -328 -12.3515 0.271
NP_439937.1_9 Forward -322 -305 -15.2031 0.287
NP_439937.1_9 Reverse -198 -215 -16.4814 0.287
NP_439937.1_9 Forward -279 -262 -16.678 0.287
NP_442294.1_3 Reverse -373 -387 12.8803 0.274
NP_439943.1_4 Forward -355 -336 4.42435 0.287
NP_441789.1_7 Forward -315 -296 -0.197979 0.251
NP_441789.1_7 Forward -312 -293 -1.96793 0.257
NP_441789.1_7 Forward -364 -345 -4.81951 0.288
NP_440819.1_5 Forward -211 -203 7.68924 0.266
NP_440316.1_10 Reverse -287 -297 6.07655 0.271
NP_442663.1_1 Forward -320 -301 3.34192 0.231
NP_441803.1_2 Reverse -341 -360 6.98095 0.146
NP_441572.1_7 Forward -361 -342 1.96607 0.14
NP_442384.1_10 Forward -355 -342 13.589 0.0195
NP_441877.1_7 Forward -253 -234 -0.29631 0.283
NP_441877.1_9 Forward -97 -80 3.87375 0.284
NP_442262.1_10 Forward -354 -347 12.0355 0.062
NP_442262.1_10 Forward -147 -140 8.20058 0.25
NP_440282.1_2 Forward -313 -294 6.88262 0.276
NP_440531.1_6 Forward -363 -344 4.12936 0.131
NP_440531.1_8 Reverse -296 -315 5.89931 0.249
NP_441060.1_4 Forward -317 -299 5.23069 0.242
NP_442910.1_1 Forward -328 -309 -6.88371 0.254
NP_440297.1_9 Forward -354 -344 -0.511621 0.289
NP_442280.1_10 Reverse -336 -354 12.2725 0.182
NP_441592.1_4 Forward -348 -329 -3.44213 0.281
NP_440894.1_10 Reverse -186 -205 2.75272 0.283
NP_443036.1_1 Forward -351 -332 8.75009 0.291
NP_443036.1_3 Forward -325 -308 14.4935 0.292
NP_440999.1_9 Forward -359 -345 2.16287 0.154
NP_440888.1_2 Reverse -346 -360 6.29216 0.241
NP_440888.1_2 Reverse -334 -348 6.19383 0.243
NP_440888.1_2 Forward -297 -283 5.50552 0.276
NP_442147.1_2 Reverse -303 -322 14.3558 0.159
NP_442147.1_7 Reverse -360 -379 10.5209 0.244
NP_439969.1_3 Forward -360 -341 1.76941 0.252
NP_441268.1_1 Forward -25 -6 11.9838 0.27
NP_442033.1_10 Reverse -231 -250 -10.227 0.23
NP_442710.1_7 Reverse -8 -27 -3.28224 0.263
NP_441306.1_10 Forward -357 -343 16.3219 0.247
NP_441462.1_2 Reverse -346 -356 -1.00328 0.274
NP_443062.1_1 Forward -297 -279 4.15809 0.272
NP_442204.1_1 Reverse -170 -181 0.353664 0.281
NP_442204.1_1 Reverse -284 -295 0.157002 0.283
NP_441351.1_8 Forward -364 -345 3.24438 0.232
NP_440516.1_2 Reverse -237 -255 10.7372 0.0831
NP_440516.1_8 Reverse -346 -355 -0.393597 0.255
NP_440516.1_8 Reverse -288 -297 -0.491928 0.262
NP_442428.1_5 Forward -354 -347 4.36568 0.271
NP_442859.1_2 Reverse -136 -155 8.06259 0.199
NP_442823.1_8 Forward -375 -356 12.2908 0.275
NP_440436.1_4 Reverse -248 -257 5.50585 0.195
NP_440436.1_4 Forward -45 -36 5.11253 0.222
NP_440436.1_4 Reverse -347 -356 4.42421 0.265
NP_441884.1_8 Reverse -345 -364 -5.31042 0.18
NP_441884.1_9 Forward -358 -339 -23.1083 0.284
NP_441004.1_1 Reverse -341 -360 -5.9004 0.18
NP_441004.1_1 Reverse -347 -366 -13.3736 0.257
NP_441004.1_4 Reverse -344 -354 13.8447 0.2
NP_442813.1_4 Reverse -338 -357 -9.14533 0.299
NP_442366.1_5 Reverse -343 -353 11.4843 0.18
NP_440296.1_10 Reverse -285 -304 -5.80207 0.225
NP_441115.1_4 Forward -253 -235 8.17984 0.257
NP_442208.1_5 Forward -225 -206 -7.86702 0.275
NP_441396.1_5 Reverse -306 -315 16.8143 0.199
NP_440593.1_3 Forward -360 -341 6.4893 0.112
NP_441982.1_6 Reverse -107 -116 13.2493 0.274
NP_441982.1_6 Reverse -59 -68 11.9124 0.288
NP_441982.1_6 Reverse -3 -12 11.9124 0.288
NP_441982.1_6 Forward -213 -204 11.3395 0.288
NP_441349.1_10 Reverse -153 -172 -6.78538 0.236
NP_440432.1_9 Forward -296 -281 1.84819 0.135
NP_442843.1_1 Forward -217 -198 -10.4236 0.278
NP_440474.1_8 Forward -170 -156 8.06211 0.193
NP_440431.1_3 Forward -74 -55 -8.55534 0.235
NP_442450.1_3 Reverse -75 -93 7.88485 0.211
NP_442450.1_5 Reverse -344 -354 4.89658 0.278
NP_441031.1_1 Reverse -75 -94 14.6316 0.1
NP_442006.1_2 Forward -349 -332 -6.84433 0.169
NP_441003.1_10 Reverse -343 -362 20.7473 0.098
NP_441570.1_1 Reverse -129 -147 -15.4188 0.23
NP_440078.1_4 Forward -182 -163 10.6192 0.25
NP_442348.1_2 Reverse -312 -321 14.1594 0.167
NP_442348.1_2 Reverse -145 -154 12.8811 0.218
NP_440707.1_9 Reverse -354 -373 5.89931 0.235
NP_442443.1_1 Reverse -357 -376 -4.72043 0.276
NP_440526.1_9 Reverse -286 -295 16.421 0.26
NP_442320.1_8 Forward -361 -347 4.42448 0.0504
NP_440497.1_6 Reverse -341 -360 -5.99873 0.264
NP_440578.1_10 Forward -60 -41 8.65258 0.286
NP_441057.1_3 Reverse -305 -324 -10.4236 0.214
NP_440713.1_4 Forward -353 -334 1.67108 0.282
NP_440713.1_7 Forward -80 -61 14.6326 0.239
NP_440713.1_7 Forward -98 -79 13.4757 0.239
NP_442489.1_7 Forward -355 -346 -1.47524 0.203
NP_442079.1_6 Reverse -154 -173 15.8307 0.273
NP_441659.2_8 Forward -355 -345 4.20827 0.142
NP_441022.1_1 Forward -76 -67 10.9707 0.284
NP_441040.1_5 Forward -283 -264 9.73422 0.226
NP_442849.1_1 Forward -212 -198 14.6509 0.201
NP_442346.1_5 Reverse -345 -355 7.15819 0.178
NP_440545.1_3 Forward -175 -158 5.64371 0.0607
NP_440545.1_3 Reverse -342 -359 -6.25434 0.273
NP_440831.1_1 Forward -361 -342 10.9142 0.277
NP_440459.1_2 Reverse -137 -154 8.39697 0.264
NP_441653.1_3 Reverse -315 -329 12.8809 0.279
NP_441948.1_3 Forward -87 -68 18.8121 0.16
NP_441047.1_2 Forward -224 -205 1.27776 0.239
NP_441329.1_6 Reverse -9 -28 -1.76702 0.293
NP_441895.1_10 Forward -214 -195 -27.6315 0.282
NP_442060.1_5 Reverse -333 -352 15.4374 0.235
NP_441973.1_1 Forward -48 -33 -7.98491 0.293
NP_442045.1_5 Reverse -337 -356 -0.4922 0.269
NP_442546.1_2 Reverse -199 -218 9.04509 0.14
NP_442140.1_3 Forward -354 -344 10.5014 0.0902
NP_442140.1_3 Reverse -347 -357 4.10993 0.261
NP_442254.1_1 Reverse -334 -353 -4.6221 0.282
NP_440590.1_4 Reverse -347 -360 1.69091 0.115
NP_440567.1_1 Reverse -347 -361 -0.393733 0.281
NP_442497.1_10 Forward -354 -345 0.29472 0.199
NP_440227.1_2 Reverse -54 -70 9.00665 0.29
NP_440227.1_6 Reverse -53 -67 14.6219 0.263
NP_441239.1_9 Forward -357 -345 16.2636 0.0175
NP_441239.1_9 Reverse -267 -279 6.03717 0.202
NP_441951.1_4 Reverse -340 -359 15.6341 0.168
NP_441892.1_1 Reverse -337 -354 3.48043 0.125
NP_441892.1_1 Forward -157 -140 -2.3211 0.22
NP_441892.1_1 Forward -364 -347 -6.05768 0.296
NP_442105.1_9 Forward -395 -381 17.8465 0.151
NP_440219.1_1 Forward -68 -49 15.8016 0.158
NP_440863.1_2 Reverse -58 -74 19.3917 0.112
NP_441541.1_1 Forward -97 -79 4.01265 0.171
NP_442138.1_10 Reverse -369 -388 -7.57203 0.29
NP_442052.1_8 Forward -173 -163 13.1564 0.253
NP_440546.1_4 Reverse -346 -356 12.8578 0.0572
NP_440546.1_4 Forward -355 -345 10.4338 0.109
NP_441230.1_5 Forward -360 -341 3.24438 0.204
NP_440462.1_6 Forward -357 -347 4.60159 0.194
NP_441474.1_1 Reverse -164 -183 -3.04956 0.29
NP_442402.1_2 Reverse -199 -213 13.5686 0.263
NP_442402.1_4 Reverse -306 -325 -5.21283 0.238
NP_442402.1_4 Reverse -194 -213 -6.09781 0.25
NP_442402.1_4 Reverse -195 -214 -7.96609 0.278
NP_441848.1_7 Forward -311 -292 -4.72118 0.298
NP_442679.1_1 Reverse -274 -293 -5.40875 0.293
NP_441203.1_1 Forward -354 -335 -19.7651 0.297
NP_441203.1_1 Reverse -334 -353 -20.5517 0.297
NP_441011.1_8 Reverse -347 -356 5.01461 0.289
NP_442533.1_1 Forward -227 -208 -17.7001 0.293
NP_442533.1_6 Reverse -346 -355 5.70292 0.132
NP_442533.1_6 Forward -355 -346 3.53964 0.21
NP_441089.1_10 Reverse -277 -296 2.16274 0.294
NP_442229.1_1 Forward -357 -343 7.27547 0.196
NP_441697.1_5 Forward -83 -64 -0.239153 0.198
NP_441697.1_5 Forward -82 -63 -4.34531 0.22
NP_441697.1_5 Forward -100 -81 -11.4117 0.295
NP_441028.1_6 Reverse -204 -214 19.1541 0.132
NP_441028.1_6 Forward -26 -16 12.0743 0.192
NP_441028.1_6 Forward -302 -292 4.10949 0.278
NP_441028.1_6 Reverse -370 -380 3.8145 0.281
NP_441527.1_4 Reverse -37 -56 -13.1306 0.298
NP_440115.1_6 Forward -259 -249 6.66654 0.172
NP_441972.1_5 Forward -354 -335 10.1275 0.0616
NP_441106.1_1 Forward -356 -347 4.52295 0.219
NP_441705.1_3 Forward -225 -206 -1.47551 0.279
NP_441930.1_2 Reverse -313 -323 12.0747 0.266
NP_440886.1_7 Forward -298 -288 4.60114 0.227
NP_442382.1_9 Forward -21 -2 7.66846 0.29
NP_439995.1_4 Forward -377 -358 16.1249 0.28
NP_442072.1_9 Reverse -345 -363 -14.3372 0.142
NP_440513.1_8 Reverse -32 -51 20.9916 0.0697
NP_442022.1_4 Forward -291 -272 7.57094 0.268
NP_440907.2_8 Forward -354 -344 4.69947 0.25
NP_441988.1_10 Reverse -348 -360 17.1486 0.278
NP_441401.1_8 Reverse -13 -32 16.9008 0.0879
NP_441431.1_2 Forward -358 -344 15.8302 0.0441
NP_441431.1_2 Reverse -343 -357 8.16044 0.222
NP_441488.1_8 Reverse -341 -355 11.897 0.146
NP_442647.1_7 Forward -360 -347 5.32916 0.295
NP_441174.1_4 Reverse -16 -26 9.51814 0.298
NP_442805.1_5 Forward -332 -313 -6.09781 0.284
NP_442684.1_9 Reverse -155 -174 19.0748 0.102
NP_441206.1_4 Forward -379 -360 -4.52377 0.263
NP_440287.1_5 Reverse -193 -212 12.3883 0.23
NP_441272.1_7 Reverse -302 -312 13.648 0.257
NP_440293.1_3 Reverse -145 -164 -3.24547 0.244
NP_440766.1_4 Reverse -342 -356 3.04785 0.159
NP_441421.1_6 Reverse -81 -98 13.039 0.224
NP_441421.1_6 Reverse -63 -80 11.5112 0.277
NP_439988.1_3 Reverse -335 -349 6.19444 0.278
NP_442930.1_1 Reverse -51 -61 11.091 0.26
NP_440457.1_1 Reverse -342 -354 1.80894 0.223
NP_440798.1_6 Forward -354 -341 1.78924 0.197
NP_440801.1_8 Forward -330 -311 2.75272 0.229
NP_440801.1_10 Reverse -342 -361 8.16093 0.272
NP_440142.1_9 Reverse -196 -210 20.9434 0.076
NP_441436.1_6 Reverse -346 -365 8.06259 0.26
NP_442509.1_9 Forward -321 -311 8.04271 0.192
NP_440554.1_4 Reverse -347 -357 3.32329 0.234
NP_440554.1_4 Forward -296 -286 2.24165 0.271
NP_441885.1_5 Reverse -346 -356 -1.29827 0.259
NP_442341.1_7 Reverse -345 -359 6.19444 0.134
NP_442341.1_9 Reverse -160 -174 6.29216 0.233
NP_442341.1_9 Forward -174 -160 5.01387 0.284
NP_441756.1_5 Forward -359 -340 -3.73712 0.29
NP_441173.1_9 Reverse -205 -213 11.3271 0.226
NP_440191.1_4 Reverse -205 -215 13.439 0.282
NP_440191.1_4 Forward -11 -1 12.5664 0.291
NP_443000.1_7 Forward -254 -244 4.50326 0.188
NP_441307.1_4 Reverse -299 -318 -1.67217 0.293
NP_441902.1_3 Forward -213 -203 14.5365 0.218
NP_441359.1_5 Reverse -343 -362 0.687771 0.29
NP_439962.1_4 Reverse -338 -357 -8.35868 0.293
NP_442495.1_4 Reverse -287 -297 12.4681 0.226
NP_442495.1_4 Forward -351 -341 11.2881 0.28
NP_441105.1_3 Forward -354 -335 -8.06369 0.265
NP_442290.1_3 Reverse -189 -208 13.1758 0.237
NP_441226.1_7 Reverse -347 -354 12.4284 0.0404
NP_440416.1_9 Reverse -339 -358 -12.0953 0.155
NP_443052.1_8 Forward -388 -369 -6.49039 0.143
NP_443052.1_8 Forward -365 -346 -10.817 0.216
NP_443052.1_9 Forward -372 -353 5.80098 0.139
NP_443052.1_9 Forward -366 -347 4.03102 0.157
NP_443052.1_9 Reverse -336 -355 -1.67217 0.231
NP_443052.1_9 Reverse -348 -367 -3.93378 0.253
NP_443052.1_9 Forward -375 -356 -7.27704 0.295
NP_442116.1_6 Reverse -55 -72 10.5563 0.219
NP_442116.1_6 Reverse -56 -73 10.4608 0.221
NP_442116.1_6 Reverse -1 -18 5.78166 0.291
NP_442154.1_1 Reverse -294 -312 -18.5654 0.282
NP_440261.1_5 Forward -354 -341 -2.63565 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGACTAACCAGGAGGGCAAAACGGTGGTCAACCTCTGCCTCCAGCACCGATGGCCCAGGGGGAGGCTTCAAACTACTGGGCAAATCCCCCACAAAACACTGCACCCCATCTCCTGTTTGTTGGGCCAGGGTACGCCAAAAACGGAGCAAGCGTTCAAAGGTGACAGCAGGTAAGAGTCGACGGAAAATGGGGGAAAAAGCGGGTAGCATGCCGAATTGAACATAGACTGGGCGGCGGCATTCAACGACCAAGCCCCATGGATTTCTATTTCCATCATGCCTAGGTTTTTGCCTAACCCTTCAAAATCTAAGTATTTTTAAAGATCTAAGATTTTTTTAAGGAAATTATTTATCTAGCCCTTGTCAGTCCATGGATTTATCTCCATATATTTTCAACTATT

CDS

ATGCATCGTCTTGCTAGTCTTCCCGGTGGTTGGACCCCGGCCATGGAAGGGGTTATTATCGTTGAGCAAACTCCTGCGCCGCTAATTTTTTTAACCGCCGCTGACACTGATATCCAGGCAATCGCCAGGGTGTGGCCCCGATTGCCCGGGGATTTTCCCGATCTGCGGGTTTGTAATCTGCTGAATTTGCAACAGTCTTTTTCCCTCGATGACTACGGCGATCGGGTATTGGGCCAAGCAGAGGTAATTGTGGTGCGGCTGTTGGGGGGAAAAAGCTATTGGCCCTACGGCTTGGAAGTATTGGGGGAACTAACGGTAACCAAACCAGATCTGAAATTATTTGTCTTGCCGGGGGACGATCGCCCAGATCCCTCCCTGATGAACCAGTCCACAGTGCCCCTCACCGCAGTCCATTGCCTGTGGCAATATTTTGCCGAGGGGGGAACGGATAATATTCGCCATGGCTTGATGTGGTTGGGGGACTACGGTTTTGGTCGCAATTATCGGCCCCCTGCCCCCCAAATGGTGCCAAAAGTGGGGATTTATCGTCCTTAG

Protein

MHRLASLPGGWTPAMEGVIIVEQTPAPLIFLTAADTDIQAIARVWPRLPGDFPDLRVCNLLNLQQSFSLDDYGDRVLGQAEVIVVRLLGGKSYWPYGLEVLGELTVTKPDLKLFVLPGDDRPDPSLMNQSTVPLTAVHCLWQYFAEGGTDNIRHGLMWLGDYGFGRNYRPPAPQMVPKVGIYRP