Your browser is old and dusty. Try Google Chrome!

Details for sll1873

ORF sll1873
Accession NP_441541.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -216 -202 14.4542 0.138
NP_441061.1_2 Forward -366 -352 2.35953 0.177
NP_441061.1_2 Reverse -331 -345 1.08123 0.195
NP_441061.1_8 Forward -80 -61 17.2853 0.098
NP_441418.1_6 Reverse -223 -242 -13.6686 0.0777
NP_441418.1_6 Reverse -363 -382 -30.1882 0.262
NP_441453.1_4 Forward -339 -331 5.0343 0.209
NP_442151.1_6 Reverse -357 -371 6.78443 0.221
NP_441818.1_9 Forward -216 -197 -4.81876 0.244
NP_441818.1_9 Reverse -271 -290 -6.78538 0.265
NP_440996.1_3 Reverse -23 -41 12.1139 0.221
NP_442752.1_4 Reverse -330 -337 4.26735 0.293
NP_442752.1_4 Forward -216 -209 4.26735 0.293
NP_443027.1_4 Forward -218 -208 11.3864 0.107
NP_440061.1_9 Reverse -191 -205 10.422 0.124
NP_441054.1_2 Forward -178 -159 9.63589 0.288
NP_439979.1_9 Reverse -358 -376 8.37728 0.263
NP_441859.1_3 Reverse -258 -277 1.57197 0.281
NP_442972.1_1 Reverse -38 -56 13.0562 0.221
NP_440304.1_4 Forward -234 -224 4.99491 0.239
NP_440304.1_4 Reverse -81 -91 4.60159 0.258
NP_440304.1_4 Reverse -257 -267 3.61828 0.295
NP_442242.1_4 Forward -215 -208 10.0689 0.174
NP_440044.1_8 Reverse -208 -227 1.37609 0.175
NP_440916.1_1 Reverse -161 -175 11.7993 0.206
NP_439918.1_3 Forward -325 -306 4.32602 0.264
NP_441208.1_1 Reverse -246 -265 -6.49039 0.287
NP_441925.1_4 Forward -254 -235 -8.75273 0.212
NP_440014.1_7 Reverse -321 -335 16.2235 0.225
NP_441083.1_5 Reverse -330 -340 5.38824 0.12
NP_441083.1_5 Forward -339 -329 -0.806614 0.28
NP_442827.1_8 Reverse -322 -341 8.94676 0.0747
NP_441558.1_1 Reverse -65 -84 9.63589 0.256
NP_440209.1_1 Forward -216 -208 5.13263 0.17
NP_440178.1_7 Reverse -288 -307 -20.0601 0.184
NP_440906.1_5 Reverse -208 -215 9.47889 0.116
NP_440747.1_10 Reverse -204 -216 -12.1541 0.227
NP_441486.1_1 Reverse -141 -155 -1.5737 0.173
NP_442634.1_4 Reverse -205 -219 5.01447 0.0671
NP_441634.1_8 Forward -357 -343 4.03116 0.138
NP_441634.1_8 Reverse -367 -381 -2.95034 0.295
NP_441634.1_9 Reverse -347 -366 8.35677 0.294
NP_440376.1_1 Forward -298 -289 4.22796 0.166
NP_440376.1_1 Forward -204 -195 -0.196935 0.285
NP_442687.1_7 Forward -233 -223 7.05986 0.142
NP_442687.1_7 Reverse -329 -339 5.5849 0.194
NP_442583.1_1 Reverse -85 -104 14.5524 0.203
NP_441422.1_7 Reverse -287 -304 -4.48438 0.245
NP_440667.1_2 Reverse -83 -102 -3.44213 0.232
NP_440141.1_8 Reverse -364 -383 6.29264 0.265
NP_442782.1_2 Forward -216 -202 6.48943 0.223
NP_441958.1_5 Reverse -329 -339 7.25653 0.0347
NP_441958.1_5 Forward -217 -207 0.668351 0.134
NP_440203.1_5 Forward -358 -348 11.1893 0.202
NP_440203.1_5 Forward -336 -326 10.4026 0.225
NP_439905.1_1 Forward -338 -325 14.2773 0.131
NP_442690.1_1 Forward -84 -65 -15.1435 0.278
NP_443055.1_6 Forward -339 -321 8.3765 0.142
NP_441099.1_5 Forward -349 -330 -0.688862 0.0964
NP_441099.1_5 Forward -371 -352 -8.45701 0.194
NP_442002.1_9 Reverse -329 -336 14.1004 0.074
NP_441294.1_7 Forward -108 -94 8.57871 0.294
NP_442431.1_10 Reverse -265 -283 0.117479 0.281
NP_442885.1_5 Reverse -140 -159 15.3382 0.236
NP_440147.1_4 Reverse -328 -341 6.50913 0.0911
NP_441550.1_8 Reverse -328 -338 13.4509 0.0248
NP_441550.1_8 Forward -341 -331 8.43603 0.124
NP_441331.1_1 Reverse -218 -237 -1.57384 0.255
NP_441916.1_10 Reverse -251 -270 0.491109 0.281
NP_441041.1_4 Reverse -358 -377 -12.7836 0.274
NP_441725.1_4 Reverse -202 -216 2.16228 0.291
NP_441725.1_5 Reverse -224 -234 0.176696 0.206
NP_441725.1_5 Forward -91 -81 -0.806614 0.271
NP_441725.1_5 Forward -338 -328 -0.904945 0.274
NP_439966.1_7 Forward -380 -370 4.40448 0.273
NP_442941.1_3 Forward -215 -205 4.3066 0.14
NP_442941.1_3 Reverse -208 -218 0.668351 0.19
NP_440260.1_8 Reverse -86 -104 -3.52077 0.252
NP_441678.1_9 Reverse -252 -271 -5.50708 0.297
NP_442281.1_1 Forward -344 -330 4.03056 0.21
NP_440498.1_4 Reverse -289 -308 15.2408 0.104
NP_442068.1_6 Forward -113 -95 16.2438 0.137
NP_441644.1_6 Forward -339 -329 3.22451 0.293
NP_442029.1_6 Forward -366 -347 5.40766 0.25
NP_442029.1_6 Forward -132 -113 3.93269 0.274
NP_440566.1_2 Reverse -9 -28 5.40766 0.282
NP_442933.1_10 Reverse -207 -216 4.52295 0.24
NP_442933.1_10 Forward -339 -330 4.42462 0.246
NP_442933.1_10 Forward -216 -207 4.22796 0.267
NP_442970.1_7 Reverse -66 -85 23.2128 0.0365
NP_440919.1_1 Reverse -325 -344 -2.75381 0.221
NP_443009.1_5 Forward -233 -222 8.31797 0.112
NP_443009.1_5 Reverse -206 -217 5.17139 0.214
NP_442408.2_1 Forward -339 -320 5.80098 0.143
NP_442741.1_5 Forward -381 -362 17.7974 0.0822
NP_441715.1_4 Forward -297 -287 5.78156 0.18
NP_441715.1_4 Forward -215 -205 5.68323 0.189
NP_440357.1_6 Forward -280 -261 8.16093 0.272
NP_440730.1_10 Forward -262 -243 19.5664 0.12
NP_441618.1_6 Forward -315 -296 8.25926 0.3
NP_441015.1_10 Reverse -358 -377 -2.36049 0.178
NP_441826.1_2 Forward -238 -224 -2.16369 0.267
NP_442719.1_2 Forward -54 -36 -2.04653 0.182
NP_441056.1_1 Forward -378 -359 -7.57203 0.274
NP_441612.1_2 Forward -16 -6 6.32259 0.294
NP_442718.1_2 Reverse -204 -223 -5.9004 0.295
NP_440558.1_2 Reverse -348 -367 -3.54046 0.236
NP_440558.1_2 Forward -364 -345 -4.22878 0.243
NP_440558.1_2 Forward -271 -252 -5.50708 0.26
NP_441878.1_6 Reverse -82 -92 1.06167 0.116
NP_441878.1_6 Reverse -372 -382 -7.78811 0.266
NP_441036.1_8 Reverse -325 -335 7.84651 0.183
NP_441036.1_9 Reverse -64 -82 7.78729 0.235
NP_441557.1_5 Reverse -330 -339 -0.786921 0.239
NP_441557.1_5 Forward -216 -207 -0.885252 0.26
NP_441520.1_8 Reverse -86 -105 15.5357 0.105
NP_441445.1_1 Reverse -86 -105 3.04771 0.22
NP_441739.1_2 Forward -34 -18 3.20445 0.281
NP_440101.1_3 Reverse -325 -344 2.0644 0.259
NP_441116.1_9 Forward -170 -156 13.8643 0.233
NP_441574.1_1 Forward -322 -303 -5.80207 0.268
NP_442347.1_2 Forward -338 -329 3.44131 0.284
NP_442645.1_2 Forward -306 -287 -15.0452 0.189
NP_442594.1_8 Forward -171 -152 12.0942 0.161
NP_442594.1_8 Reverse -233 -252 6.39097 0.233
NP_441633.1_3 Forward -290 -277 1.69091 0.109
NP_441633.1_3 Forward -341 -328 -6.2739 0.242
NP_441633.1_3 Forward -371 -358 -6.37223 0.248
NP_442998.1_10 Forward -337 -330 5.93897 0.206
NP_442998.1_10 Reverse -209 -216 5.93897 0.206
NP_442998.1_10 Reverse -97 -104 4.16902 0.259
NP_440299.1_1 Reverse -303 -316 6.50855 0.139
NP_441007.1_10 Reverse -325 -338 -0.177378 0.268
NP_440256.1_1 Reverse -204 -223 -7.67036 0.243
NP_441559.1_8 Reverse -100 -114 -7.57189 0.295
NP_442756.1_2 Reverse -87 -106 5.99764 0.27
NP_440915.1_6 Reverse -203 -217 -1.5737 0.239
NP_440717.1_1 Forward -338 -319 22.4189 0.0374
NP_441866.1_6 Reverse -305 -324 6.58682 0.285
NP_442866.1_1 Forward -327 -308 -2.75381 0.214
NP_440748.1_5 Forward -101 -82 -2.16383 0.271
NP_441464.1_8 Reverse -289 -303 7.66941 0.206
NP_441464.1_8 Forward -104 -90 4.22782 0.28
NP_440570.1_5 Reverse -297 -316 -2.75381 0.28
NP_441340.1_5 Forward -103 -96 8.8889 0.084
NP_442240.1_2 Reverse -317 -336 -16.4218 0.246
NP_440161.1_3 Reverse -205 -224 10.5209 0.23
NP_440586.1_1 Reverse -20 -39 8.06259 0.182
NP_440586.1_8 Forward -215 -208 9.3802 0.156
NP_440684.1_9 Forward -345 -331 6.98109 0.283
NP_443051.1_1 Reverse -329 -338 5.40793 0.0926
NP_443051.1_1 Forward -217 -208 0.196389 0.213
NP_439937.1_8 Reverse -358 -377 -2.95047 0.264
NP_439937.1_9 Forward -362 -345 -12.6465 0.274
NP_440372.1_2 Reverse -331 -338 4.07068 0.262
NP_440819.1_5 Reverse -250 -258 7.98423 0.228
NP_442488.1_3 Reverse -230 -249 15.5357 0.167
NP_440267.1_1 Reverse -63 -79 17.2908 0.295
NP_442384.1_10 Forward -339 -326 6.90245 0.092
NP_442384.1_10 Reverse -207 -220 1.49425 0.257
NP_442235.1_3 Forward -343 -324 11.8975 0.0924
NP_440562.1_3 Forward -215 -198 4.07041 0.204
NP_440297.1_9 Forward -91 -81 0.176696 0.282
NP_440350.1_1 Reverse -311 -330 -1.08219 0.235
NP_440999.1_9 Reverse -278 -292 0.982901 0.172
NP_440999.1_9 Forward -343 -329 0.294584 0.189
NP_440999.1_9 Reverse -203 -217 -0.492064 0.209
NP_440999.1_9 Reverse -285 -299 -2.65535 0.273
NP_440888.1_2 Forward -361 -347 8.65209 0.152
NP_440888.1_2 Forward -298 -284 5.89884 0.258
NP_441917.1_2 Forward -186 -168 8.57394 0.28
NP_441543.1_2 Reverse -280 -289 10.8161 0.0666
NP_441543.1_2 Forward -287 -278 4.0313 0.293
NP_441319.1_8 Reverse -301 -319 6.11567 0.272
NP_442315.1_2 Forward -164 -152 9.97041 0.291
NP_443064.1_6 Reverse -330 -340 11.6943 0.124
NP_441462.1_2 Forward -216 -206 0.0783647 0.168
NP_441462.1_2 Reverse -330 -340 -0.904945 0.265
NP_443062.1_1 Reverse -207 -225 8.2534 0.157
NP_443062.1_1 Forward -378 -360 6.20575 0.206
NP_443062.1_6 Forward -240 -221 7.66927 0.162
NP_440519.1_8 Reverse -223 -239 1.63183 0.28
NP_442204.1_1 Reverse -203 -214 0.157002 0.283
NP_442204.1_1 Forward -220 -209 -0.236322 0.289
NP_442204.1_5 Forward -298 -279 0.196116 0.27
NP_441351.1_1 Forward -175 -156 9.53756 0.259
NP_442872.1_1 Forward -255 -236 -11.6036 0.252
NP_440516.1_8 Reverse -330 -339 -0.295266 0.232
NP_442120.1_10 Reverse -83 -102 -9.93197 0.247
NP_440673.1_3 Reverse -146 -153 10.5605 0.123
NP_440673.1_3 Forward -337 -330 10.1672 0.149
NP_440673.1_3 Reverse -209 -216 10.1672 0.149
NP_440673.1_8 Forward -315 -298 18.1317 0.206
NP_440436.1_4 Reverse -145 -154 6.48915 0.157
NP_441884.1_9 Forward -342 -323 -24.0916 0.284
NP_442813.1_2 Reverse -85 -104 4.52268 0.191
NP_442366.1_3 Forward -323 -305 -5.38906 0.287
NP_440129.1_10 Forward -239 -225 3.34284 0.214
NP_441115.1_4 Forward -217 -199 7.29487 0.291
NP_442854.1_4 Reverse -169 -188 11.5033 0.253
NP_442622.1_1 Reverse -312 -331 -11.8986 0.257
NP_442689.1_8 Forward -80 -63 0.432165 0.191
NP_441349.1_10 Reverse -279 -298 -5.70374 0.21
NP_441394.1_10 Reverse -159 -177 11.2281 0.263
NP_440432.1_9 Forward -91 -76 -6.01829 0.28
NP_442843.1_1 Forward -103 -84 -4.22878 0.235
NP_440474.1_8 Reverse -374 -388 4.62054 0.271
NP_441124.1_5 Reverse -60 -70 10.1434 0.297
NP_440943.1_5 Forward -270 -256 16.2242 0.22
NP_440483.1_1 Reverse -365 -384 -2.95047 0.208
NP_441570.1_1 Reverse -207 -225 -4.30741 0.0743
NP_441078.1_4 Reverse -279 -288 5.99792 0.0932
NP_441078.1_4 Forward -288 -279 5.70292 0.111
NP_441432.1_8 Forward -217 -208 4.12963 0.237
NP_441432.1_8 Reverse -351 -360 2.65466 0.292
NP_441432.1_8 Reverse -258 -267 2.65466 0.292
NP_441432.1_8 Reverse -329 -338 2.55633 0.298
NP_442320.1_8 Reverse -273 -287 -3.34366 0.117
NP_440199.1_10 Forward -150 -140 6.76487 0.269
NP_442400.1_10 Reverse -66 -79 9.51548 0.271
NP_442489.1_7 Forward -298 -289 -1.6719 0.235
NP_440559.1_1 Reverse -331 -340 5.01461 0.161
NP_441659.2_8 Forward -339 -329 4.10993 0.144
NP_442913.1_10 Reverse -321 -340 -2.16383 0.182
NP_440336.1_4 Reverse -72 -91 19.1731 0.048
NP_440779.1_5 Forward -339 -322 -14.6125 0.254
NP_442346.1_5 Forward -217 -207 11.0914 0.0764
NP_442346.1_5 Forward -154 -144 9.12481 0.118
NP_442346.1_5 Reverse -329 -339 4.99491 0.267
NP_440545.1_3 Reverse -249 -266 -6.15601 0.27
NP_441856.1_5 Reverse -99 -118 14.9449 0.276
NP_441629.1_3 Forward -373 -354 -3.93454 0.29
NP_442603.1_7 Forward -339 -325 8.3571 0.176
NP_440449.1_6 Forward -387 -369 4.46257 0.297
NP_441833.1_4 Reverse -208 -215 4.46401 0.256
NP_441329.1_6 Reverse -62 -81 3.96249 0.212
NP_440671.1_4 Reverse -363 -377 5.30946 0.286
NP_441696.1_6 Forward -38 -19 0.0977854 0.294
NP_442497.1_10 Forward -338 -329 0.196389 0.208
NP_440821.1_4 Reverse -328 -338 0.0783647 0.205
NP_440227.1_2 Forward -72 -56 7.04003 0.295
NP_440227.1_10 Reverse -144 -163 11.5033 0.225
NP_441239.1_9 Forward -384 -372 6.72548 0.178
NP_441892.1_1 Reverse -364 -381 1.51381 0.152
NP_442193.1_3 Reverse -84 -103 15.2111 0.294
NP_441874.1_1 Forward -181 -167 15.8309 0.165
NP_441541.1_2 Forward -79 -60 18.0541 0.122
NP_441541.1_5 Forward -187 -168 16.7157 0.265
NP_440833.1_6 Reverse -159 -173 8.55376 0.272
NP_440833.1_6 Forward -48 -34 6.98048 0.292
NP_442138.1_10 Reverse -207 -226 -0.295539 0.15
NP_440675.1_1 Reverse -220 -239 3.14605 0.254
NP_442340.1_3 Reverse -146 -165 -10.227 0.284
NP_440868.1_4 Forward -382 -370 2.49725 0.153
NP_440868.1_4 Reverse -326 -338 0.0389777 0.234
NP_441204.1_1 Reverse -363 -382 7.66927 0.25
NP_441474.1_1 Reverse -197 -216 12.4867 0.18
NP_442402.1_4 Reverse -142 -161 1.37531 0.173
NP_442402.1_10 Reverse -164 -174 13.8442 0.182
NP_441848.1_4 Reverse -65 -81 12.1343 0.211
NP_440696.1_3 Forward -114 -96 1.39578 0.217
NP_442053.1_1 Reverse -7 -16 5.99792 0.153
NP_440505.1_3 Forward -106 -96 5.97822 0.202
NP_441102.1_1 Reverse -224 -243 7.86593 0.212
NP_440914.1_1 Reverse -352 -362 8.41992 0.191
NP_442101.1_10 Reverse -199 -218 -7.96535 0.224
NP_442533.1_6 Reverse -330 -339 2.85133 0.236
NP_442533.1_6 Forward -216 -207 2.75299 0.241
NP_441482.1_7 Forward -238 -224 -11.8001 0.284
NP_442269.1_10 Forward -215 -196 4.32602 0.248
NP_441028.1_6 Forward -259 -249 3.42118 0.296
NP_440116.1_8 Forward -215 -196 -1.18052 0.117
NP_440116.1_8 Reverse -96 -115 -4.72043 0.178
NP_440115.1_6 Reverse -327 -337 15.418 0.0453
NP_440115.1_6 Forward -219 -209 4.60159 0.293
NP_441972.1_5 Reverse -358 -377 -9.24366 0.282
NP_441972.1_5 Forward -109 -90 -9.83364 0.293
NP_441106.1_1 Reverse -206 -215 4.42462 0.226
NP_441825.1_4 Reverse -25 -35 11.6814 0.255
NP_439903.1_6 Reverse -204 -223 5.99684 0.173
NP_442588.1_1 Reverse -18 -37 19.6656 0.125
NP_442306.1_10 Forward -293 -274 -9.44032 0.11
NP_441186.1_4 Reverse -70 -80 15.6142 0.232
NP_441286.1_1 Forward -340 -328 -4.58258 0.165
NP_440886.1_7 Reverse -278 -288 6.86274 0.113
NP_440886.1_7 Reverse -288 -298 3.91283 0.26
NP_440460.1_10 Reverse -329 -348 14.6508 0.269
NP_442072.1_9 Reverse -329 -347 -12.3706 0.0852
NP_441753.1_10 Reverse -354 -373 1.0811 0.277
NP_440907.2_8 Reverse -151 -161 8.43603 0.117
NP_440907.2_8 Forward -338 -328 8.04271 0.117
NP_442264.1_2 Reverse -140 -157 8.10198 0.222
NP_441021.1_1 Reverse -331 -350 -12.7836 0.295
NP_440841.1_4 Reverse -350 -369 1.96607 0.118
NP_441463.1_3 Forward -226 -207 3.04771 0.107
NP_441463.1_3 Forward -278 -259 -5.21209 0.222
NP_441463.1_3 Forward -102 -83 -6.29373 0.243
NP_441463.1_3 Reverse -306 -325 -7.17871 0.255
NP_442794.1_1 Forward -125 -113 2.89058 0.286
NP_440634.1_8 Forward -254 -235 2.75194 0.285
NP_441993.1_1 Forward -304 -285 0.679741 0.294
NP_441425.1_3 Reverse -76 -86 16.4996 0.273
NP_441817.1_10 Reverse -328 -347 20.059 0.148
NP_442323.1_7 Forward -238 -219 6.78348 0.19
NP_442324.1_7 Forward -223 -204 6.62992 0.268
NP_440766.1_4 Forward -125 -111 2.65453 0.176
NP_442743.1_1 Reverse -297 -316 4.81688 0.288
NP_442867.1_8 Forward -29 -10 5.211 0.276
NP_442278.1_3 Reverse -310 -328 17.4044 0.256
NP_440457.1_1 Reverse -326 -338 2.49725 0.21
NP_440798.1_6 Forward -338 -325 1.9859 0.188
NP_441332.1_6 Forward -380 -370 13.6798 0.184
NP_440473.1_9 Reverse -319 -338 -1.27885 0.144
NP_441489.1_3 Reverse -67 -81 7.55548 0.261
NP_441885.1_5 Reverse -330 -340 7.94484 0.0385
NP_441428.1_8 Forward -368 -349 7.96426 0.206
NP_442341.1_7 Reverse -278 -292 1.57289 0.286
NP_442341.1_7 Reverse -101 -115 1.08123 0.299
NP_441173.1_9 Reverse -69 -77 10.6388 0.261
NP_441173.1_9 Forward -258 -250 9.75379 0.284
NP_443000.1_7 Reverse -205 -215 7.05986 0.102
NP_443000.1_7 Forward -218 -208 4.79825 0.169
NP_443000.1_7 Reverse -311 -321 1.55333 0.244
NP_440507.2_3 Reverse -270 -289 10.2251 0.208
NP_441842.1_10 Reverse -323 -337 8.16106 0.233
NP_440275.1_3 Reverse -328 -338 7.25653 0.0823
NP_443010.1_8 Reverse -361 -380 18.1907 0.217
NP_443010.1_10 Reverse -327 -344 3.15733 0.261
NP_440216.1_1 Reverse -279 -293 -10.9151 0.153
NP_440216.1_1 Forward -216 -202 -12.2918 0.256
NP_440216.1_9 Forward -201 -192 9.4395 0.286
NP_440216.1_9 Forward -102 -93 5.50626 0.292
NP_440172.1_1 Forward -216 -206 7.15819 0.0897
NP_440172.1_1 Reverse -330 -340 4.69992 0.171
NP_440172.1_1 Forward -232 -222 2.43831 0.279
NP_442371.1_2 Forward -85 -68 17.5752 0.281
NP_442015.1_3 Reverse -197 -216 10.7167 0.296
NP_442379.1_10 Forward -346 -329 -1.63279 0.223
NP_442252.1_3 Forward -121 -103 8.37728 0.259
NP_440416.1_9 Forward -362 -343 -11.1119 0.148
NP_440591.1_9 Reverse -362 -380 7.78729 0.195
NP_440261.1_5 Forward -338 -325 6.31247 0.038
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TATGGATGAAGACTTAACTGCCCTCGACCCCTATGGTCTCCGCATTGCCATCCAAGATAGTACTGATCGCCCCCAGGCAGTGAAAGCTTTGGTCAAAGAGTTGGAGACTGCCGGTTATAGCCGCATCAACGTAGTCAGTGCCTTTTCCCCGCCCTTACAAACCACCAGGGTAATTGCTCAACAAGGCGATCATTTGGGGGCCAGGCAAGTACGCAATAGTATTGGTCTGGGGGAAGTTTTAGTGGATAGCAATGGTTATCTGATTTCCGACGTTACCATTCAAATCGGGGCTGACTGGCCATAGGAAATTCCAGCGCCCTATTTTTGTTAAAATTCAGTCACAATTAGTTTGTACACAATTCACCATAAAATCCCGCCCAATTAGGAGAACCACATTAAA

CDS

ATGTTAAAAAAATTGTTTGGCGCTAAAAAAGAATTTTACGTCCAGTTAGATGAAAGCCAAGCCCCCGCCCAGGTGGAAGAGGCCGACGTGGCGATCGTAAAATCGGAGGTAGCTCCGGTGGAAAAACCGGCTCCGACCACTTCGAAAAAAACTTCCATTAAGAAAAAGTCTGCTACTAAAGCGGCTGCCCCAGTGGAAACTCCTGCCTCCGCTCCAGTGGCCCCGGCTCCCAAGGCCAAAGTTGATCCCAGCCAGGTGGCCTTTGCTAGTGGTGACCCCATTCCCCAAAATGTTGCTCGTCGTACCCCTGGCCCTAGTTTGAATCGTTTCAAGGAAATGGCTCGCCAAGTTAAGGTTAAACGCTAA

Protein

MLKKLFGAKKEFYVQLDESQAPAQVEEADVAIVKSEVAPVEKPAPTTSKKTSIKKKSATKAAAPVETPASAPVAPAPKAKVDPSQVAFASGDPIPQNVARRTPGPSLNRFKEMARQVKVKR