Your browser is old and dusty. Try Google Chrome!

Details for sll1869

ORF sll1869
Accession NP_441547.1
Symbol
Category Other
Definition probable dioxygenase, Rieske iron-sulfur component
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440694.1_6 Forward -315 -296 9.53756 0.203
NP_440897.1_9 Reverse -195 -213 14.178 0.215
NP_442173.1_3 Reverse -48 -58 15.6147 0.287
NP_442861.1_4 Forward -39 -20 -1.08295 0.297
NP_439979.1_9 Reverse -225 -243 8.86894 0.26
NP_440518.1_3 Reverse -90 -109 7.96345 0.295
NP_441149.1_3 Reverse -144 -163 5.01433 0.238
NP_441149.1_9 Reverse -148 -167 1.27698 0.221
NP_441738.1_2 Reverse -300 -307 8.29857 0.176
NP_441558.1_5 Reverse -241 -260 4.32602 0.283
NP_442889.1_8 Reverse -240 -254 4.8172 0.25
NP_440056.1_9 Forward -113 -94 13.1894 0.295
NP_441713.1_1 Forward -91 -72 -15.1435 0.26
NP_441770.1_4 Forward -251 -232 -12.7836 0.297
NP_441770.1_5 Reverse -205 -224 -2.26216 0.285
NP_440178.1_7 Forward -204 -185 -12.5869 0.121
NP_442059.1_10 Reverse -222 -241 11.0125 0.239
NP_442570.1_3 Forward -260 -241 -1.18052 0.212
NP_441624.1_7 Reverse -303 -317 15.4376 0.154
NP_441533.1_9 Forward -348 -329 15.5357 0.3
NP_441209.1_4 Reverse -192 -211 14.2566 0.259
NP_440747.1_10 Reverse -306 -318 -12.3507 0.27
NP_441486.1_1 Reverse -191 -205 -2.36035 0.175
NP_443018.1_3 Forward -251 -244 10.2655 0.107
NP_441634.1_8 Forward -254 -240 -0.0987402 0.247
NP_440376.1_1 Forward -67 -58 1.57302 0.246
NP_442191.1_4 Reverse -375 -389 11.9627 0.233
NP_442485.1_3 Reverse -292 -311 2.0644 0.215
NP_441846.1_1 Forward -41 -22 10.6192 0.15
NP_440642.1_10 Forward -30 -16 5.21053 0.241
NP_441511.1_2 Reverse -354 -373 14.0608 0.156
NP_441763.1_10 Reverse -20 -39 5.99684 0.279
NP_440360.1_5 Reverse -234 -253 -2.36049 0.297
NP_442782.1_2 Forward -209 -195 10.226 0.179
NP_439959.1_6 Forward -172 -153 5.99764 0.274
NP_440203.1_2 Forward -214 -195 16.6174 0.201
NP_440203.1_5 Reverse -300 -310 9.51767 0.254
NP_443055.1_6 Reverse -235 -253 -0.276578 0.256
NP_443044.1_1 Reverse -227 -246 6.78429 0.261
NP_442853.1_5 Forward -26 -7 7.07848 0.281
NP_440377.1_1 Reverse -350 -367 10.5973 0.293
NP_441041.1_4 Forward -203 -184 -6.58872 0.169
NP_441547.1_2 Forward -214 -196 20.767 0.0651
NP_441547.1_3 Forward -244 -225 20.1564 0.146
NP_441725.1_4 Reverse -93 -107 2.5556 0.284
NP_441725.1_5 Reverse -195 -205 -0.216628 0.241
NP_440260.1_8 Forward -261 -243 -3.12744 0.249
NP_442281.1_1 Reverse -238 -252 3.53891 0.228
NP_442172.1_1 Reverse -349 -368 10.6537 0.279
NP_001035871.2_7 Forward -207 -197 16.893 0.137
NP_442500.1_9 Reverse -5 -24 17.994 0.189
NP_442500.1_9 Forward -385 -366 12.9791 0.294
NP_442049.1_2 Forward -215 -196 7.27595 0.257
NP_441556.1_10 Reverse -379 -393 11.8765 0.208
NP_442215.1_2 Reverse -192 -208 2.71347 0.111
NP_440929.1_8 Reverse -341 -350 0.786375 0.299
NP_440780.1_1 Reverse -96 -115 7.49569 0.274
NP_442554.1_8 Forward -251 -241 2.53664 0.268
NP_443009.1_5 Forward -394 -383 6.94134 0.144
NP_443009.1_5 Reverse -57 -68 4.18809 0.259
NP_440183.1_9 Forward -250 -231 -3.24547 0.176
NP_441379.1_2 Reverse -106 -125 7.47261 0.263
NP_442719.1_2 Reverse -78 -96 -1.6532 0.175
NP_441612.1_2 Forward -372 -362 13.2931 0.21
NP_441612.1_2 Forward -318 -308 10.6792 0.21
NP_442808.1_1 Forward -396 -386 2.14288 0.275
NP_440918.1_9 Reverse -109 -128 18.4112 0.105
NP_442718.1_2 Forward -182 -163 -6.78538 0.295
NP_442050.1_5 Forward -395 -385 9.22267 0.193
NP_440558.1_2 Reverse -170 -189 -2.45882 0.227
NP_440558.1_2 Reverse -191 -210 -3.93378 0.239
NP_442576.1_9 Forward -376 -362 18.728 0.125
NP_442789.1_5 Reverse -232 -251 1.17943 0.29
NP_441518.1_3 Reverse -233 -252 -8.85033 0.199
NP_441878.1_6 Forward -204 -194 -6.70647 0.194
NP_441878.1_6 Reverse -333 -343 -7.39479 0.222
NP_441878.1_6 Forward -344 -334 -7.49312 0.231
NP_441878.1_6 Forward -68 -58 -7.88644 0.278
NP_441557.1_8 Forward -235 -225 10.206 0.292
NP_442267.1_4 Forward -57 -38 -0.000545616 0.287
NP_442066.2_4 Reverse -334 -353 -0.787193 0.18
NP_442397.1_1 Forward -217 -203 16.327 0.24
NP_441574.1_1 Forward -264 -245 -4.91709 0.255
NP_441574.1_1 Forward -182 -163 -6.88371 0.281
NP_442998.1_5 Reverse -248 -258 11.3864 0.187
NP_441118.1_2 Forward -94 -75 11.2092 0.237
NP_440456.1_9 Reverse -287 -306 13.1758 0.103
NP_441559.1_8 Reverse -380 -394 2.85119 0.143
NP_441559.1_8 Reverse -47 -61 -1.18038 0.181
NP_441559.1_8 Reverse -293 -307 -5.31028 0.259
NP_441559.1_8 Reverse -93 -107 -5.90027 0.271
NP_441559.1_8 Reverse -303 -317 -6.68692 0.279
NP_441559.1_8 Reverse -292 -306 -6.78525 0.279
NP_440134.1_2 Reverse -225 -244 2.75272 0.298
NP_442452.1_3 Reverse -41 -60 0.0977854 0.298
NP_441464.1_8 Reverse -58 -72 11.8976 0.178
NP_440306.1_5 Reverse -17 -36 5.80098 0.121
NP_440695.1_6 Reverse -360 -374 10.8961 0.265
NP_442993.1_1 Forward -67 -51 -14.1995 0.297
NP_441952.1_9 Forward -148 -129 17.0038 0.231
NP_440211.1_4 Forward -198 -188 14.9263 0.258
NP_440586.1_8 Forward -251 -244 9.08521 0.178
NP_440586.1_8 Reverse -7 -14 7.1186 0.272
NP_440586.1_9 Reverse -65 -84 6.58763 0.283
NP_439937.1_9 Forward -308 -291 -1.14182 0.122
NP_439937.1_9 Forward -307 -290 -9.59824 0.196
NP_441181.1_4 Reverse -57 -76 16.5182 0.271
NP_441789.1_9 Forward -94 -75 11.9958 0.191
NP_441572.1_7 Reverse -46 -65 -4.6221 0.24
NP_442887.1_5 Forward -266 -247 -5.31042 0.264
NP_441877.1_5 Forward -261 -242 3.14605 0.237
NP_441877.1_7 Reverse -238 -257 2.85027 0.218
NP_442790.1_4 Forward -284 -265 -13.1769 0.259
NP_442262.1_10 Forward -251 -244 9.18389 0.211
NP_440297.1_9 Reverse -195 -205 7.45319 0.113
NP_440297.1_9 Forward -66 -56 -0.41329 0.283
NP_441592.1_10 Reverse -249 -263 15.4369 0.279
NP_440700.1_8 Forward -183 -169 11.701 0.28
NP_440990.1_8 Forward -245 -226 13.8641 0.287
NP_440894.1_10 Reverse -292 -311 3.53937 0.271
NP_440937.1_5 Forward -22 -3 9.14423 0.275
NP_442129.1_6 Forward -390 -371 13.1708 0.29
NP_441543.1_2 Forward -251 -242 4.81794 0.219
NP_442845.1_2 Forward -318 -304 5.99778 0.219
NP_441469.1_8 Reverse -57 -66 10.1278 0.227
NP_441548.1_4 Reverse -36 -55 22.418 0.032
NP_441548.1_8 Reverse -58 -76 21.4553 0.0274
NP_442578.1_7 Reverse -295 -302 6.72562 0.18
NP_442578.1_7 Reverse -17 -24 6.72562 0.18
NP_441929.1_6 Forward -196 -177 7.27595 0.294
NP_443062.1_1 Forward -252 -234 5.42569 0.229
NP_443062.1_6 Reverse -352 -371 3.04771 0.245
NP_442204.1_1 Reverse -48 -59 7.82682 0.112
NP_441351.1_8 Reverse -241 -260 1.96607 0.263
NP_440454.1_2 Reverse -22 -36 10.1338 0.291
NP_442120.1_10 Forward -264 -245 -4.22878 0.199
NP_442120.1_10 Forward -203 -184 -14.2585 0.288
NP_440673.1_2 Forward -262 -243 8.92631 0.26
NP_442577.1_9 Reverse -191 -205 15.2402 0.209
NP_441719.1_2 Forward -36 -22 13.925 0.278
NP_441004.1_1 Forward -222 -203 -16.9135 0.287
NP_442813.1_4 Reverse -279 -298 -7.76869 0.299
NP_442813.1_5 Reverse -381 -400 5.60432 0.217
NP_440328.1_4 Forward -21 -2 -1.27885 0.299
NP_441668.1_4 Forward -261 -242 -0.885524 0.263
NP_441982.1_6 Forward -374 -365 11.053 0.288
NP_442689.1_8 Forward -38 -21 -6.35267 0.281
NP_442843.1_1 Reverse -244 -263 -11.7019 0.291
NP_439960.1_10 Reverse -45 -63 -2.83245 0.258
NP_441124.1_5 Reverse -248 -258 12.7217 0.215
NP_442450.1_5 Reverse -56 -66 4.99491 0.271
NP_440195.1_4 Reverse -7 -26 4.12936 0.297
NP_440943.1_5 Forward -212 -198 11.0127 0.285
NP_442006.1_2 Reverse -341 -358 -8.90928 0.197
NP_441333.1_1 Forward -38 -28 11.5899 0.241
NP_441030.1_6 Forward -320 -301 13.044 0.23
NP_442797.1_1 Reverse -163 -182 -3.73712 0.283
NP_442797.1_1 Reverse -64 -83 -4.6221 0.286
NP_441805.1_6 Forward -178 -159 9.14423 0.261
NP_442010.1_1 Forward -368 -350 12.5064 0.239
NP_442913.1_10 Forward -76 -57 8.65258 0.0464
NP_440545.1_3 Forward -71 -54 -5.1727 0.242
NP_441923.1_8 Reverse -307 -321 11.701 0.286
NP_440459.1_2 Reverse -185 -202 8.59364 0.254
NP_440912.1_3 Forward -41 -22 7.96345 0.287
NP_441895.1_2 Reverse -342 -361 -7.76869 0.113
NP_441895.1_2 Forward -388 -369 -26.9432 0.275
NP_442404.1_9 Forward -303 -289 10.8154 0.263
NP_441973.1_1 Reverse -366 -381 1.06154 0.235
NP_441973.1_1 Forward -254 -239 0.27489 0.235
NP_442199.1_5 Reverse -235 -254 -4.52377 0.229
NP_441609.1_1 Reverse -189 -208 1.57275 0.196
NP_440875.1_9 Forward -250 -240 8.66404 0.233
NP_441239.1_9 Reverse -301 -313 5.84051 0.206
NP_440219.1_1 Forward -41 -22 13.4144 0.254
NP_442643.1_1 Forward -67 -48 -10.9153 0.231
NP_442216.1_4 Reverse -299 -307 8.1805 0.255
NP_440949.1_5 Reverse -247 -266 16.6174 0.236
NP_441509.1_2 Reverse -299 -317 7.29564 0.271
NP_440024.1_8 Forward -41 -22 16.6165 0.233
NP_441204.1_1 Reverse -234 -253 8.55425 0.25
NP_440401.1_5 Forward -309 -295 15.0442 0.272
NP_441497.1_3 Reverse -242 -261 -11.0136 0.294
NP_442479.1_9 Forward -260 -241 -2.75381 0.224
NP_442402.1_2 Reverse -360 -374 11.012 0.291
NP_441084.1_6 Reverse -198 -212 13.8041 0.121
NP_440696.1_3 Forward -71 -53 2.18243 0.217
NP_442039.1_7 Reverse -245 -255 13.5497 0.211
NP_442273.1_10 Reverse -12 -30 8.57394 0.224
NP_440825.1_6 Reverse -277 -296 7.47261 0.285
NP_440505.1_1 Reverse -238 -255 16.4593 0.273
NP_440505.1_5 Forward -168 -154 18.4858 0.0978
NP_440207.2_2 Forward -395 -376 15.8725 0.28
NP_440914.1_1 Reverse -207 -217 7.83437 0.219
NP_440914.1_1 Reverse -195 -205 7.5416 0.232
NP_442533.1_6 Reverse -58 -67 4.81794 0.172
NP_440263.1_5 Reverse -290 -304 7.66941 0.294
NP_439944.1_9 Reverse -310 -320 5.87989 0.214
NP_441697.1_5 Forward -144 -125 -0.812105 0.204
NP_441697.1_5 Reverse -114 -133 -9.88384 0.278
NP_441028.1_6 Reverse -365 -375 14.6309 0.158
NP_441028.1_6 Reverse -178 -188 5.48612 0.255
NP_441028.1_6 Forward -233 -223 5.19112 0.265
NP_441527.1_3 Forward -150 -131 8.55425 0.296
NP_441527.1_4 Reverse -20 -39 -7.974 0.24
NP_441527.1_4 Reverse -19 -38 -12.6531 0.292
NP_440115.1_6 Reverse -95 -105 9.12481 0.121
NP_440007.1_9 Forward -207 -193 10.4227 0.163
NP_441602.1_3 Reverse -379 -398 0.982764 0.217
NP_440429.1_2 Reverse -244 -263 8.45592 0.272
NP_439903.1_6 Reverse -136 -155 3.63691 0.207
NP_439903.1_6 Forward -135 -116 -1.18128 0.293
NP_441286.1_1 Reverse -193 -205 -6.35254 0.26
NP_442674.1_10 Reverse -360 -379 9.24257 0.288
NP_440205.1_3 Forward -59 -40 5.211 0.282
NP_442238.1_4 Forward -45 -26 17.109 0.117
NP_442238.1_7 Reverse -125 -144 6.1935 0.285
NP_441962.1_5 Reverse -310 -329 6.68596 0.278
NP_440387.1_1 Forward -343 -327 -1.21977 0.142
NP_441174.1_4 Reverse -223 -233 15.2213 0.267
NP_442323.1_7 Reverse -369 -388 1.57197 0.278
NP_440293.1_3 Forward -260 -241 -5.80207 0.282
NP_440766.1_5 Forward -374 -362 6.70087 0.294
NP_441133.1_1 Forward -357 -338 13.6675 0.243
NP_440798.1_9 Forward -140 -121 10.1275 0.224
NP_441801.1_4 Reverse -300 -310 3.12662 0.231
NP_442128.1_2 Forward -26 -8 12.4089 0.149
NP_442395.2_9 Reverse -110 -126 14.3165 0.226
NP_441561.1_4 Reverse -300 -319 9.3409 0.191
NP_442932.1_9 Forward -167 -148 3.53937 0.298
NP_442275.1_1 Forward -306 -287 -0.000545616 0.295
NP_441875.1_3 Forward -325 -306 15.4366 0.297
NP_441105.1_3 Reverse -189 -208 -3.83545 0.185
NP_440216.1_9 Reverse -245 -254 16.9127 0.116
NP_442371.1_1 Reverse -183 -193 11.6809 0.288
NP_442015.1_10 Forward -71 -58 -0.472371 0.268
NP_441226.1_7 Reverse -59 -66 8.59356 0.197
NP_442417.1_5 Reverse -266 -280 7.86607 0.172
NP_442552.1_1 Forward -49 -30 2.94938 0.203
NP_440988.1_5 Reverse -184 -203 14.4203 0.233
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTGACGAGGAAATCCCAGGCACTATCTAGGGGAAAACTATCCTCAATTTCTGCGTGGGGCCGTAGACCTAATTCCTGTACAGGGACAAAGCCAGGGGATTTACCGCCAAAATCCACATAGACTCCCTCGTTAGCGTGCTGACAGATTTTGCCATGGACGGTTTGACCTTTCTCCGCATGGTAGTCGTGTTTGTCAAGGGCTTTGGCAAATTCATCGAGGGAAAAGGCTGCACTGTTGGAGGAAGAAGGCATACGAGAACAGATTGAAAAATCATTTTGAATGCCTTATTCTAGCAGGATTGCTTGGGACTTTCGTGACAAGCTAGTTCCAGTGTGGGACGGCCCTTACCTGGGTAGGATCAGTTTTTTGCTTTACCTTTACCGCTGTTGTTGGCTTGCTA

CDS

ATGAGCGCTCTTTCTTCCCATAGTCAAGTATTGTCTATGCTGCGTACTACCCCAATCAATTTCAACCATTGGTATGTGGTGGCCCAAGCAGGGGAATTAGGTCAGGGACCACTGGGAATTGTTCTTTGGGAAAAGGCGATCGCCATTTATCGGGACCAGGATGGCCAGGTGCGGGCGGTGGAGGATCGTTGTCCCCATCGTCAAGTGAAGTTGAGTGAAGGGAAGGTGTTGGGCAATAATTTAGAATGTGCTTACCATGGTTGGCAGTTTGATGCCCAGGGCCACTGTGCAAAGATCCCCTATTTTAGCGAGGATCAAAAACTTCCTCCCTGCCGTTTGCGCACCTATCCTGTGCAGGAAAAAGATGGGTTTATTTGGCTTTATCCAGGGGATCTAGACCATCTTGCCAGCCACGGACCAGAGCCCTTGGCGATACCAGAATGGCACCATTTAAACCACATTGGTAGTTTCGCCGCCTTTGATTGCCCGGGTCATTTTTCCTACCTGATTGAAAATTTAATGGATATGTACCATGGGCATTTACACGATAATTACCAGGCTTGGGCCTCTGCTTCTCTCCGGGAAATTGAAACCAATGGCGATCAGGTGGTGGTGGACTACAATGCCCAAAGTTATTACAAAATTGATAAAATCTGGTCCATTTCCCAACTGTTTTTCCCTACCCTAAGACGATTGCATCCAGAAAATTTGCGGGTGAGTTACATCTATCCCCATTGGTCCTCTACGTTGGGAGCAGACTTTAAAATTTACTGCCTATTTTGTCCCATTTCTGCCAACAAAACCAAGGCCTATTTAGTCCACTTTACTTCCCTAGAAGCTTTTCCCAAACTACATAAACTACCCGTTGCCTTTAGGAGTTTTTTAAAAAATTGGCTATCGGGAACAGCCCGGCCCTTACTAGAAGGTTTGATTGACCAGGATATTCGCATGATTTCCCAAGAGCAAGCCGCTTTTGAGCAGAACCCAGATCGCCAAAATGTGGAAGTTAACCCAGCCCTAGCTAAGGTCCAACAATTAATTCGTCAACAGGCCTTGGCCTCGGAGAATGCATGA

Protein

MSALSSHSQVLSMLRTTPINFNHWYVVAQAGELGQGPLGIVLWEKAIAIYRDQDGQVRAVEDRCPHRQVKLSEGKVLGNNLECAYHGWQFDAQGHCAKIPYFSEDQKLPPCRLRTYPVQEKDGFIWLYPGDLDHLASHGPEPLAIPEWHHLNHIGSFAAFDCPGHFSYLIENLMDMYHGHLHDNYQAWASASLREIETNGDQVVVDYNAQSYYKIDKIWSISQLFFPTLRRLHPENLRVSYIYPHWSSTLGADFKIYCLFCPISANKTKAYLVHFTSLEAFPKLHKLPVAFRSFLKNWLSGTARPLLEGLIDQDIRMISQEQAAFEQNPDRQNVEVNPALAKVQQLIRQQALASENA