Your browser is old and dusty. Try Google Chrome!

Details for sll1866

ORF sll1866
Accession NP_441551.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -107 -121 0.88457 0.197
NP_441061.1_2 Reverse -113 -127 0.196253 0.215
NP_441480.1_8 Forward -122 -103 14.2574 0.271
NP_442151.1_6 Reverse -106 -120 5.80112 0.262
NP_441818.1_9 Forward -130 -111 0.0977854 0.191
NP_441818.1_9 Forward -124 -105 -10.227 0.292
NP_441465.1_5 Forward -370 -356 15.9292 0.286
NP_443002.1_5 Reverse -107 -125 8.76983 0.297
NP_442752.1_4 Reverse -391 -398 7.90559 0.144
NP_442000.2_7 Forward -257 -239 21.5536 0.0813
NP_442062.1_8 Forward -115 -105 4.10993 0.232
NP_442268.1_9 Forward -124 -105 16.0274 0.207
NP_440044.1_8 Forward -114 -95 4.52268 0.114
NP_441581.1_1 Forward -396 -379 14.3952 0.224
NP_439918.1_2 Reverse -209 -228 -4.22878 0.272
NP_441208.1_9 Forward -309 -295 10.816 0.174
NP_441208.1_9 Forward -124 -110 8.25939 0.219
NP_441558.1_5 Forward -342 -323 8.45592 0.15
NP_441713.1_5 Forward -151 -132 5.80098 0.271
NP_442570.1_3 Forward -79 -60 -9.047 0.296
NP_442570.1_3 Forward -385 -366 -9.14533 0.296
NP_439953.1_2 Reverse -100 -118 9.36059 0.266
NP_441624.1_9 Forward -125 -107 21.652 0.0432
NP_441533.1_7 Forward -395 -377 11.2281 0.299
NP_440343.1_9 Forward -125 -106 10.4225 0.243
NP_441486.1_1 Reverse -103 -117 0.88457 0.124
NP_442848.1_5 Reverse -106 -124 7.4923 0.232
NP_442848.1_5 Reverse -112 -130 1.39578 0.276
NP_441012.1_4 Forward -146 -133 8.18076 0.272
NP_443018.1_3 Forward -114 -107 4.26735 0.267
NP_443018.1_3 Reverse -107 -114 4.16902 0.278
NP_441634.1_8 Forward -117 -103 -2.45868 0.295
NP_440376.1_1 Forward -115 -106 4.62128 0.154
NP_442687.1_1 Reverse -17 -30 12.1134 0.273
NP_441797.1_7 Reverse -333 -351 9.95058 0.292
NP_440667.1_2 Reverse -136 -155 -7.86702 0.287
NP_441950.1_7 Forward -121 -102 -5.50708 0.231
NP_441274.1_9 Reverse -287 -306 7.7676 0.264
NP_442296.1_9 Forward -399 -380 -3.54046 0.254
NP_442782.1_2 Forward -255 -241 9.34103 0.198
NP_441487.1_9 Forward -228 -209 7.66927 0.115
NP_442937.1_5 Reverse -380 -399 5.89931 0.295
NP_440203.1_5 Reverse -109 -119 11.6809 0.182
NP_440203.1_5 Forward -100 -90 10.6976 0.215
NP_439905.1_1 Reverse -107 -120 10.4424 0.216
NP_442911.1_2 Reverse -96 -115 7.86593 0.0229
NP_441591.1_10 Reverse -198 -217 12.0942 0.148
NP_440993.1_4 Forward -103 -86 3.18543 0.294
NP_441294.1_7 Reverse -102 -116 11.9383 0.12
NP_441646.1_1 Reverse -99 -118 -1.67217 0.293
NP_442438.1_10 Reverse -139 -153 4.52282 0.146
NP_442431.1_10 Forward -127 -109 22.3403 0.0133
NP_442431.1_10 Reverse -382 -400 9.65558 0.128
NP_442431.1_10 Forward -124 -106 1.69077 0.249
NP_441000.1_6 Reverse -143 -157 -5.60527 0.285
NP_440484.1_1 Forward -353 -334 13.47 0.191
NP_441550.1_8 Reverse -334 -344 4.60114 0.299
NP_440206.1_4 Forward -223 -204 1.96529 0.289
NP_440345.1_3 Reverse -173 -187 11.0887 0.259
NP_441041.1_4 Forward -127 -108 -3.3438 0.121
NP_441041.1_4 Forward -121 -102 -9.73531 0.222
NP_441041.1_4 Reverse -133 -152 -11.0136 0.239
NP_442396.1_1 Reverse -289 -307 13.9821 0.179
NP_441079.1_7 Reverse -15 -34 7.76679 0.114
NP_441079.1_7 Forward -36 -17 -2.55791 0.22
NP_442049.1_6 Reverse -86 -105 8.35759 0.215
NP_440498.1_1 Reverse -135 -153 2.28076 0.193
NP_441644.1_6 Forward -115 -105 3.91283 0.256
NP_440652.1_10 Forward -118 -99 6.39097 0.283
NP_442215.1_2 Reverse -104 -120 6.15506 0.0738
NP_442177.1_5 Forward -118 -104 8.94771 0.261
NP_440929.1_8 Reverse -106 -115 4.81794 0.176
NP_442554.1_8 Reverse -107 -117 4.79825 0.173
NP_442554.1_8 Forward -114 -104 4.10993 0.198
NP_441586.1_5 Reverse -50 -69 2.55606 0.291
NP_442313.1_5 Reverse -139 -158 11.0125 0.191
NP_442142.1_4 Forward -394 -381 5.91857 0.178
NP_442142.1_4 Reverse -112 -125 2.96866 0.269
NP_442292.1_1 Reverse -107 -116 6.09625 0.116
NP_442301.1_2 Reverse -111 -130 9.34008 0.204
NP_440357.1_6 Reverse -118 -137 2.55606 0.296
NP_441468.1_1 Forward -114 -107 4.36568 0.237
NP_441015.1_10 Forward -126 -107 -9.047 0.278
NP_441876.1_9 Reverse -364 -374 14.4342 0.267
NP_441826.1_5 Reverse -212 -231 2.85105 0.276
NP_441330.1_1 Forward -276 -257 -13.4719 0.19
NP_442808.1_1 Reverse -59 -69 4.50281 0.197
NP_442808.1_1 Forward -154 -144 3.32285 0.244
NP_442808.1_1 Forward -319 -309 1.15957 0.292
NP_440630.1_7 Reverse -107 -126 1.57275 0.129
NP_440630.1_7 Reverse -113 -132 -0.000545616 0.136
NP_440558.1_2 Forward -119 -100 6.19431 0.136
NP_440558.1_2 Forward -151 -132 2.55606 0.167
NP_440558.1_2 Reverse -103 -122 1.27776 0.182
NP_441878.1_6 Forward -116 -106 -7.29646 0.217
NP_441445.1_1 Forward -77 -58 0.0977854 0.283
NP_441590.1_4 Reverse -114 -133 4.32522 0.288
NP_441739.1_2 Reverse -232 -248 2.12282 0.288
NP_440101.1_3 Forward -126 -107 3.14605 0.237
NP_441574.1_1 Forward -127 -108 -3.93378 0.246
NP_442888.1_6 Reverse -77 -96 5.11266 0.228
NP_441037.1_4 Forward -342 -332 8.87701 0.237
NP_442594.1_8 Forward -133 -114 10.5209 0.178
NP_442508.1_3 Reverse -139 -158 11.5042 0.242
NP_440899.1_1 Forward -287 -268 5.67487 0.297
NP_440299.1_1 Forward -146 -133 9.16348 0.0774
NP_440299.1_1 Reverse -102 -115 3.65697 0.237
NP_441799.1_1 Forward -119 -105 3.93223 0.274
NP_441799.1_4 Reverse -113 -132 -6.09707 0.253
NP_441799.1_4 Reverse -107 -126 -6.39206 0.266
NP_441007.1_10 Forward -120 -107 -1.06236 0.3
NP_441559.1_8 Forward -311 -297 -7.37523 0.291
NP_440915.1_6 Forward -298 -284 -3.24533 0.292
NP_441464.1_10 Forward -80 -66 12.3893 0.201
NP_442386.1_9 Reverse -105 -114 9.04574 0.175
NP_442386.1_9 Forward -318 -309 5.60418 0.245
NP_442386.1_9 Forward -111 -102 4.7192 0.289
NP_440570.1_5 Reverse -129 -148 -1.57384 0.274
NP_441340.1_5 Reverse -107 -114 4.07068 0.239
NP_442791.1_5 Forward -217 -198 -5.31042 0.279
NP_440327.1_6 Forward -142 -123 3.34271 0.285
NP_441248.1_10 Forward -197 -187 14.6181 0.282
NP_441160.1_5 Forward -126 -107 -5.31042 0.288
NP_440586.1_8 Reverse -107 -114 7.70858 0.227
NP_440192.1_5 Forward -134 -115 4.62101 0.25
NP_440398.1_6 Forward -305 -286 9.83255 0.214
NP_443039.1_7 Forward -153 -139 3.73557 0.287
NP_442239.1_8 Forward -131 -112 6.78429 0.263
NP_440574.1_2 Forward -222 -203 6.98095 0.242
NP_441789.1_7 Forward -398 -379 -5.1145 0.293
NP_442572.1_6 Forward -153 -134 11.6025 0.229
NP_440344.1_10 Forward -324 -307 -13.8258 0.296
NP_440531.1_8 Forward -243 -224 3.6377 0.269
NP_442910.1_1 Forward -234 -215 -7.57203 0.254
NP_440297.1_9 Reverse -134 -144 -0.118297 0.282
NP_440888.1_2 Forward -306 -292 9.53707 0.123
NP_440888.1_2 Reverse -308 -322 9.04542 0.139
NP_440888.1_2 Forward -215 -201 5.70218 0.267
NP_441543.1_2 Reverse -107 -116 5.21127 0.209
NP_442845.1_2 Forward -121 -107 7.66941 0.195
NP_441469.1_3 Forward -201 -182 14.4242 0.21
NP_442315.1_1 Forward -126 -108 12.6055 0.131
NP_443064.1_6 Reverse -297 -307 8.97947 0.254
NP_440710.1_1 Reverse -59 -77 0.21581 0.163
NP_441462.1_5 Forward -373 -354 5.40766 0.254
NP_442204.1_1 Forward -344 -333 0.255333 0.282
NP_442204.1_5 Reverse -103 -122 -0.295539 0.283
NP_440504.1_7 Reverse -101 -120 5.01433 0.175
NP_442872.1_1 Forward -399 -380 -9.63698 0.241
NP_442428.1_5 Forward -114 -107 4.66067 0.244
NP_440783.1_3 Reverse -253 -272 2.55606 0.265
NP_442120.1_10 Forward -109 -90 -4.91709 0.199
NP_441867.1_2 Reverse -199 -218 -3.73712 0.176
NP_441867.1_2 Forward -295 -276 -12.3902 0.253
NP_440778.1_8 Reverse -236 -255 17.994 0.226
NP_440436.1_4 Reverse -107 -116 4.81753 0.239
NP_442086.1_7 Forward -174 -155 19.8623 0.152
NP_442864.1_3 Forward -97 -78 8.35759 0.233
NP_441004.1_1 Forward -136 -117 -12.9802 0.251
NP_441004.1_1 Forward -130 -111 -14.3569 0.267
NP_441004.1_2 Forward -141 -122 4.03102 0.198
NP_442366.1_3 Forward -123 -105 1.78911 0.141
NP_440094.1_8 Reverse -300 -319 3.73603 0.215
NP_441851.1_10 Forward -116 -106 4.60159 0.259
NP_441396.1_5 Reverse -389 -398 8.35786 0.224
NP_440726.1_2 Reverse -212 -231 -0.787193 0.295
NP_442168.1_4 Forward -320 -306 16.8142 0.277
NP_442168.1_5 Reverse -102 -121 6.19431 0.192
NP_440483.1_1 Forward -299 -280 2.3594 0.18
NP_442243.1_1 Forward -65 -47 -0.0799167 0.239
NP_441078.1_4 Forward -115 -106 -1.86856 0.272
NP_441432.1_8 Forward -116 -107 11.3078 0.0569
NP_441732.1_2 Forward -119 -103 -16.3627 0.165
NP_441732.1_2 Reverse -108 -124 -17.5427 0.27
NP_442797.1_1 Forward -155 -136 8.16093 0.137
NP_442797.1_1 Reverse -108 -127 -3.83545 0.284
NP_441057.1_4 Forward -125 -107 5.42735 0.201
NP_441057.1_4 Reverse -358 -376 -1.45582 0.272
NP_443011.1_4 Forward -131 -112 5.89931 0.294
NP_441072.1_2 Reverse -196 -215 9.24257 0.22
NP_442400.1_10 Reverse -233 -246 7.12818 0.298
NP_442489.1_7 Forward -115 -106 -1.37691 0.195
NP_442913.1_10 Forward -124 -105 -5.31042 0.262
NP_442346.1_5 Forward -116 -106 5.09324 0.262
NP_440352.1_5 Reverse -32 -51 11.877 0.25
NP_440545.1_3 Forward -231 -214 -5.27103 0.245
NP_440545.1_3 Reverse -102 -119 -5.66436 0.256
NP_440545.1_3 Forward -119 -102 -6.84433 0.289
NP_440545.1_5 Forward -119 -102 8.59364 0.21
NP_440459.1_1 Forward -320 -301 15.4374 0.277
NP_441888.1_9 Forward -115 -96 13.8726 0.282
NP_442140.1_3 Forward -96 -86 6.96153 0.156
NP_442140.1_3 Forward -339 -329 5.78156 0.197
NP_442140.1_3 Forward -114 -104 4.0116 0.265
NP_441813.1_7 Reverse -112 -126 11.9953 0.215
NP_440590.1_4 Reverse -101 -114 -3.91395 0.256
NP_440567.1_1 Forward -114 -100 0.196253 0.254
NP_442839.1_2 Reverse -365 -384 23.7955 0.0296
NP_441727.1_3 Reverse -99 -118 3.24438 0.291
NP_440604.1_5 Forward -205 -186 15.7855 0.264
NP_442643.1_3 Forward -147 -128 -4.72043 0.261
NP_440546.1_6 Forward -248 -229 9.24257 0.251
NP_440675.1_1 Forward -125 -106 1.96607 0.28
NP_442611.1_1 Forward -153 -134 0.58944 0.256
NP_441269.1_6 Forward -125 -107 21.7503 0.065
NP_441269.1_6 Forward -128 -110 12.1139 0.259
NP_441474.1_1 Reverse -123 -142 -0.197979 0.255
NP_442402.1_10 Reverse -310 -320 10.796 0.282
NP_441848.1_7 Reverse -244 -263 -3.24622 0.28
NP_440696.1_3 Forward -215 -197 -3.71743 0.289
NP_442039.1_7 Forward -113 -103 16.2046 0.211
NP_440825.1_6 Forward -141 -122 9.43923 0.285
NP_440160.1_9 Forward -256 -237 16.5191 0.157
NP_441252.1_6 Forward -289 -282 11.9372 0.25
NP_442533.1_1 Forward -261 -242 -17.9951 0.299
NP_442541.1_10 Forward -148 -134 7.86545 0.225
NP_440263.1_5 Forward -247 -233 11.2093 0.294
NP_440854.1_7 Forward -32 -18 14.2385 0.253
NP_439944.1_9 Forward -114 -104 11.9764 0.0887
NP_442269.1_10 Forward -126 -107 7.47261 0.194
NP_441697.1_5 Reverse -15 -34 -2.14899 0.207
NP_441697.1_5 Forward -33 -14 -9.50187 0.268
NP_441697.1_5 Reverse -18 -37 -9.78835 0.274
NP_441697.1_5 Reverse -16 -35 -9.97933 0.278
NP_441028.1_6 Reverse -280 -290 7.74772 0.218
NP_441028.1_6 Reverse -363 -373 3.8145 0.281
NP_441216.1_6 Forward -274 -255 14.0608 0.262
NP_441286.1_1 Forward -116 -104 -6.74586 0.278
NP_442022.1_4 Reverse -379 -398 6.29264 0.273
NP_441463.1_3 Reverse -96 -115 -3.44213 0.176
NP_442842.1_9 Reverse -190 -209 10.1275 0.221
NP_442061.1_5 Reverse -336 -354 17.597 0.289
NP_442365.1_7 Forward -119 -100 -6.58872 0.298
NP_442362.1_7 Forward -216 -198 11.8189 0.236
NP_441193.1_1 Reverse -115 -134 11.2084 0.234
NP_441425.1_2 Reverse -16 -35 12.0775 0.269
NP_442437.1_8 Reverse -140 -159 2.94938 0.296
NP_441510.2_7 Reverse -107 -121 11.307 0.28
NP_441500.1_1 Forward -302 -284 15.7521 0.253
NP_440293.1_3 Forward -123 -104 -6.68705 0.291
NP_440766.1_4 Forward -344 -330 1.57289 0.226
NP_441237.1_9 Reverse -107 -117 11.2881 0.189
NP_441984.1_4 Forward -121 -107 19.3708 0.118
NP_442514.1_5 Forward -384 -365 -4.81951 0.249
NP_441756.1_5 Forward -222 -203 -4.91709 0.297
NP_440679.1_10 Reverse -135 -154 -18.6834 0.279
NP_440679.1_10 Forward -131 -112 -20.7484 0.286
NP_441207.1_7 Reverse -24 -38 10.2235 0.266
NP_439962.1_4 Forward -213 -194 -5.80207 0.28
NP_440175.1_7 Forward -125 -107 11.9005 0.23
NP_441105.1_3 Forward -351 -332 -9.24366 0.286
NP_442373.1_2 Forward -133 -114 -0.590531 0.198
NP_440216.1_9 Reverse -90 -99 5.50626 0.292
NP_442371.1_1 Forward -201 -191 16.5975 0.137
NP_441008.1_4 Reverse -118 -137 17.1001 0.295
NP_441226.1_7 Reverse -107 -114 11.2485 0.0971
NP_441226.1_7 Reverse -369 -376 5.64364 0.286
NP_441111.1_7 Reverse -107 -115 -0.570565 0.233
NP_440416.1_9 Forward -389 -370 -19.1751 0.27
NP_443052.1_9 Reverse -111 -130 2.3594 0.172
NP_443052.1_9 Forward -222 -203 -2.95047 0.244
NP_440072.1_5 Forward -130 -112 0.117479 0.236
NP_442154.1_1 Forward -132 -114 -6.56903 0.141
NP_442154.1_1 Forward -141 -123 -11.9772 0.217
NP_442154.1_1 Forward -123 -105 -13.3539 0.217
NP_440261.1_5 Reverse -107 -120 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TACCCTCACCAACAGCACTGCTTTGCGTCGGGGAGAAACGGCAGAGTCCCTATTGACCGATGAGATGGTGGATAGTTTACTGCGGGAAACCCTAGCTGTTCCCCTCAAGGATGGGGCAAAGTATAACCAAGCGTTGATTGAAGCTGACAAACGTTTGGGCGCAATTTTAGCTGGACAACCGGACCCGGGTCCTCCAGCCCTGGAAGAAATTAGTTTGGAAGGAACTTTCACTACAGCGGAAGAAACCGACGATACCAGTGCCACCGTTTGGGTAGTGGTGCTGTTGGCGTTGGCAACCCTAATTCCCATGGTGACTTACTTCTGGTATGTGGGCTTACCGGGACGGTGAACATATTCCGCTGGTAATAATAATTTTGAATTTTATGAGTCGGACTTAACC

CDS

GTGCCCCTAGTTAGTCAATCGGATTTAGTCTCAGCGGCGATCGCCCATCGGGTCGTCAGTTTTCCCACGGATACAGTGCCGGCTTTGGCGGTGCGTCCAGAAAACTCAGCTTTAATTTACGAGCTTAAACAACGGGAAGCTAGTAAACCATTAATTTTGATGGCGGCAACCGTAGAACAAATTCTCCCTTACCTGGCAGGTAGTCAGCGGGAAAAGCAACTGTGGCAGGCAGTAATGGCAGAATATTGGCCCGGTGCCCTAACTTTGGTACTGCCGTGCAGCGAAAAGTTGCCCCCGGAAATCAATCCCCGTCAAGACCAGACCATTGGGGTTCGCATTCCCCGCCAGGCGATCTCCCTAGAAATTTTGCTGCAAACGGGACCCCTGGCCACCACCAGTGCTAATTTGTCGGGACAGCCCCCCCTGGAAAAGTTGGCCGATATTGCCGAAACTTTCCCTGCCGTTCATTGTCTAGATTGCCTCAGCCTGGAGCAACAGGGGCCAATTGGCAAAGGTCTACCGTCCACCGTTGCCCAATGGGACGGAGCAAAGGAAATCTTCCAAATTCTGCGCCAAGGGGAAGTTGTGTTGCAGGATTAG

Protein

MPLVSQSDLVSAAIAHRVVSFPTDTVPALAVRPENSALIYELKQREASKPLILMAATVEQILPYLAGSQREKQLWQAVMAEYWPGALTLVLPCSEKLPPEINPRQDQTIGVRIPRQAISLEILLQTGPLATTSANLSGQPPLEKLADIAETFPAVHCLDCLSLEQQGPIGKGLPSTVAQWDGAKEIFQILRQGEVVLQD