Your browser is old and dusty. Try Google Chrome!

Details for sll1852

ORF sll1852
Accession NP_441918.1
Symbol
Category Interconversions and salvage of nucleosides and nucleotides
Definition nucleoside diphosphate kinase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -128 -114 10.521 0.0605
NP_441061.1_2 Reverse -66 -80 -1.77037 0.272
NP_440557.1_1 Forward -128 -109 0.687771 0.265
NP_440557.1_1 Reverse -2 -21 -1.67217 0.276
NP_440795.1_7 Forward -128 -121 14.6904 0.0123
NP_440795.1_7 Reverse -121 -128 14.6904 0.0123
NP_441418.1_1 Reverse -23 -42 9.69201 0.205
NP_441418.1_6 Forward -129 -110 -1.37718 0.0136
NP_441418.1_6 Reverse -227 -246 -19.1751 0.0854
NP_440815.1_5 Reverse -87 -106 5.30933 0.286
NP_442291.1_5 Forward -130 -114 0.451859 0.165
NP_441453.1_1 Forward -136 -118 7.29487 0.216
NP_441453.1_4 Forward -129 -121 16.6374 0.00633
NP_441453.1_4 Reverse -120 -128 16.539 0.00633
NP_441453.1_4 Forward -236 -228 4.93597 0.224
NP_441453.1_4 Reverse -227 -235 4.83764 0.237
NP_441623.1_1 Forward -123 -105 -1.75081 0.241
NP_441818.1_1 Forward -128 -117 9.79292 0.232
NP_440226.1_1 Forward -129 -110 9.43923 0.0726
NP_440226.1_1 Forward -46 -27 5.211 0.163
NP_440931.1_7 Forward -75 -57 14.6697 0.23
NP_441098.1_3 Reverse -361 -380 3.45135 0.25
NP_441098.1_3 Forward -42 -23 -6.02333 0.28
NP_440150.1_6 Forward -132 -113 8.94757 0.19
NP_442173.1_1 Reverse -121 -129 17.3257 0.00633
NP_442173.1_1 Forward -128 -120 15.4574 0.00633
NP_442173.1_1 Forward -9 -1 6.01761 0.2
NP_442752.1_4 Reverse -120 -127 13.8055 0.0199
NP_442752.1_4 Reverse -65 -72 5.25066 0.256
NP_443027.1_4 Forward -131 -121 16.303 0.0437
NP_443027.1_4 Reverse -118 -128 11.0914 0.107
NP_441812.1_3 Reverse -119 -133 8.25939 0.254
NP_442975.1_10 Forward -133 -119 12.9786 0.0459
NP_440784.1_7 Forward -128 -121 15.9687 0.0123
NP_440784.1_7 Reverse -121 -128 15.9687 0.0123
NP_440061.1_9 Forward -131 -117 14.8469 0.0573
NP_442062.1_8 Reverse -120 -130 19.1546 0.00121
NP_442062.1_8 Forward -129 -119 14.9263 0.0108
NP_441859.1_3 Forward -130 -111 10.2251 0.121
NP_440304.1_4 Reverse -245 -255 2.14332 0.299
NP_440304.1_4 Reverse -118 -128 1.84832 0.299
NP_442242.1_4 Forward -128 -121 14.3954 0.0124
NP_442242.1_4 Reverse -121 -128 14.3954 0.0124
NP_440044.1_3 Reverse -78 -97 21.1406 0.0856
NP_440044.1_8 Reverse -121 -140 11.5042 0.0497
NP_441619.1_8 Forward -295 -281 10.717 0.185
NP_441208.1_9 Forward -358 -344 5.60446 0.267
NP_441594.1_6 Reverse -143 -162 0.982764 0.276
NP_442110.1_7 Forward -129 -115 3.14618 0.216
NP_440300.1_1 Forward -80 -61 8.65176 0.242
NP_440856.1_7 Forward -132 -113 -6.09707 0.235
NP_441083.1_5 Forward -129 -119 11.0914 0.0166
NP_441083.1_5 Forward -74 -64 5.78156 0.104
NP_441083.1_5 Reverse -120 -130 1.55333 0.204
NP_441738.1_2 Forward -127 -120 15.28 0.0102
NP_441738.1_2 Reverse -122 -129 11.5435 0.084
NP_441955.1_8 Reverse -114 -131 7.11867 0.281
NP_440209.1_1 Reverse -120 -128 18.1123 0.00295
NP_440209.1_1 Forward -129 -121 8.57422 0.0425
NP_441444.1_1 Forward -160 -141 4.71934 0.286
NP_442136.1_4 Forward -127 -108 5.30853 0.295
NP_442889.1_8 Forward -132 -118 4.52221 0.263
NP_440447.1_6 Reverse -112 -130 1.39578 0.266
NP_441713.1_1 Reverse -114 -133 -16.2252 0.278
NP_441770.1_4 Forward -122 -103 15.3391 0.0214
NP_441716.1_1 Forward -129 -115 7.47274 0.169
NP_441716.1_2 Forward -32 -13 -1.71666 0.289
NP_442111.1_4 Forward -130 -116 3.93283 0.226
NP_440906.1_5 Forward -128 -121 15.8704 0.0124
NP_440906.1_5 Reverse -121 -128 15.8704 0.0124
NP_440747.1_10 Reverse -117 -129 16.7552 0.0019
NP_440747.1_10 Forward -132 -120 -11.7607 0.142
NP_441854.1_10 Forward -357 -338 3.44104 0.282
NP_441486.1_1 Forward -132 -118 11.996 0.0136
NP_441486.1_1 Reverse -117 -131 3.53951 0.0575
NP_442145.1_4 Forward -42 -23 2.33913 0.299
NP_442634.1_4 Reverse -118 -132 -1.37704 0.149
NP_441265.1_1 Forward -288 -269 8.75091 0.0129
NP_440842.1_4 Reverse -23 -42 7.49757 0.117
NP_442848.1_1 Forward -135 -121 2.35953 0.176
NP_442848.1_1 Reverse -114 -128 -0.983719 0.263
NP_443018.1_3 Forward -128 -121 14.8871 0.0123
NP_443018.1_3 Reverse -121 -128 14.8871 0.0123
NP_443018.1_3 Reverse -95 -102 8.20058 0.153
NP_441634.1_8 Reverse -118 -132 6.6861 0.114
NP_441634.1_8 Forward -105 -91 -3.63866 0.295
NP_440376.1_1 Forward -129 -120 9.73449 0.0365
NP_440376.1_1 Reverse -120 -129 9.63616 0.0385
NP_440376.1_1 Reverse -267 -276 1.1797 0.255
NP_441857.1_6 Reverse -58 -68 13.5497 0.269
NP_441588.1_4 Reverse -122 -132 7.64985 0.178
NP_441588.1_4 Forward -72 -62 5.38824 0.272
NP_442687.1_7 Reverse -119 -129 7.94484 0.121
NP_442687.1_7 Forward -130 -120 6.27322 0.175
NP_442687.1_7 Reverse -226 -236 6.07655 0.179
NP_442687.1_7 Forward -47 -37 5.38824 0.206
NP_442687.1_7 Reverse -268 -278 3.71661 0.292
NP_442191.1_4 Forward -275 -261 11.4779 0.256
NP_441077.1_2 Reverse -23 -42 5.1084 0.224
NP_442485.1_3 Reverse -103 -122 -3.93378 0.277
NP_442485.1_3 Reverse -241 -260 -5.31042 0.289
NP_442485.1_5 Reverse -21 -40 20.7691 0.0262
NP_441422.1_7 Forward -131 -114 -9.20427 0.294
NP_440360.1_2 Reverse -16 -30 16.0275 0.297
NP_442658.1_1 Forward -131 -121 15.0242 0.0188
NP_442658.1_1 Reverse -118 -128 7.94438 0.199
NP_442198.1_1 Reverse -120 -139 14.5524 0.29
NP_442782.1_2 Reverse -120 -134 12.586 0.173
NP_442782.1_2 Forward -204 -190 4.32615 0.256
NP_442782.1_2 Reverse -385 -399 0.982901 0.282
NP_440656.1_8 Forward -140 -121 -4.32711 0.198
NP_440184.1_1 Reverse -24 -43 11.0109 0.0985
NP_440184.1_1 Forward -186 -167 3.06757 0.243
NP_440184.1_1 Forward -39 -20 3.06757 0.243
NP_441256.1_1 Forward -132 -113 -4.91709 0.233
NP_442937.1_5 Reverse -115 -134 10.0292 0.173
NP_442321.1_1 Reverse -225 -244 -5.21209 0.216
NP_441958.1_5 Reverse -119 -129 10.9931 0.00875
NP_441958.1_5 Forward -130 -120 2.53664 0.0409
NP_441958.1_5 Reverse -226 -236 -0.314959 0.198
NP_441958.1_5 Reverse -384 -394 -2.28158 0.27
NP_442836.1_5 Reverse -114 -133 3.73603 0.225
NP_440203.1_4 Forward -238 -225 18.3088 0.282
NP_439905.1_2 Forward -355 -341 10.521 0.214
NP_440984.1_7 Reverse -222 -236 5.99778 0.231
NP_439990.1_5 Reverse -115 -128 13.884 0.0889
NP_442376.1_2 Forward -288 -269 -6.78538 0.286
NP_442690.1_1 Reverse -162 -181 -10.522 0.215
NP_442911.1_2 Reverse -110 -129 -3.04881 0.107
NP_442911.1_2 Forward -139 -120 -9.14533 0.25
NP_442911.1_4 Forward -97 -78 15.8299 0.148
NP_441580.1_6 Forward -140 -121 -4.81876 0.235
NP_443055.1_6 Reverse -106 -124 0.215075 0.248
NP_440602.1_8 Reverse -120 -134 11.2093 0.242
NP_441099.1_5 Reverse -110 -129 -4.72043 0.147
NP_441938.1_6 Reverse -188 -207 15.0441 0.206
NP_441294.1_7 Forward -133 -119 15.2019 0.0285
NP_441646.1_1 Reverse -176 -195 5.50599 0.177
NP_442438.1_10 Forward -134 -120 19.5675 0.0136
NP_441000.1_6 Reverse -119 -133 5.01447 0.0933
NP_440147.1_1 Forward -135 -116 4.12936 0.254
NP_440147.1_4 Forward -238 -225 9.55739 0.0392
NP_440147.1_4 Forward -131 -118 8.9674 0.0448
NP_440147.1_4 Reverse -118 -131 5.32916 0.129
NP_441175.1_7 Forward -129 -110 6.78429 0.248
NP_441550.1_8 Reverse -118 -128 15.1225 0.0132
NP_441916.1_7 Reverse -120 -130 16.4013 0.00539
NP_441916.1_7 Forward -129 -119 10.9931 0.0261
NP_441916.1_7 Forward -236 -226 4.69992 0.163
NP_441916.1_7 Reverse -227 -237 1.94665 0.268
NP_440345.1_3 Reverse -164 -178 13.094 0.219
NP_440465.1_4 Reverse -119 -138 11.7008 0.217
NP_441041.1_7 Forward -132 -120 10.0414 0.103
NP_442004.1_6 Forward -129 -115 1.47456 0.288
NP_441725.1_4 Reverse -115 -129 5.70218 0.278
NP_441725.1_5 Reverse -121 -131 2.24165 0.115
NP_441725.1_5 Forward -128 -118 2.04498 0.115
NP_441725.1_5 Forward -235 -225 -0.118297 0.232
NP_439966.1_7 Reverse -118 -128 15.3192 0.0152
NP_439966.1_7 Forward -131 -121 10.206 0.0958
NP_439966.1_9 Forward -131 -122 0.983037 0.253
NP_442941.1_3 Forward -128 -118 19.2529 0.00262
NP_442941.1_3 Reverse -121 -131 8.92815 0.0326
NP_440289.1_2 Forward -132 -119 12.409 0.015
NP_441678.1_9 Reverse -171 -190 3.93269 0.209
NP_442281.1_1 Reverse -115 -129 13.372 0.0277
NP_442281.1_1 Forward -134 -120 11.012 0.0511
NP_442281.1_1 Forward -241 -227 3.73557 0.221
NP_441334.1_7 Forward -131 -112 -20.65 0.277
NP_441079.1_7 Forward -171 -152 -2.95123 0.226
NP_442012.1_1 Reverse -221 -240 8.94757 0.0986
NP_442049.1_6 Reverse -112 -131 9.24257 0.215
NP_441644.1_6 Forward -129 -119 15.0242 0.00766
NP_441644.1_6 Forward -192 -182 7.0594 0.137
NP_441644.1_6 Forward -74 -64 3.12618 0.297
NP_442247.1_8 Reverse -118 -132 10.6193 0.247
NP_440253.1_2 Forward -129 -111 2.18243 0.142
NP_440929.1_8 Forward -129 -120 9.93116 0.0249
NP_440929.1_8 Reverse -120 -129 9.83282 0.0254
NP_442933.1_10 Forward -129 -120 17.601 0.00325
NP_442933.1_10 Reverse -120 -129 17.601 0.00325
NP_441310.1_10 Reverse -102 -112 15.4991 0.161
NP_441751.2_8 Forward -128 -114 6.58777 0.0348
NP_441751.2_8 Reverse -121 -135 -4.22864 0.166
NP_442554.1_8 Forward -128 -118 16.2046 0.0065
NP_442554.1_8 Reverse -121 -131 4.20827 0.193
NP_442554.1_9 Reverse -5 -24 12.5971 0.279
NP_441762.1_7 Forward -130 -118 4.16888 0.0533
NP_441762.1_7 Reverse -119 -131 -4.58258 0.179
NP_441762.1_7 Reverse -97 -109 -6.15587 0.276
NP_441762.1_7 Forward -237 -225 -6.64753 0.284
NP_442142.1_4 Reverse -117 -130 14.4733 0.0311
NP_442142.1_4 Forward -132 -119 8.96682 0.106
NP_442142.1_4 Reverse -111 -124 4.54195 0.217
NP_442142.1_4 Reverse -91 -104 2.18201 0.299
NP_442292.1_1 Forward -128 -119 18.486 0.00229
NP_442292.1_1 Reverse -121 -130 0.688044 0.23
NP_442292.1_5 Reverse -103 -122 7.66927 0.15
NP_442476.1_6 Reverse -121 -135 3.34284 0.158
NP_441264.1_3 Forward -288 -269 6.39097 0.0847
NP_441264.1_5 Forward -251 -232 29.3021 0.0000277
NP_442381.1_8 Forward -132 -113 3.83436 0.0708
NP_443009.1_5 Reverse -119 -130 17.266 0.00627
NP_441741.1_7 Forward -314 -295 16.4207 0.222
NP_442741.1_8 Reverse -110 -128 14.1788 0.276
NP_441371.1_2 Forward -55 -36 16.6174 0.114
NP_441715.1_4 Forward -128 -118 17.3846 0.0106
NP_441715.1_4 Reverse -121 -131 15.0247 0.0268
NP_440357.1_3 Reverse -63 -82 -0.295539 0.291
NP_440279.1_2 Reverse -60 -79 12.7825 0.104
NP_440158.1_8 Forward -131 -112 10.2259 0.249
NP_441198.1_8 Reverse -225 -235 10.2438 0.289
NP_441468.1_1 Forward -128 -121 15.8704 0.0124
NP_441468.1_1 Reverse -121 -128 15.8704 0.0124
NP_441020.2_6 Forward -131 -114 10.2653 0.149
NP_441020.2_6 Forward -289 -272 9.47861 0.17
NP_441673.1_1 Forward -129 -120 11.1111 0.0121
NP_441673.1_1 Reverse -120 -129 11.0128 0.018
NP_441731.1_3 Reverse -112 -131 -4.81876 0.284
NP_441096.1_5 Reverse -322 -340 13.7847 0.297
NP_441826.1_2 Reverse -114 -128 3.93283 0.105
NP_441826.1_2 Reverse -88 -102 0.392915 0.187
NP_442490.1_9 Forward -141 -122 -8.752 0.293
NP_442868.1_6 Reverse -118 -128 19.2529 0.00563
NP_442719.1_2 Forward -180 -162 -2.24319 0.185
NP_441612.1_2 Reverse -105 -115 16.7784 0.189
NP_442559.1_10 Reverse -92 -111 19.6648 0.198
NP_442361.1_3 Reverse -114 -127 8.18076 0.285
NP_440789.1_8 Reverse -105 -124 12.8808 0.28
NP_442427.1_5 Reverse -84 -103 3.34271 0.284
NP_441911.1_7 Forward -183 -164 -9.9327 0.201
NP_442808.1_1 Forward -130 -120 9.91099 0.0481
NP_441101.1_10 Reverse -116 -135 -6.88371 0.29
NP_441849.1_2 Forward -168 -149 2.05265 0.245
NP_442542.1_2 Reverse -225 -238 7.98409 0.167
NP_442050.1_1 Forward -136 -117 8.65258 0.25
NP_442050.1_5 Reverse -118 -128 14.3359 0.0206
NP_442050.1_5 Forward -131 -121 8.23937 0.234
NP_440038.1_4 Reverse -181 -200 -0.983855 0.288
NP_441114.1_3 Forward -73 -64 15.1427 0.193
NP_440558.1_2 Forward -90 -71 -6.49039 0.275
NP_440558.1_2 Reverse -111 -130 -6.78538 0.28
NP_442576.1_9 Reverse -101 -115 17.0092 0.191
NP_441518.1_3 Reverse -110 -129 -12.0953 0.262
NP_441878.1_6 Forward -130 -120 0.668351 0.139
NP_441878.1_6 Reverse -119 -129 0.57002 0.14
NP_441878.1_6 Forward -237 -227 -6.90313 0.198
NP_441878.1_6 Reverse -226 -236 -7.00147 0.201
NP_441036.1_8 Forward -130 -120 17.4829 0.0012
NP_441557.1_4 Reverse -102 -116 12.0943 0.291
NP_441557.1_5 Reverse -120 -129 18.6826 0.0015
NP_441557.1_5 Forward -129 -120 10.5211 0.00695
NP_441557.1_5 Reverse -227 -236 -0.885252 0.26
NP_441445.1_1 Forward -55 -36 9.83255 0.1
NP_441445.1_1 Forward -201 -182 4.32602 0.195
NP_441433.1_8 Reverse -94 -113 -1.47551 0.258
NP_441458.1_10 Forward -138 -119 4.52268 0.23
NP_441458.1_10 Reverse -111 -130 1.27776 0.292
NP_442183.1_1 Forward -129 -115 5.89945 0.198
NP_442183.1_1 Reverse -65 -79 3.73617 0.299
NP_441819.1_5 Reverse -163 -182 13.1297 0.223
NP_441819.1_5 Forward -184 -165 10.7424 0.261
NP_442347.1_2 Forward -128 -119 12.4878 0.056
NP_442347.1_2 Forward -73 -64 3.83464 0.284
NP_440690.1_8 Forward -247 -228 27.1379 0.00303
NP_441633.1_3 Reverse -118 -131 0.904263 0.112
NP_440136.1_2 Forward -128 -121 15.9687 0.0123
NP_440136.1_2 Reverse -121 -128 15.9687 0.0123
NP_442590.1_10 Forward -204 -185 4.916 0.27
NP_442998.1_10 Forward -127 -120 15.5754 0.0102
NP_442998.1_10 Forward -234 -227 10.4622 0.0819
NP_442998.1_10 Reverse -122 -129 5.74231 0.255
NP_440899.1_2 Reverse -109 -128 5.11187 0.298
NP_440299.1_1 Reverse -116 -129 20.3732 0.00128
NP_440299.1_1 Forward -133 -120 4.73861 0.201
NP_441799.1_1 Forward -133 -119 9.14375 0.0988
NP_441799.1_1 Reverse -116 -130 8.3571 0.117
NP_441007.1_10 Reverse -222 -235 0.0192843 0.254
NP_441007.1_10 Reverse -115 -128 -0.964025 0.296
NP_440256.1_1 Reverse -117 -136 25.1722 0.00147
NP_440256.1_1 Forward -132 -113 -3.73712 0.138
NP_441362.1_2 Forward -183 -164 4.02558 0.287
NP_440709.1_1 Reverse -21 -40 5.30853 0.173
NP_441559.1_8 Reverse -115 -129 -6.78525 0.279
NP_441270.1_5 Forward -113 -94 12.3111 0.237
NP_440915.1_6 Forward -133 -119 1.76955 0.131
NP_440915.1_6 Reverse -116 -130 1.17956 0.145
NP_440915.1_6 Forward -107 -93 -3.34366 0.293
NP_441179.1_9 Reverse -112 -122 9.22267 0.28
NP_442866.1_1 Forward -361 -342 -6.29373 0.254
NP_442866.1_1 Forward -134 -115 -9.44032 0.293
NP_441939.1_3 Forward -128 -109 13.3725 0.0913
NP_442993.1_1 Reverse -120 -136 1.73016 0.0502
NP_442993.1_1 Reverse -1 -17 -11.2495 0.24
NP_442386.1_9 Forward -130 -121 16.7155 0.0144
NP_442386.1_9 Reverse -119 -128 13.8639 0.0289
NP_442386.1_9 Forward -75 -66 7.17747 0.219
NP_442054.1_2 Forward -289 -270 29.9904 0.0000286
NP_442054.1_3 Forward -244 -225 27.7288 0.000126
NP_441340.1_5 Forward -128 -121 15.6737 0.0124
NP_441340.1_5 Reverse -121 -128 15.6737 0.0124
NP_441340.1_9 Reverse -26 -36 13.7504 0.199
NP_441271.1_1 Forward -135 -117 14.768 0.202
NP_442791.1_5 Forward -137 -118 -4.6221 0.279
NP_442240.1_1 Reverse -112 -131 5.11187 0.264
NP_442240.1_2 Forward -106 -87 -20.5517 0.295
NP_440586.1_8 Forward -128 -121 13.2151 0.026
NP_440586.1_8 Reverse -121 -128 13.2151 0.026
NP_440586.1_8 Reverse -95 -102 9.08521 0.178
NP_440586.1_9 Reverse -113 -132 11.3075 0.258
NP_442251.1_6 Forward -128 -121 15.2804 0.0124
NP_442251.1_6 Reverse -121 -128 15.2804 0.0124
NP_441262.1_3 Reverse -120 -127 14.7888 0.0223
NP_441262.1_3 Forward -129 -122 13.9038 0.0336
NP_443051.1_1 Reverse -119 -128 10.4228 0.00754
NP_443051.1_1 Forward -130 -121 1.08137 0.123
NP_440451.1_10 Reverse -88 -107 8.35677 0.264
NP_439984.1_3 Reverse -378 -392 13.2736 0.225
NP_439984.1_7 Reverse -280 -298 -4.99573 0.292
NP_440439.1_1 Reverse -117 -130 9.85238 0.0418
NP_440439.1_6 Forward -43 -24 4.42435 0.242
NP_440372.1_2 Forward -128 -121 16.3621 0.0124
NP_440372.1_2 Reverse -121 -128 16.3621 0.0124
NP_442488.1_3 Reverse -250 -269 17.0107 0.167
NP_439977.1_5 Forward -135 -116 5.60432 0.149
NP_440139.1_1 Forward -135 -116 14.7483 0.0474
NP_441572.1_7 Forward -135 -116 0.392778 0.168
NP_442384.1_10 Forward -129 -116 20.3738 0.00289
NP_442384.1_10 Forward -74 -61 1.88757 0.243
NP_442114.1_4 Forward -129 -118 7.33516 0.29
NP_441877.1_9 Forward -42 -25 24.2283 0.00736
NP_441018.1_7 Reverse -116 -135 13.6675 0.132
NP_442790.1_4 Reverse -111 -130 -15.7335 0.297
NP_442262.1_10 Forward -128 -121 14.1988 0.0123
NP_442262.1_10 Reverse -121 -128 14.1988 0.0123
NP_442262.1_10 Reverse -95 -102 9.38056 0.202
NP_441689.1_5 Forward -131 -121 10.796 0.132
NP_441689.1_5 Reverse -118 -128 5.78111 0.197
NP_440163.1_10 Forward -132 -122 11.3864 0.169
NP_440344.1_10 Forward -136 -119 11.5436 0.006
NP_440344.1_10 Forward -81 -64 -11.9575 0.235
NP_440344.1_10 Reverse -113 -130 -12.8425 0.267
NP_440531.1_6 Reverse -112 -131 -4.32711 0.279
NP_442832.1_6 Reverse -134 -153 18.7807 0.145
NP_441965.1_10 Forward -132 -116 9.20332 0.123
NP_440297.1_9 Reverse -121 -131 0.766681 0.282
NP_440297.1_9 Forward -128 -118 -0.118297 0.282
NP_440350.1_5 Reverse -7 -26 4.62101 0.158
NP_440350.1_5 Forward -166 -147 -6.09707 0.296
NP_441896.1_5 Reverse -59 -66 15.3787 0.268
NP_442078.1_3 Forward -67 -48 12.1917 0.0983
NP_440999.1_9 Forward -133 -119 4.91614 0.114
NP_440888.1_2 Forward -129 -115 13.2736 0.0307
NP_440888.1_2 Reverse -120 -134 12.8803 0.0369
NP_442225.1_10 Forward -90 -71 5.99684 0.287
NP_442277.1_7 Forward -27 -11 -0.184182 0.219
NP_442033.1_6 Reverse -66 -85 16.9124 0.157
NP_442077.1_8 Forward -125 -106 10.3234 0.26
NP_441543.1_2 Forward -128 -119 16.9127 0.00359
NP_441543.1_2 Reverse -121 -130 15.4377 0.00784
NP_441543.1_2 Forward -235 -226 4.71961 0.222
NP_441543.1_5 Reverse -113 -132 13.9625 0.0344
NP_442845.1_2 Reverse -59 -73 14.9459 0.0763
NP_442845.1_2 Forward -135 -121 7.9644 0.195
NP_442845.1_4 Reverse -118 -137 8.16093 0.189
NP_440380.1_1 Reverse -258 -277 -10.6203 0.284
NP_441918.1_7 Forward -193 -174 22.4189 0.0139
NP_441918.1_7 Forward -47 -28 7.17762 0.262
NP_441918.1_8 Reverse -253 -272 17.109 0.157
NP_441918.1_8 Forward -265 -246 16.2241 0.157
NP_441918.1_10 Forward -108 -90 21.4553 0.0511
NP_441469.1_8 Forward -130 -121 8.06287 0.227
NP_441469.1_8 Reverse -119 -128 6.48957 0.227
NP_442637.1_3 Reverse -377 -396 3.04771 0.202
NP_443064.1_6 Reverse -37 -47 10.2399 0.166
NP_443064.1_6 Forward -129 -119 9.75513 0.199
NP_442578.1_7 Forward -128 -121 14.5921 0.026
NP_442578.1_7 Reverse -121 -128 14.5921 0.026
NP_441462.1_2 Reverse -120 -130 10.5998 0.0068
NP_441462.1_2 Forward -129 -119 1.84832 0.081
NP_441462.1_2 Reverse -227 -237 -0.41329 0.225
NP_441462.1_2 Reverse -1 -11 -0.806614 0.254
NP_443062.1_6 Reverse -112 -131 12.5858 0.0975
NP_442204.1_1 Reverse -116 -127 11.5634 0.0565
NP_442204.1_1 Forward -107 -96 0.746988 0.281
NP_440516.1_8 Reverse -120 -129 9.4395 0.0183
NP_440516.1_8 Forward -129 -120 7.17789 0.0754
NP_440516.1_8 Reverse -65 -74 -0.590259 0.283
NP_442428.1_5 Forward -128 -121 15.8704 0.0124
NP_442428.1_5 Reverse -121 -128 15.8704 0.0124
NP_442120.1_10 Reverse -66 -85 -15.5368 0.294
NP_441867.1_2 Reverse -57 -76 -20.2567 0.291
NP_440673.1_2 Forward -139 -120 12.048 0.156
NP_440673.1_3 Reverse -122 -129 14.0021 0.0426
NP_440673.1_3 Forward -127 -120 12.4288 0.0426
NP_440673.1_7 Forward -127 -108 2.94938 0.216
NP_440865.1_9 Forward -135 -116 0.884433 0.128
NP_441052.1_2 Forward -129 -119 11.4848 0.0285
NP_441052.1_2 Forward -74 -64 5.68323 0.107
NP_441052.1_2 Reverse -120 -130 0.668351 0.256
NP_442219.1_9 Forward -128 -119 17.7976 0.00718
NP_442219.1_9 Reverse -121 -130 9.04618 0.0681
NP_440436.1_4 Forward -128 -119 17.2072 0.00233
NP_440436.1_4 Reverse -121 -130 16.9122 0.00357
NP_441884.1_9 Forward -132 -113 -5.01543 0.0594
NP_442577.1_7 Forward -176 -157 7.07848 0.288
NP_441719.1_4 Forward -128 -121 16.3621 0.0124
NP_441719.1_4 Reverse -121 -128 16.3621 0.0124
NP_441733.1_10 Reverse -117 -130 8.67241 0.138
NP_441004.1_4 Reverse -63 -73 11.1898 0.254
NP_442366.1_3 Forward -130 -112 -1.94747 0.219
NP_442366.1_5 Reverse -62 -72 10.206 0.282
NP_440129.1_10 Reverse -113 -127 5.21113 0.185
NP_442873.1_9 Forward -84 -65 7.37347 0.236
NP_440296.1_6 Forward -44 -26 14.6123 0.283
NP_442206.1_10 Forward -129 -114 4.40479 0.178
NP_443054.1_2 Reverse -118 -132 0.687908 0.256
NP_442308.1_4 Reverse -114 -133 3.53937 0.267
NP_441851.1_10 Reverse -119 -129 16.9913 0.00552
NP_441851.1_10 Forward -130 -120 6.76487 0.156
NP_442208.1_5 Reverse -130 -149 -8.16202 0.275
NP_441555.1_2 Reverse -10 -29 15.326 0.188
NP_442515.1_1 Forward -237 -223 -3.93365 0.298
NP_441396.1_5 Forward -102 -93 17.2076 0.141
NP_441396.1_5 Reverse -99 -108 7.47288 0.252
NP_441982.1_6 Reverse -142 -151 11.053 0.288
NP_441982.1_6 Reverse -103 -112 11.053 0.288
NP_441982.1_6 Reverse -169 -178 10.7665 0.292
NP_440165.1_5 Forward -130 -111 -8.06369 0.288
NP_441046.1_2 Forward -203 -184 0.0977854 0.271
NP_440338.1_4 Forward -165 -146 4.22689 0.298
NP_440940.1_7 Forward -139 -121 5.72158 0.225
NP_441349.1_10 Forward -139 -120 -0.590531 0.0947
NP_441409.1_6 Reverse -198 -217 -14.2585 0.253
NP_441394.1_4 Reverse -143 -162 9.93088 0.235
NP_440432.1_9 Forward -128 -113 -1.00341 0.167
NP_439960.1_10 Reverse -113 -131 5.82068 0.144
NP_440474.1_8 Reverse -121 -135 9.6354 0.158
NP_440431.1_3 Forward -130 -111 -12.1936 0.296
NP_441031.1_1 Reverse -19 -38 4.50898 0.288
NP_440943.1_4 Forward -244 -232 17.1486 0.0959
NP_441570.1_1 Forward -129 -111 -9.81395 0.15
NP_441570.1_1 Reverse -120 -138 -14.5338 0.226
NP_441078.1_4 Forward -129 -120 9.93116 0.0203
NP_441078.1_4 Reverse -120 -129 9.83282 0.0226
NP_441078.1_4 Forward -236 -227 5.80125 0.104
NP_441078.1_4 Reverse -227 -236 5.70292 0.111
NP_442729.1_5 Forward -124 -114 8.04317 0.251
NP_441539.1_1 Forward -40 -26 12.3887 0.284
NP_442443.1_1 Forward -206 -187 -3.63879 0.267
NP_441094.1_6 Forward -136 -119 21.5725 0.0416
NP_440526.1_3 Forward -128 -117 8.02298 0.126
NP_441432.1_8 Reverse -119 -128 16.8143 0.00595
NP_441432.1_8 Reverse -182 -191 2.55633 0.298
NP_441333.1_1 Forward -41 -31 11.9712 0.241
NP_442320.1_8 Forward -135 -121 15.9292 0.0102
NP_442320.1_8 Reverse -114 -128 -4.62196 0.177
NP_441732.1_2 Reverse -101 -117 -15.6744 0.155
NP_440497.1_6 Forward -108 -89 -7.08038 0.269
NP_440913.1_1 Reverse -118 -136 4.34571 0.275
NP_440713.1_4 Reverse -110 -129 0.884433 0.3
NP_440713.1_9 Forward -146 -127 17.109 0.197
NP_442489.1_7 Forward -129 -120 10.4228 0.0151
NP_442489.1_7 Reverse -120 -129 10.3245 0.0193
NP_442489.1_7 Forward -10 -1 -1.57357 0.213
NP_441830.1_2 Reverse -258 -277 -5.60541 0.291
NP_440559.1_1 Forward -128 -119 17.4043 0.00658
NP_440559.1_1 Reverse -121 -130 8.84951 0.0586
NP_441659.2_8 Forward -129 -119 15.9097 0.00467
NP_441659.2_8 Reverse -120 -130 2.33998 0.205
NP_441659.2_8 Forward -192 -182 -0.216628 0.292
NP_441040.1_2 Forward -111 -92 -8.85033 0.236
NP_442849.1_1 Reverse -142 -156 7.76774 0.282
NP_440442.1_3 Forward -130 -116 15.0442 0.287
NP_440029.1_5 Reverse -186 -205 18.0915 0.178
NP_442346.1_5 Reverse -119 -129 16.2046 0.00277
NP_442346.1_5 Forward -130 -120 6.8632 0.188
NP_442346.1_5 Reverse -226 -236 4.69992 0.276
NP_440545.1_3 Forward -240 -223 1.02215 0.127
NP_440545.1_3 Reverse -116 -133 -7.13932 0.298
NP_440459.1_2 Forward -105 -88 10.8552 0.189
NP_441653.1_2 Reverse -109 -128 13.5795 0.0959
NP_440010.1_4 Reverse -110 -129 2.9486 0.221
NP_442311.1_5 Forward -204 -185 3.93269 0.245
NP_442603.1_7 Forward -129 -115 13.077 0.0925
NP_441888.1_7 Reverse -115 -129 14.4542 0.0743
NP_441833.1_4 Forward -128 -121 15.9687 0.0124
NP_441833.1_4 Reverse -121 -128 15.9687 0.0124
NP_441329.1_1 Forward -43 -24 7.59119 0.236
NP_441329.1_3 Forward -177 -167 16.16 0.231
NP_441329.1_6 Forward -30 -11 -2.62645 0.294
NP_441112.1_6 Forward -20 -1 -2.0655 0.296
NP_442162.1_9 Forward -128 -121 16.2637 0.0124
NP_442162.1_9 Reverse -121 -128 16.2637 0.0124
NP_440671.1_1 Forward -42 -23 15.7972 0.0861
NP_440671.1_1 Reverse -159 -178 7.47092 0.213
NP_440671.1_4 Forward -135 -121 15.0442 0.0512
NP_440671.1_4 Forward -16 -2 9.34103 0.184
NP_442140.1_3 Forward -128 -118 10.3048 0.0902
NP_442140.1_3 Reverse -121 -131 8.04317 0.124
NP_440875.1_9 Forward -127 -117 8.37203 0.233
NP_441813.1_3 Reverse -132 -151 15.4008 0.238
NP_441813.1_5 Reverse -118 -128 18.1713 0.00743
NP_441813.1_5 Forward -131 -121 16.4013 0.01
NP_440594.1_5 Forward -169 -150 5.40686 0.293
NP_442089.1_6 Reverse -2 -21 7.27595 0.187
NP_440590.1_4 Forward -128 -115 5.72248 0.0585
NP_440567.1_1 Reverse -121 -135 20.0591 0.0136
NP_440567.1_1 Forward -128 -114 5.01447 0.108
NP_440567.1_6 Forward -79 -60 10.0292 0.163
NP_440567.1_6 Reverse -121 -140 6.98095 0.228
NP_440719.1_6 Forward -355 -336 23.2047 0.0295
NP_442497.1_10 Forward -128 -119 10.4228 0.0087
NP_442497.1_10 Reverse -121 -130 8.55452 0.0294
NP_442497.1_10 Forward -235 -226 0.29472 0.199
NP_440821.1_4 Forward -131 -121 10.3048 0.0163
NP_440821.1_4 Reverse -118 -128 9.41981 0.0286
NP_440821.1_4 Reverse -225 -235 -0.0199663 0.217
NP_441239.1_9 Forward -131 -119 11.7404 0.0551
NP_441239.1_9 Forward -280 -268 4.36554 0.253
NP_441239.1_9 Reverse -118 -130 3.67722 0.279
NP_441727.1_8 Forward -134 -115 1.0811 0.238
NP_441892.1_1 Reverse -111 -128 -4.18939 0.256
NP_442193.1_8 Forward -201 -182 14.3549 0.211
NP_442643.1_1 Forward -135 -116 -0.590531 0.143
NP_441541.1_1 Forward -41 -23 8.59626 0.116
NP_442216.1_2 Forward -253 -234 19.3707 0.000859
NP_440212.1_1 Forward -261 -242 4.22769 0.163
NP_440212.1_3 Forward -282 -263 8.06259 0.297
NP_442138.1_10 Forward -129 -110 8.25926 0.0577
NP_440546.1_4 Reverse -120 -130 13.5365 0.0459
NP_440546.1_4 Forward -129 -119 10.8217 0.104
NP_440546.1_4 Reverse -227 -237 8.49468 0.186
NP_440546.1_4 Forward -236 -226 7.62206 0.23
NP_440546.1_4 Reverse -65 -75 7.23423 0.252
NP_440546.1_6 Forward -139 -120 6.88262 0.283
NP_441656.1_7 Reverse -192 -211 21.9991 0.0105
NP_440462.1_6 Forward -131 -121 14.7297 0.0186
NP_440462.1_6 Reverse -118 -128 9.61647 0.0429
NP_440462.1_6 Reverse -272 -282 1.25834 0.297
NP_440868.1_4 Reverse -116 -128 8.00379 0.0602
NP_440868.1_4 Forward -133 -121 0.825626 0.199
NP_440868.1_8 Reverse -223 -242 4.22769 0.103
NP_442499.1_3 Reverse -59 -77 4.34571 0.289
NP_442402.1_4 Forward -188 -169 -3.83621 0.22
NP_441848.1_4 Reverse -164 -180 12.3253 0.206
NP_442460.1_7 Forward -141 -122 1.37609 0.249
NP_442039.1_4 Forward -128 -121 15.1821 0.0124
NP_442039.1_4 Reverse -121 -128 15.1821 0.0124
NP_442679.1_1 Forward -23 -4 -5.01543 0.288
NP_441926.1_3 Reverse -1 -17 4.77842 0.179
NP_442837.1_3 Forward -128 -121 15.7721 0.0124
NP_442837.1_3 Reverse -121 -128 15.7721 0.0124
NP_442053.1_1 Reverse -120 -129 9.24284 0.068
NP_442053.1_1 Forward -129 -120 8.94785 0.07
NP_440505.1_3 Reverse -118 -128 18.3679 0.00213
NP_442360.1_5 Reverse -138 -148 12.6647 0.298
NP_441959.1_5 Forward -119 -100 6.98095 0.26
NP_440914.1_1 Forward -129 -119 16.3248 0.00196
NP_440914.1_1 Forward -74 -64 11.3477 0.097
NP_440914.1_1 Reverse -183 -193 8.71269 0.186
NP_440914.1_7 Reverse -362 -381 4.91741 0.29
NP_441011.1_8 Reverse -121 -130 18.191 0.00602
NP_441011.1_8 Forward -128 -119 8.25953 0.144
NP_442533.1_1 Forward -210 -191 -17.6018 0.291
NP_442533.1_6 Reverse -120 -129 15.1427 0.00675
NP_442533.1_6 Forward -129 -120 7.47288 0.0898
NP_442533.1_6 Forward -74 -65 2.75299 0.241
NP_443016.1_1 Forward -242 -223 -6.78538 0.263
NP_441482.1_7 Reverse -114 -128 6.88276 0.0257
NP_439944.1_9 Forward -128 -118 10.5014 0.0887
NP_439944.1_9 Reverse -121 -131 8.63316 0.105
NP_439944.1_9 Forward -235 -225 5.19158 0.27
NP_440816.1_7 Reverse -223 -242 9.83255 0.252
NP_441028.1_6 Forward -112 -102 16.5975 0.137
NP_441028.1_6 Forward -151 -141 14.6309 0.158
NP_441527.1_4 Forward -23 -4 -3.1994 0.164
NP_441527.1_4 Forward -27 -8 -12.3666 0.285
NP_441527.1_4 Reverse -147 -166 -12.6531 0.292
NP_440115.1_6 Reverse -117 -127 16.008 0.0325
NP_439965.1_1 Forward -138 -119 -2.75381 0.177
NP_441347.1_9 Forward -40 -27 15.135 0.153
NP_441961.1_4 Forward -137 -118 5.70265 0.27
NP_441602.1_4 Reverse -109 -128 9.63589 0.278
NP_441972.1_5 Forward -277 -258 -5.70374 0.224
NP_441972.1_5 Forward -128 -109 -9.93197 0.294
NP_441106.1_1 Forward -130 -121 17.306 0.00607
NP_441106.1_1 Reverse -119 -128 9.63616 0.0311
NP_439903.1_6 Forward -132 -113 -0.0996487 0.276
NP_442588.1_6 Forward -126 -107 0.0977854 0.252
NP_441286.1_1 Reverse -119 -131 5.25052 0.0259
NP_441286.1_1 Forward -130 -118 -5.76255 0.223
NP_440670.1_8 Reverse -120 -129 8.94785 0.0606
NP_440670.1_8 Forward -129 -120 8.84951 0.0606
NP_441479.1_4 Reverse -216 -235 10.7175 0.152
NP_440886.1_7 Forward -130 -120 9.02601 0.0805
NP_442717.1_4 Forward -167 -148 3.04771 0.207
NP_440205.1_4 Forward -65 -46 14.9458 0.238
NP_441808.1_8 Forward -204 -185 6.68596 0.284
NP_440907.2_8 Forward -235 -225 6.46942 0.165
NP_440907.2_8 Reverse -121 -131 4.99446 0.228
NP_441021.1_1 Forward -128 -109 -7.27704 0.182
NP_442459.1_5 Reverse -108 -127 20.1573 0.0931
NP_441463.1_2 Forward -45 -27 5.08004 0.174
NP_441626.1_2 Forward -128 -121 15.7721 0.0124
NP_441626.1_2 Reverse -121 -128 15.7721 0.0124
NP_442365.1_7 Reverse -116 -135 -4.52377 0.245
NP_442238.1_7 Reverse -316 -335 9.24175 0.224
NP_440107.1_5 Reverse -113 -132 -2.16383 0.178
NP_442794.1_1 Reverse -116 -128 20.0002 0.00523
NP_442615.1_1 Reverse -218 -236 5.82068 0.0374
NP_442615.1_1 Forward -138 -120 3.26407 0.0561
NP_441962.1_4 Forward -134 -115 -7.96535 0.195
NP_440387.1_1 Forward -129 -113 -4.07137 0.174
NP_441431.1_2 Reverse -224 -238 6.58715 0.266
NP_441836.1_2 Forward -135 -116 8.35759 0.101
NP_441993.1_1 Reverse -263 -282 5.06532 0.208
NP_442224.1_1 Forward -131 -112 6.19431 0.164
NP_440467.1_3 Forward -128 -109 10.9633 0.293
NP_440114.1_10 Reverse -120 -134 14.0609 0.0446
NP_442090.1_2 Reverse -17 -36 6.54077 0.281
NP_440311.1_8 Forward -134 -120 17.5025 0.272
NP_441510.2_7 Forward -80 -66 9.6354 0.281
NP_440287.1_6 Forward -170 -151 0.491109 0.29
NP_441552.1_3 Forward -136 -117 12.4867 0.292
NP_440766.1_4 Reverse -116 -130 10.0294 0.0871
NP_441421.1_6 Reverse -26 -43 13.994 0.212
NP_441421.1_6 Reverse -25 -42 10.6517 0.279
NP_439988.1_3 Reverse -61 -75 5.99778 0.278
NP_442743.1_5 Reverse -121 -140 3.14605 0.277
NP_439910.1_2 Forward -137 -120 -2.91109 0.0305
NP_440457.1_1 Reverse -116 -128 7.61046 0.101
NP_440457.1_1 Forward -133 -121 0.0389777 0.25
NP_442297.1_4 Forward -133 -114 11.6543 0.294
NP_442509.1_9 Reverse -120 -130 6.86274 0.248
NP_440554.1_4 Reverse -121 -131 16.6963 0.0189
NP_440554.1_4 Forward -128 -118 8.92815 0.0646
NP_441885.1_5 Forward -129 -119 11.1898 0.00775
NP_441885.1_5 Reverse -120 -130 10.2065 0.012
NP_441885.1_5 Reverse -227 -237 -0.904945 0.241
NP_440478.1_10 Forward -131 -117 7.27608 0.264
NP_442703.1_1 Reverse -23 -42 15.135 0.13
NP_442703.1_4 Forward -80 -61 1.27698 0.284
NP_442341.1_9 Reverse -63 -77 7.76712 0.187
NP_441173.1_9 Forward -177 -169 14.0803 0.17
NP_441173.1_9 Forward -176 -168 10.9338 0.242
NP_440423.1_10 Reverse -113 -132 22.6156 0.0302
NP_443000.1_7 Reverse -118 -128 19.9412 0.00223
NP_443000.1_7 Forward -131 -121 8.04317 0.0553
NP_440552.1_8 Forward -38 -21 18.3866 0.0428
NP_441842.1_10 Forward -136 -122 9.14437 0.199
NP_440275.1_3 Reverse -118 -128 15.123 0.0182
NP_440560.1_5 Reverse -32 -51 13.5712 0.149
NP_440091.1_1 Forward -133 -121 22.4584 0.00953
NP_443060.1_5 Forward -137 -118 9.24175 0.196
NP_441397.1_8 Reverse -142 -155 11.9028 0.284
NP_443010.1_10 Forward -132 -115 2.28762 0.277
NP_441207.1_7 Reverse -146 -160 16.71 0.179
NP_440149.1_8 Forward -129 -110 -4.03212 0.201
NP_440149.1_8 Reverse -120 -139 -4.13045 0.202
NP_441105.1_3 Reverse -109 -128 0.687771 0.122
NP_440216.1_1 Reverse -120 -134 -2.26202 0.0484
NP_440216.1_1 Forward -129 -115 -10.3252 0.145
NP_440216.1_9 Forward -260 -251 7.57121 0.286
NP_440216.1_9 Forward -61 -52 6.09625 0.289
NP_440172.1_1 Reverse -120 -130 10.9931 0.0445
NP_440172.1_1 Forward -129 -119 5.28991 0.146
NP_440172.1_1 Reverse -1 -11 2.92996 0.258
NP_442015.1_10 Reverse -116 -129 11.3273 0.0372
NP_441226.1_7 Forward -128 -121 14.4934 0.0123
NP_441226.1_7 Reverse -121 -128 14.4934 0.0123
NP_440305.1_1 Reverse -175 -189 14.8129 0.193
NP_441111.1_7 Forward -128 -120 18.7023 0.00294
NP_441111.1_7 Reverse -121 -129 8.86921 0.0589
NP_440244.1_1 Reverse -259 -278 -2.95047 0.224
NP_441766.1_2 Reverse -120 -129 17.896 0.00297
NP_441766.1_2 Forward -129 -120 9.4395 0.0285
NP_442417.1_5 Forward -129 -115 9.93102 0.124
NP_440416.1_9 Reverse -113 -132 -8.94866 0.123
NP_440416.1_9 Forward -136 -117 -14.1602 0.173
NP_443052.1_8 Forward -139 -120 -6.78538 0.147
NP_442116.1_6 Forward -182 -165 13.23 0.172
NP_440261.1_5 Forward -235 -222 8.37742 0.0263
NP_440261.1_5 Forward -128 -115 -2.63565 0.0924
NP_440988.1_10 Forward -194 -180 5.67333 0.24
NP_440988.1_10 Forward -76 -62 4.80201 0.25
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGATAAACCGCTAGCCCACTACATTAACTATGTAAACCATTTGGAGCCTTCTGCCTGGTCAAGACAAGAAGTAAAGGAGTAACTGACTAGTTTTCCATTTAAATGGAGCTAAGCGGGCTCGAACCGCTGACCCCTTGCATGCCATGCAAGTGCTCTACCAACTGAGCTATAGCCCCGAGTCACAGTATTCTATTGTGCTGAAAGTGGTGCCCATTGTCAAGCTTTTTACCAAAATTATCCTTGATCTTCTTTTCCCCTAGGGTTCTGGAACAGCGATCGCCAGGGTGGTTTTCCCCTATCGATGGGGGCTGGTTACCATTCATAATCCCGATGCCCAAACCATGTAAAATACAGGGTGATTGTTAAGTTTTTTTAACAGAAAAAGCAAAAGGAGGTTGCC

CDS

ATGGAACGCACATTTATCATGATCAAGCCCGATGGGGTACAACGGCAATTAATTGGGGAAATTGTTGGCCGTTTCGAGAAAAAAGGCTTCAAATTAGTCGCCATGAAGGTGATGACTGTCTCCCAAGAATTAGCCGAAAAACATTACGAAGCTCTCAACGACAAACCGTTCTTTTCCGGCTTGGTGAACTTCATTTGTTCCTCTCCCGTGGTGGCCATGGTCTGGGAAGGTAATTCCATCGTTTCTACTTCCCGCCAAATGATTGGTGCAACTGATCCCCATGCTGCCGCCCCTGGTACTATCCGGGGAGATTACGGTGTGTCCGTTGGTCGCAACATTATCCATGGTTCCGATGCCATTGAAACCGCTAAACGGGAAATTTCCCTCTGGTTTAAGGATGAGGAAGTGAATGAATGGGATGCCACCCTTAACCCTTGGTTGTACGAGTAG

Protein

MERTFIMIKPDGVQRQLIGEIVGRFEKKGFKLVAMKVMTVSQELAEKHYEALNDKPFFSGLVNFICSSPVVAMVWEGNSIVSTSRQMIGATDPHAAAPGTIRGDYGVSVGRNIIHGSDAIETAKREISLWFKDEEVNEWDATLNPWLYE