Your browser is old and dusty. Try Google Chrome!

Details for sll1851

ORF sll1851
Accession NP_441919.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_4 Forward -136 -117 9.63507 0.278
NP_441418.1_1 Reverse -371 -390 10.074 0.205
NP_441480.1_1 Forward -142 -123 -0.787193 0.287
NP_440897.1_6 Reverse -250 -269 3.9319 0.14
NP_442151.1_1 Reverse -87 -106 4.42435 0.287
NP_440226.1_9 Reverse -193 -212 12.1925 0.215
NP_441098.1_3 Reverse -213 -232 -6.50185 0.28
NP_440996.1_1 Reverse -201 -220 18.6308 0.0234
NP_440996.1_2 Reverse -157 -166 14.8477 0.248
NP_441812.1_4 Reverse -260 -278 11.9172 0.253
NP_441470.1_4 Reverse -330 -349 27.5321 0.0000116
NP_441470.1_6 Reverse -187 -206 28.2204 0.0000759
NP_441470.1_7 Reverse -286 -305 27.2371 0.000139
NP_442972.1_2 Reverse -175 -189 15.2402 0.136
NP_442268.1_3 Forward -264 -245 12.9783 0.284
NP_441492.1_1 Reverse -82 -101 11.1109 0.148
NP_442742.1_9 Reverse -12 -31 -12.9802 0.269
NP_441365.1_5 Reverse -82 -101 37.5619 0.000000115
NP_440300.1_5 Forward -73 -55 12.225 0.271
NP_441434.1_1 Forward -233 -219 10.0383 0.233
NP_441434.1_1 Reverse -219 -233 7.93745 0.26
NP_440178.1_7 Forward -257 -238 -15.0452 0.156
NP_441716.1_2 Forward -50 -31 3.35565 0.229
NP_442973.1_5 Reverse -90 -109 9.93088 0.287
NP_441014.1_10 Forward -388 -369 2.16195 0.216
NP_442730.1_8 Forward -136 -117 8.16011 0.185
NP_442687.1_7 Reverse -131 -141 4.20827 0.262
NP_442687.1_7 Forward -361 -351 4.10993 0.266
NP_442720.1_8 Forward -390 -372 10.0489 0.297
NP_442720.1_8 Forward -313 -295 7.59063 0.297
NP_442658.1_1 Reverse -97 -107 6.37109 0.231
NP_442496.1_5 Reverse -149 -167 4.83737 0.288
NP_440200.1_7 Reverse -145 -164 6.22677 0.204
NP_441913.1_1 Reverse -258 -274 13.6262 0.246
NP_442598.1_2 Forward -292 -283 14.2577 0.252
NP_441000.1_1 Reverse -81 -99 13.3937 0.184
NP_440345.1_3 Reverse -11 -25 13.1895 0.219
NP_441369.1_1 Reverse -47 -66 38.7419 0.000000157
NP_441369.1_2 Reverse -77 -96 38.9385 0.0000000955
NP_441369.1_3 Reverse -30 -44 28.5156 0.00021
NP_441079.1_3 Reverse -101 -120 13.4708 0.166
NP_441079.1_7 Reverse -23 -42 -7.57277 0.295
NP_441566.1_3 Reverse -145 -164 14.5524 0.198
NP_001035871.2_4 Forward -365 -346 10.3234 0.248
NP_440437.1_1 Reverse -241 -260 -5.80207 0.292
NP_442288.1_5 Reverse -45 -59 16.7159 0.12
NP_441556.1_6 Reverse -49 -67 12.4797 0.296
NP_442247.1_5 Forward -74 -60 14.4865 0.234
NP_442933.1_1 Forward -400 -381 7.68668 0.253
NP_442933.1_1 Forward -198 -179 7.11373 0.253
NP_442933.1_2 Reverse -379 -397 7.64134 0.257
NP_442671.1_2 Reverse -55 -74 24.6829 0.000359
NP_442970.1_1 Reverse -57 -71 9.56081 0.269
NP_440405.1_6 Reverse -213 -231 2.18243 0.26
NP_440125.1_1 Forward -29 -10 16.5191 0.0538
NP_441865.1_3 Forward -42 -24 13.8838 0.242
NP_440881.1_10 Forward -264 -251 11.3273 0.249
NP_442076.1_5 Reverse -51 -70 9.93088 0.186
NP_440183.1_1 Forward -326 -307 8.25926 0.244
NP_441826.1_2 Reverse -250 -264 -0.197071 0.204
NP_441826.1_6 Reverse -211 -225 20.5508 0.0182
NP_441612.1_2 Reverse -155 -165 11.5505 0.21
NP_441911.1_10 Reverse -380 -399 7.40211 0.274
NP_440871.1_3 Forward -51 -37 15.905 0.166
NP_442775.1_6 Forward -332 -313 10.5209 0.277
NP_442903.1_2 Reverse -379 -398 6.92274 0.165
NP_440274.1_2 Forward -351 -337 12.3887 0.236
NP_441878.1_6 Reverse -350 -360 -7.29646 0.217
NP_441036.1_7 Reverse -151 -161 16.7941 0.0578
NP_441445.1_1 Forward -274 -255 1.17943 0.259
NP_440084.1_5 Forward -339 -320 13.7658 0.124
NP_441116.1_10 Forward -163 -144 4.71934 0.257
NP_442047.1_2 Forward -277 -263 15.4376 0.161
NP_441633.1_6 Forward -176 -157 8.75091 0.182
NP_440136.1_1 Forward -210 -194 9.69426 0.238
NP_442998.1_5 Reverse -78 -88 8.53483 0.261
NP_440899.1_8 Forward -70 -51 -9.14533 0.258
NP_441118.1_2 Reverse -118 -137 24.4839 0.000875
NP_441118.1_10 Reverse -250 -268 24.0119 0.000829
NP_441362.1_2 Reverse -53 -72 5.55684 0.243
NP_441362.1_4 Forward -27 -9 7.19731 0.292
NP_442158.1_4 Forward -28 -18 12.1731 0.257
NP_441296.1_6 Forward -242 -223 0.982764 0.299
NP_440733.1_2 Reverse -23 -41 16.5221 0.105
NP_440537.1_7 Reverse -31 -50 16.6629 0.0599
NP_440306.1_3 Reverse -214 -233 4.71934 0.295
NP_441340.1_5 Reverse -257 -264 8.8889 0.084
NP_441248.1_10 Reverse -334 -344 14.9073 0.277
NP_439976.1_1 Reverse -16 -28 17.6396 0.272
NP_440192.1_4 Reverse -333 -352 12.6963 0.169
NP_440372.1_3 Reverse -58 -72 15.0039 0.165
NP_441138.1_5 Forward -399 -386 20.879 0.0216
NP_441293.1_6 Forward -349 -330 16.09 0.1
NP_442114.1_8 Reverse -384 -398 6.98048 0.234
NP_441018.1_3 Forward -256 -237 10.52 0.286
NP_440530.1_6 Forward -249 -235 15.7664 0.201
NP_442910.1_1 Reverse -268 -287 -7.57203 0.254
NP_440189.1_2 Reverse -343 -362 1.27776 0.268
NP_440562.1_5 Forward -314 -295 3.04771 0.261
NP_440350.1_5 Forward -303 -284 1.57275 0.158
NP_440350.1_5 Forward -395 -376 -4.32711 0.273
NP_442129.1_6 Reverse -56 -75 13.9464 0.246
NP_440888.1_2 Reverse -351 -365 7.96378 0.175
NP_440888.1_2 Forward -134 -120 6.19383 0.243
NP_441771.1_4 Reverse -154 -173 -4.42544 0.292
NP_440179.1_6 Forward -359 -340 4.03102 0.246
NP_440663.1_6 Forward -264 -245 14.4541 0.0249
NP_442277.1_7 Reverse -384 -400 1.05721 0.205
NP_442277.1_7 Reverse -378 -394 -1.61656 0.278
NP_442845.1_2 Reverse -250 -264 3.93283 0.272
NP_442710.1_6 Reverse -164 -183 6.39097 0.204
NP_442710.1_7 Reverse -54 -73 -7.22274 0.294
NP_439907.1_10 Reverse -248 -267 11.0117 0.273
NP_441462.1_2 Forward -360 -350 -0.904945 0.265
NP_440519.1_6 Forward -139 -125 9.43936 0.29
NP_440544.1_5 Forward -305 -298 13.8024 0.28
NP_440454.1_2 Reverse -386 -400 9.94278 0.291
NP_442577.1_4 Forward -36 -17 18.6823 0.0318
NP_442139.1_10 Forward -334 -315 12.1917 0.188
NP_442694.1_8 Forward -71 -53 12.3105 0.191
NP_443054.1_2 Reverse -349 -363 0.982901 0.251
NP_441396.1_2 Forward -397 -380 7.21627 0.107
NP_441982.1_10 Forward -99 -80 8.55343 0.143
NP_440005.1_3 Reverse -217 -236 21.2407 0.00993
NP_442689.1_8 Forward -71 -54 -8.61428 0.294
NP_441661.1_3 Reverse -292 -309 -3.99273 0.226
NP_441124.1_5 Reverse -50 -60 12.7217 0.215
NP_440431.1_3 Reverse -249 -268 -10.7186 0.276
NP_440431.1_4 Reverse -376 -395 6.34979 0.07
NP_440040.1_8 Reverse -373 -392 7.87766 0.203
NP_440943.1_5 Reverse -96 -110 14.1593 0.22
NP_442348.1_2 Forward -310 -301 11.7994 0.225
NP_442906.1_9 Forward -175 -156 4.32602 0.207
NP_441432.1_8 Reverse -124 -133 2.85133 0.281
NP_441333.1_1 Forward -389 -379 13.0198 0.217
NP_441333.1_1 Forward -400 -390 12.9245 0.217
NP_442400.1_10 Reverse -385 -398 13.8126 0.173
NP_442489.1_7 Reverse -351 -360 -1.47524 0.203
NP_441706.1_1 Forward -399 -380 4.52268 0.081
NP_440284.1_8 Reverse -88 -107 29.6945 0.000000161
NP_440284.1_9 Reverse -156 -175 28.8104 0.00000727
NP_440336.1_1 Reverse -180 -199 10.5209 0.286
NP_441329.1_1 Forward -161 -142 5.29938 0.265
NP_441329.1_6 Reverse -286 -305 12.0793 0.106
NP_441329.1_6 Reverse -381 -400 11.2199 0.106
NP_441329.1_6 Reverse -284 -303 -2.14899 0.293
NP_442436.1_4 Forward -199 -185 12.3893 0.218
NP_440227.1_2 Reverse -227 -243 8.41667 0.29
NP_441239.1_9 Forward -362 -350 4.26721 0.256
NP_442568.1_8 Reverse -286 -300 10.7177 0.257
NP_441541.1_1 Reverse -67 -85 -3.43572 0.264
NP_440833.1_4 Forward -315 -297 14.3755 0.0722
NP_442499.1_4 Reverse -254 -268 11.0127 0.226
NP_442499.1_6 Reverse -1 -20 8.06259 0.267
NP_442840.1_7 Reverse -158 -177 13.5691 0.064
NP_440341.1_7 Forward -284 -270 12.6843 0.2
NP_442402.1_4 Reverse -4 -23 -8.35941 0.281
NP_442402.1_10 Reverse -14 -24 11.2876 0.264
NP_441848.1_4 Reverse -233 -249 7.74165 0.288
NP_441811.1_8 Reverse -339 -353 5.80112 0.289
NP_442679.1_1 Reverse -381 -400 4.42435 0.147
NP_442679.1_1 Reverse -179 -198 3.83436 0.147
NP_442053.1_1 Reverse -351 -360 5.70292 0.172
NP_441959.1_8 Reverse -57 -70 8.61288 0.286
NP_442456.1_5 Reverse -121 -139 6.80398 0.26
NP_442532.1_1 Reverse -371 -385 11.5713 0.215
NP_442533.1_6 Reverse -351 -360 2.35967 0.259
NP_441482.1_7 Reverse -345 -359 -11.0135 0.229
NP_442203.1_1 Reverse -374 -388 14.8129 0.228
NP_441028.1_6 Forward -162 -152 14.6309 0.158
NP_441527.1_4 Reverse -378 -397 3.77151 0.111
NP_441527.1_4 Reverse -285 -304 -1.09858 0.146
NP_441527.1_4 Reverse -284 -303 -1.28956 0.146
NP_441527.1_4 Reverse -287 -306 -1.67153 0.148
NP_441527.1_4 Reverse -381 -400 -3.29489 0.164
NP_441527.1_4 Reverse -288 -307 -4.15432 0.179
NP_441527.1_4 Reverse -376 -395 -4.72727 0.188
NP_441527.1_4 Reverse -375 -394 -9.88384 0.262
NP_441527.1_4 Reverse -286 -305 -11.5072 0.282
NP_441527.1_4 Reverse -147 -166 -12.1756 0.285
NP_441527.1_4 Reverse -372 -391 -12.7486 0.293
NP_439965.1_1 Forward -319 -300 -10.4236 0.3
NP_442673.1_5 Forward -181 -163 11.4255 0.272
NP_441106.1_7 Reverse -318 -337 13.0766 0.205
NP_441825.1_4 Forward -310 -300 12.5664 0.249
NP_440670.1_8 Reverse -351 -360 3.14632 0.296
NP_442463.1_3 Forward -140 -121 10.0292 0.275
NP_439940.1_1 Reverse -29 -48 31.957 0.00000438
NP_440404.1_9 Reverse -372 -391 10.265 0.209
NP_442842.1_10 Forward -392 -373 0.950819 0.254
NP_440855.1_3 Forward -291 -272 9.63507 0.185
NP_441431.1_1 Forward -72 -54 5.06306 0.245
NP_442805.1_6 Reverse -118 -137 1.86774 0.292
NP_440114.1_10 Reverse -99 -113 7.37441 0.236
NP_440114.1_10 Forward -360 -346 5.80112 0.292
NP_442324.1_7 Reverse -87 -106 6.24429 0.268
NP_440766.1_5 Reverse -153 -165 7.65579 0.288
NP_440278.1_1 Reverse -311 -330 9.53756 0.155
NP_440213.1_4 Forward -181 -162 15.6421 0.217
NP_442680.1_5 Reverse -224 -243 1.73297 0.237
NP_441436.1_8 Reverse -274 -293 7.07928 0.293
NP_441496.1_1 Forward -171 -157 14.3354 0.265
NP_440185.1_9 Reverse -341 -358 11.9369 0.264
NP_440628.1_1 Reverse -390 -400 14.6456 0.248
NP_442341.1_5 Reverse -232 -251 15.0441 0.182
NP_441173.1_9 Reverse -16 -24 13.1954 0.184
NP_440191.1_6 Forward -72 -58 13.1895 0.294
NP_441397.1_8 Reverse -153 -166 15.8179 0.142
NP_441902.1_3 Reverse -153 -163 13.0789 0.23
NP_442451.1_7 Reverse -52 -71 12.9791 0.113
NP_442451.1_7 Reverse -183 -202 8.65258 0.26
NP_441190.1_2 Reverse -161 -180 4.03102 0.17
NP_441207.1_7 Reverse -378 -392 15.0642 0.179
NP_440175.1_4 Reverse -343 -362 -2.36049 0.122
NP_440216.1_9 Reverse -258 -267 5.50626 0.292
NP_441064.1_4 Forward -279 -260 7.07928 0.276
NP_440117.1_7 Reverse -194 -208 17.9942 0.0592
NP_442116.1_6 Reverse -278 -295 12.5616 0.172
NP_442116.1_6 Forward -73 -56 7.50051 0.254
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTTTCTGTTTATTTTCATTTTCTTTAATGCGTAATATACGGCACTCGGCCTCACTCCAAATTTCTTGGCTCTGTCTATCAATCTTGCATCGGGATTTTCTTCTACGTCTTTTTTTAGAGCTTCCCAGTCTAATTTCCTATGGCGACGCTCTACTTTTGTTGGGCTTAAATCTACTCTATTTAACCATCTGTATATCGAGGCTTTTCCTATTTTATATATCTTGGAAGCCTCAGTTATTTTTCCTCCAGCTTCTATATAAGCTACTACCCTTTGCCTTAAATCTAAACTGTAAGCCATTGTTTAAACCTGTTCATTTTGTACACTCCATAATTTTACATTAAATTCTCTCATCGTTAATTGAAATGACTATATTTTTTGGGAGAAACCTATGAATATTCC

CDS

ATGCGTTATGACAATGGTTGCATTGGTTTACTGACCATTATGAAAAATGTCCGTTTTTTTCCTCCTCTACACATGATTTATGCCTACGTTCCCCTGCCCAGCTTGCACGGTGATGATGTCAATCTAGAGTTGAGTAAAATTCGCATCCAGCCCATCTACGTTACGGCAAAACGTCGTGGCATTATGGGCTATTTGGTCAGTCATTTTCTCTTGCTTTGCACAAAATTAGCTTACTATTTCCTGCGCCATGAAGACGGTTTGATTTATGACAATATTCAATTTAAGCCCAATATTCTATTGAGTGTTGATAAACCGCTAGCCCACTACATTAACTATGTAAACCATTTGGAGCCTTCTGCCTGGTCAAGACAAGAAGTAAAGGAGTAA

Protein

MRYDNGCIGLLTIMKNVRFFPPLHMIYAYVPLPSLHGDDVNLELSKIRIQPIYVTAKRRGIMGYLVSHFLLLCTKLAYYFLRHEDGLIYDNIQFKPNILLSVDKPLAHYINYVNHLEPSAWSRQEVKE