Your browser is old and dusty. Try Google Chrome!

Details for sll1849

ORF sll1849
Accession NP_441922.1
Symbol
Category Other
Definition probable dioxygenase Rieske iron-sulfur component
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -248 -262 5.40779 0.137
NP_441061.1_2 Forward -192 -178 3.24451 0.166
NP_441061.1_2 Forward -243 -229 0.196253 0.215
NP_440795.1_7 Forward -192 -185 14.6904 0.0123
NP_440795.1_7 Reverse -185 -192 14.6904 0.0123
NP_441418.1_6 Reverse -184 -203 -20.0601 0.103
NP_442291.1_5 Forward -194 -178 6.64671 0.0694
NP_442291.1_5 Reverse -183 -199 -3.28472 0.239
NP_441453.1_4 Reverse -184 -192 16.539 0.00633
NP_441453.1_4 Forward -193 -185 16.539 0.00633
NP_442151.1_6 Forward -193 -179 14.3559 0.0362
NP_442151.1_6 Reverse -184 -198 6.3911 0.236
NP_442151.1_6 Reverse -202 -216 5.89945 0.256
NP_442151.1_6 Reverse -259 -273 5.1128 0.294
NP_442838.1_3 Forward -91 -73 16.3421 0.223
NP_441818.1_1 Forward -192 -181 15.6928 0.0257
NP_441818.1_9 Reverse -16 -35 -9.93197 0.291
NP_440226.1_1 Forward -193 -174 15.3391 0.025
NP_440226.1_1 Reverse -184 -203 11.6025 0.0519
NP_442173.1_1 Forward -192 -184 15.4574 0.00633
NP_442173.1_1 Reverse -185 -193 15.4574 0.00633
NP_442752.1_4 Forward -193 -186 13.8055 0.0199
NP_442752.1_4 Reverse -184 -191 13.8055 0.0199
NP_443027.1_4 Reverse -182 -192 13.1564 0.0521
NP_443027.1_4 Forward -195 -185 5.87989 0.294
NP_441812.1_3 Reverse -183 -197 7.47274 0.272
NP_442975.1_10 Forward -197 -183 19.3701 0.00397
NP_442975.1_10 Reverse -180 -194 3.04726 0.263
NP_440784.1_7 Forward -192 -185 15.9687 0.0123
NP_440784.1_7 Reverse -185 -192 15.9687 0.0123
NP_442909.1_7 Forward -192 -178 21.8284 0.0154
NP_440061.1_9 Forward -195 -181 20.8451 0.00314
NP_441054.1_2 Forward -375 -356 14.9458 0.155
NP_441476.1_5 Reverse -248 -267 -3.04881 0.231
NP_441476.1_5 Forward -198 -179 -3.63879 0.239
NP_441476.1_5 Forward -267 -248 -4.72043 0.255
NP_440878.1_9 Forward -203 -184 2.26107 0.177
NP_442062.1_8 Reverse -184 -194 19.4496 0.000558
NP_442062.1_8 Forward -193 -183 17.3846 0.00193
NP_442062.1_8 Reverse -247 -257 4.3066 0.221
NP_440304.1_4 Reverse -182 -192 9.91146 0.051
NP_440304.1_4 Forward -195 -185 1.84832 0.299
NP_442242.1_4 Forward -192 -185 14.3954 0.0124
NP_442242.1_4 Reverse -185 -192 14.3954 0.0124
NP_440044.1_8 Reverse -185 -204 -3.24547 0.281
NP_440044.1_8 Forward -192 -173 -3.3438 0.282
NP_439918.1_2 Forward -371 -352 5.99764 0.154
NP_441208.1_9 Forward -214 -200 9.04604 0.219
NP_441208.1_9 Reverse -181 -195 6.78443 0.229
NP_441594.1_6 Reverse -283 -302 1.96607 0.259
NP_440370.1_10 Reverse -175 -194 16.5191 0.0713
NP_442110.1_7 Forward -193 -179 7.07942 0.126
NP_442110.1_7 Reverse -241 -255 1.67122 0.222
NP_442367.1_1 Forward -366 -347 -7.67036 0.26
NP_441925.1_4 Forward -248 -229 -7.76943 0.2
NP_441925.1_4 Forward -245 -226 -16.7175 0.285
NP_441083.1_5 Forward -193 -183 20.3345 0.00053
NP_441083.1_5 Reverse -184 -194 11.3864 0.0159
NP_441083.1_5 Forward -353 -343 3.61828 0.166
NP_442827.1_8 Forward -201 -182 4.22689 0.138
NP_442827.1_8 Reverse -176 -195 3.63691 0.144
NP_441434.1_7 Reverse -186 -200 4.12949 0.225
NP_441434.1_7 Forward -254 -240 3.04785 0.264
NP_441738.1_2 Forward -191 -184 15.28 0.0102
NP_441738.1_2 Reverse -186 -193 15.28 0.0102
NP_441558.1_5 Reverse -182 -201 13.1758 0.0619
NP_441558.1_5 Forward -195 -176 7.7676 0.17
NP_441558.1_5 Reverse -200 -219 5.70265 0.242
NP_440209.1_1 Reverse -184 -192 18.1123 0.00295
NP_440209.1_1 Forward -193 -185 18.1123 0.00295
NP_442889.1_8 Forward -196 -182 3.93223 0.27
NP_440447.1_1 Reverse -209 -227 2.57575 0.278
NP_441713.1_1 Reverse -178 -197 -15.7335 0.27
NP_440178.1_7 Forward -194 -175 6.78429 0.013
NP_440178.1_7 Reverse -183 -202 -18.9784 0.172
NP_440178.1_7 Forward -212 -193 -20.5517 0.194
NP_442570.1_3 Reverse -245 -264 -5.01543 0.237
NP_442570.1_3 Reverse -268 -287 -5.70374 0.248
NP_442570.1_3 Forward -374 -355 -6.09707 0.255
NP_441716.1_1 Forward -193 -179 11.5043 0.0936
NP_441716.1_1 Reverse -184 -198 4.81781 0.248
NP_442111.1_4 Reverse -183 -197 7.9644 0.0826
NP_441163.1_1 Forward -201 -184 14.0011 0.179
NP_440343.1_9 Reverse -324 -343 18.879 0.139
NP_440906.1_5 Forward -192 -185 15.8704 0.0124
NP_440906.1_5 Reverse -185 -192 15.8704 0.0124
NP_440747.1_10 Reverse -181 -193 7.51213 0.00286
NP_440747.1_10 Forward -196 -184 5.44718 0.0137
NP_441130.1_10 Forward -195 -181 11.3077 0.107
NP_441130.1_10 Reverse -182 -196 8.84938 0.131
NP_441486.1_1 Reverse -181 -195 13.8643 0.00743
NP_441486.1_1 Forward -196 -182 13.4709 0.00839
NP_441014.1_5 Forward -254 -236 9.0656 0.287
NP_441014.1_10 Forward -38 -19 4.62021 0.196
NP_442848.1_1 Reverse -178 -192 16.0275 0.0143
NP_441012.1_4 Forward -254 -241 8.18076 0.272
NP_443018.1_3 Forward -192 -185 14.8871 0.0123
NP_443018.1_3 Reverse -185 -192 14.8871 0.0123
NP_443018.1_3 Forward -210 -203 9.38056 0.128
NP_443018.1_3 Reverse -392 -399 8.49558 0.141
NP_441634.1_8 Reverse -182 -196 5.99778 0.114
NP_441634.1_8 Forward -195 -181 -3.63866 0.295
NP_440376.1_1 Forward -193 -184 19.4693 0.000692
NP_440376.1_1 Reverse -184 -193 19.4693 0.000692
NP_440376.1_1 Reverse -202 -211 2.65466 0.216
NP_441588.1_4 Reverse -186 -196 7.25653 0.178
NP_442687.1_7 Forward -194 -184 15.8113 0.0125
NP_442687.1_7 Reverse -183 -193 8.92815 0.0994
NP_442485.1_3 Forward -267 -248 -1.67217 0.26
NP_441846.1_10 Reverse -229 -248 -22.0267 0.257
NP_440642.1_10 Forward -39 -25 5.1122 0.242
NP_441013.1_3 Reverse -16 -35 9.63589 0.227
NP_441422.1_7 Forward -195 -178 15.2801 0.0565
NP_441029.1_3 Forward -261 -242 1.27776 0.277
NP_442658.1_1 Forward -195 -185 15.9091 0.00966
NP_442658.1_1 Reverse -182 -192 9.616 0.147
NP_440141.1_8 Forward -265 -246 5.40766 0.275
NP_441855.2_4 Reverse -349 -368 16.368 0.0854
NP_441855.2_4 Forward -201 -182 10.8728 0.24
NP_442782.1_2 Forward -370 -356 3.63784 0.263
NP_442205.1_9 Reverse -178 -194 7.92501 0.105
NP_442205.1_9 Forward -199 -183 -3.8747 0.297
NP_441414.1_9 Reverse -184 -203 -9.83364 0.269
NP_440607.1_8 Forward -367 -348 5.211 0.209
NP_441487.1_9 Forward -194 -175 2.55606 0.18
NP_442937.1_5 Reverse -179 -198 15.3391 0.0581
NP_442937.1_5 Forward -198 -179 10.7175 0.154
NP_442937.1_5 Reverse -242 -261 7.86593 0.241
NP_441958.1_5 Forward -194 -184 12.2714 0.00183
NP_441958.1_5 Reverse -183 -193 12.2714 0.00183
NP_441958.1_5 Reverse -201 -211 -0.609952 0.215
NP_442836.1_5 Reverse -178 -197 6.39097 0.179
NP_439905.1_1 Forward -192 -179 10.1474 0.216
NP_439905.1_1 Forward -294 -281 7.78743 0.244
NP_440984.1_7 Reverse -179 -193 9.14437 0.131
NP_440984.1_7 Forward -198 -184 8.06273 0.158
NP_441097.1_2 Reverse -267 -284 8.49531 0.236
NP_442911.1_2 Reverse -174 -193 3.24438 0.045
NP_440153.1_5 Forward -192 -178 11.2093 0.0763
NP_440153.1_5 Reverse -185 -199 4.03116 0.199
NP_440153.1_8 Forward -268 -255 -2.83231 0.266
NP_441591.1_10 Reverse -182 -201 5.211 0.297
NP_443055.1_6 Reverse -176 -194 -0.374908 0.259
NP_441429.1_8 Reverse -247 -266 18.584 0.144
NP_440615.1_8 Forward -392 -373 14.0608 0.213
NP_441099.1_5 Reverse -174 -193 -9.34199 0.219
NP_442002.1_9 Forward -194 -187 10.7572 0.185
NP_441294.1_7 Forward -197 -183 20.1933 0.00262
NP_441646.1_1 Forward -200 -181 0.392778 0.251
NP_441646.1_1 Forward -251 -232 -1.18052 0.28
NP_442438.1_10 Reverse -179 -193 11.996 0.0412
NP_442438.1_10 Reverse -254 -268 4.62115 0.144
NP_441000.1_6 Reverse -183 -197 4.42448 0.0953
NP_441000.1_6 Forward -194 -180 2.85119 0.126
NP_441000.1_6 Reverse -236 -250 0.982901 0.183
NP_440147.1_4 Forward -195 -182 22.0454 0.00117
NP_440147.1_4 Reverse -182 -195 0.904263 0.244
NP_440147.1_4 Forward -213 -200 0.215946 0.261
NP_441175.1_7 Forward -193 -174 6.68596 0.253
NP_441550.1_8 Reverse -182 -192 16.7941 0.00906
NP_441550.1_8 Forward -195 -185 8.3377 0.124
NP_441916.1_7 Reverse -184 -194 18.4663 0.00144
NP_441916.1_7 Forward -193 -183 10.3048 0.0261
NP_441916.1_7 Forward -400 -390 1.16001 0.293
NP_440465.1_10 Reverse -181 -200 0.294447 0.29
NP_441041.1_4 Forward -211 -192 -11.0136 0.239
NP_441041.1_4 Reverse -247 -266 -12.1936 0.26
NP_441041.1_4 Reverse -184 -203 -12.9802 0.278
NP_441041.1_7 Forward -196 -184 9.65268 0.108
NP_442642.1_9 Reverse -4 -21 -0.0594896 0.296
NP_442004.1_6 Forward -193 -179 10.1277 0.14
NP_441725.1_5 Forward -192 -182 9.02648 0.0553
NP_441725.1_5 Reverse -185 -195 2.04498 0.115
NP_439966.1_7 Reverse -182 -192 14.8275 0.0177
NP_439966.1_7 Forward -195 -185 9.91099 0.0968
NP_439966.1_9 Forward -195 -186 0.884706 0.253
NP_439966.1_9 Reverse -182 -191 0.884706 0.253
NP_442941.1_3 Forward -192 -182 10.9931 0.0116
NP_442941.1_3 Reverse -185 -195 2.63497 0.14
NP_440289.1_2 Forward -196 -183 3.16588 0.0811
NP_440289.1_2 Reverse -181 -194 -4.50394 0.288
NP_441514.1_2 Forward -114 -95 14.6508 0.281
NP_442281.1_1 Forward -216 -202 12.487 0.0369
NP_442281.1_1 Reverse -179 -193 5.40719 0.159
NP_442281.1_1 Forward -198 -184 4.12889 0.206
NP_442281.1_1 Forward -261 -247 2.5556 0.263
NP_441079.1_7 Reverse -92 -111 -3.34455 0.233
NP_441079.1_7 Forward -110 -91 -5.80282 0.268
NP_440437.1_1 Forward -199 -180 -0.688862 0.185
NP_440647.1_9 Forward -213 -195 2.87075 0.283
NP_442012.1_1 Reverse -178 -197 6.68596 0.124
NP_440498.1_1 Forward -202 -184 -3.22577 0.259
NP_440375.1_6 Reverse -193 -212 8.75091 0.239
NP_441644.1_6 Forward -193 -183 17.3841 0.00127
NP_441644.1_6 Forward -211 -201 15.3192 0.00663
NP_441644.1_6 Reverse -184 -194 10.1076 0.0628
NP_441644.1_6 Forward -20 -10 3.32285 0.288
NP_442215.1_2 Forward -39 -23 -7.21796 0.289
NP_442029.1_1 Reverse -182 -201 -20.1584 0.297
NP_440253.1_2 Forward -193 -175 4.54237 0.102
NP_440929.1_8 Forward -193 -184 19.2726 0.000701
NP_440929.1_8 Reverse -184 -193 19.2726 0.000701
NP_442933.1_10 Forward -193 -184 17.601 0.00325
NP_442933.1_10 Reverse -184 -193 17.601 0.00325
NP_441751.2_8 Forward -192 -178 -4.52363 0.174
NP_442554.1_8 Forward -192 -182 18.0729 0.00543
NP_442554.1_8 Reverse -185 -195 13.2547 0.0187
NP_442554.1_8 Reverse -203 -213 9.7148 0.0562
NP_442554.1_8 Forward -210 -200 7.15819 0.0975
NP_440133.1_10 Reverse -245 -264 8.25926 0.181
NP_441762.1_7 Forward -194 -182 11.8387 0.0142
NP_441762.1_7 Reverse -183 -195 10.1671 0.0142
NP_441762.1_7 Forward -247 -235 -7.63084 0.296
NP_442142.1_4 Reverse -181 -194 6.90188 0.153
NP_442142.1_4 Forward -196 -183 4.73861 0.212
NP_442142.1_4 Forward -235 -222 3.95196 0.239
NP_442292.1_1 Forward -192 -183 18.486 0.00229
NP_442292.1_1 Reverse -185 -194 9.63616 0.0183
NP_442476.1_6 Forward -192 -178 11.0127 0.0601
NP_441523.1_6 Forward -357 -338 10.6192 0.161
NP_443009.1_5 Reverse -183 -194 18.3477 0.00265
NP_442301.1_2 Forward -272 -253 5.01354 0.269
NP_441715.1_4 Reverse -185 -195 9.41981 0.097
NP_441715.1_4 Forward -192 -182 7.84651 0.107
NP_441715.1_4 Reverse -238 -248 7.74818 0.108
NP_440620.1_4 Forward -111 -97 14.3354 0.272
NP_440379.1_5 Reverse -199 -218 -1.86883 0.194
NP_440379.1_5 Forward -265 -246 -10.6203 0.281
NP_441468.1_1 Forward -192 -185 15.8704 0.0124
NP_441468.1_1 Reverse -185 -192 15.8704 0.0124
NP_441020.2_6 Reverse -260 -277 8.29864 0.203
NP_441015.1_10 Reverse -179 -198 5.01433 0.119
NP_441673.1_1 Forward -193 -184 20.8459 0.000698
NP_441673.1_1 Reverse -184 -193 20.8459 0.000698
NP_441673.1_1 Reverse -237 -246 -8.06341 0.254
NP_441826.1_2 Reverse -178 -192 2.94952 0.117
NP_442868.1_6 Reverse -182 -192 17.4829 0.012
NP_442868.1_6 Forward -195 -185 0.865012 0.205
NP_442677.1_3 Forward -386 -367 -4.13045 0.287
NP_441612.1_2 Forward -193 -183 8.54929 0.21
NP_442808.1_1 Forward -194 -184 18.4657 0.00201
NP_442808.1_1 Reverse -183 -193 8.63269 0.0481
NP_442808.1_1 Reverse -355 -365 1.15957 0.292
NP_440145.1_3 Reverse -174 -193 10.5209 0.04
NP_442050.1_5 Reverse -182 -192 15.6142 0.01
NP_441114.1_1 Reverse -189 -207 13.6864 0.279
NP_441114.1_3 Forward -216 -207 7.66954 0.231
NP_440558.1_2 Reverse -199 -218 2.65439 0.166
NP_440558.1_2 Forward -40 -21 -5.21209 0.254
NP_440558.1_2 Reverse -283 -302 -7.57203 0.296
NP_441518.1_3 Reverse -174 -193 -5.31042 0.123
NP_441878.1_6 Forward -212 -202 10.4031 0.0176
NP_441878.1_6 Forward -194 -184 10.4031 0.0176
NP_441878.1_6 Reverse -183 -193 10.4031 0.0176
NP_441878.1_6 Reverse -390 -400 1.25834 0.108
NP_441878.1_6 Reverse -201 -211 0.766681 0.134
NP_441878.1_6 Reverse -240 -250 -7.88644 0.278
NP_441036.1_3 Reverse -314 -333 -4.32711 0.271
NP_441036.1_8 Forward -194 -184 17.7779 0.000554
NP_441036.1_8 Reverse -183 -193 8.33817 0.174
NP_441036.1_8 Reverse -236 -246 5.5849 0.271
NP_442650.1_2 Forward -193 -179 4.71948 0.163
NP_441557.1_5 Forward -193 -184 19.9609 0.000699
NP_441557.1_5 Reverse -184 -193 19.9609 0.000699
NP_441445.1_1 Forward -202 -183 9.24257 0.108
NP_441445.1_1 Reverse -175 -194 9.24257 0.108
NP_441590.1_4 Reverse -352 -371 2.35861 0.296
NP_442066.2_9 Reverse -258 -271 12.8023 0.154
NP_442419.1_2 Reverse -179 -198 4.12936 0.185
NP_442419.1_2 Forward -198 -179 -5.11376 0.295
NP_442183.1_1 Forward -193 -179 11.701 0.0693
NP_441549.1_9 Reverse -231 -249 -8.63398 0.234
NP_441549.1_9 Reverse -199 -217 -10.6989 0.285
NP_442347.1_2 Forward -192 -183 12.4878 0.056
NP_442347.1_2 Reverse -185 -194 11.1111 0.056
NP_442347.1_2 Forward -245 -236 7.07956 0.134
NP_442645.1_2 Reverse -176 -195 8.25926 0.0177
NP_441037.1_4 Forward -195 -185 14.7245 0.028
NP_441037.1_4 Reverse -182 -192 9.55921 0.21
NP_442594.1_8 Reverse -332 -351 3.6377 0.279
NP_440151.1_5 Forward -377 -358 4.62101 0.262
NP_441633.1_3 Forward -195 -182 13.1956 0.018
NP_441633.1_3 Forward -248 -235 1.49425 0.109
NP_441633.1_3 Reverse -182 -195 1.39592 0.109
NP_440136.1_2 Forward -192 -185 15.9687 0.0123
NP_440136.1_2 Reverse -185 -192 15.9687 0.0123
NP_442590.1_10 Forward -382 -363 7.57094 0.223
NP_442998.1_10 Forward -191 -184 15.5754 0.0102
NP_442998.1_10 Reverse -186 -193 15.5754 0.0102
NP_440299.1_1 Reverse -180 -193 9.85179 0.0646
NP_440299.1_1 Forward -197 -184 8.18017 0.0964
NP_440299.1_1 Forward -191 -178 3.26365 0.251
NP_441799.1_1 Reverse -180 -194 16.6169 0.0138
NP_441799.1_1 Forward -197 -183 16.0269 0.0153
NP_441007.1_10 Reverse -179 -192 11.229 0.0646
NP_441007.1_10 Reverse -254 -267 0.412608 0.23
NP_442334.1_2 Reverse -283 -300 -13.5308 0.297
NP_440256.1_1 Reverse -244 -263 1.86774 0.0702
NP_440256.1_1 Reverse -181 -200 -6.49039 0.213
NP_441559.1_8 Forward -251 -237 11.8976 0.0574
NP_441559.1_8 Forward -198 -184 2.45787 0.143
NP_440915.1_6 Reverse -198 -212 0.786239 0.153
NP_441179.1_1 Forward -196 -177 1.76941 0.267
NP_441704.1_8 Reverse -173 -192 10.2251 0.162
NP_441464.1_2 Forward -239 -229 14.238 0.277
NP_441464.1_8 Forward -193 -179 12.0943 0.177
NP_441464.1_8 Forward -268 -254 8.25939 0.2
NP_441464.1_8 Reverse -184 -198 7.47274 0.206
NP_441939.1_3 Forward -192 -173 12.4875 0.1
NP_442993.1_1 Reverse -184 -200 -8.20127 0.157
NP_442386.1_9 Forward -194 -185 15.7322 0.0144
NP_442386.1_9 Reverse -183 -192 13.8639 0.0289
NP_442386.1_9 Forward -257 -248 4.81753 0.282
NP_441750.1_1 Reverse -328 -347 -7.17871 0.259
NP_441340.1_5 Forward -192 -185 15.6737 0.0124
NP_441340.1_5 Reverse -185 -192 15.6737 0.0124
NP_441947.1_4 Forward -207 -188 13.2741 0.222
NP_441947.1_10 Forward -264 -246 8.37728 0.187
NP_442484.1_2 Forward -261 -242 -0.000545616 0.254
NP_442791.1_5 Forward -264 -245 -10.7186 0.281
NP_442240.1_2 Forward -192 -173 -15.5368 0.215
NP_440586.1_8 Forward -192 -185 13.2151 0.026
NP_440586.1_8 Reverse -185 -192 13.2151 0.026
NP_442251.1_6 Forward -192 -185 15.2804 0.0124
NP_442251.1_6 Reverse -185 -192 15.2804 0.0124
NP_441262.1_3 Reverse -184 -191 14.7888 0.0223
NP_441262.1_3 Forward -193 -186 14.7888 0.0223
NP_440027.1_3 Reverse -357 -375 5.03327 0.249
NP_440027.1_3 Forward -256 -238 2.77167 0.286
NP_440027.1_3 Forward -203 -185 2.47668 0.289
NP_443051.1_1 Reverse -183 -192 10.4228 0.00754
NP_443051.1_1 Forward -194 -185 10.4228 0.00754
NP_439937.1_9 Forward -194 -177 -15.9897 0.287
NP_439937.1_9 Reverse -183 -200 -16.1864 0.287
NP_440439.1_1 Reverse -181 -194 10.8357 0.0339
NP_440439.1_1 Forward -196 -183 3.65753 0.11
NP_440439.1_1 Reverse -234 -247 0.117615 0.202
NP_439943.1_1 Forward -217 -198 -10.3253 0.29
NP_440372.1_2 Forward -192 -185 16.3621 0.0124
NP_440372.1_2 Reverse -185 -192 16.3621 0.0124
NP_441789.1_7 Forward -255 -236 -4.72118 0.288
NP_440316.1_10 Reverse -201 -211 6.56821 0.257
NP_441803.1_2 Reverse -179 -198 1.96607 0.222
NP_441155.1_2 Reverse -173 -192 13.7658 0.28
NP_442384.1_10 Reverse -184 -197 8.37742 0.0656
NP_442384.1_10 Forward -193 -180 3.95252 0.172
NP_442384.1_10 Forward -353 -340 1.78924 0.247
NP_441018.1_7 Reverse -243 -262 11.7992 0.177
NP_442262.1_10 Forward -192 -185 14.1988 0.0123
NP_442262.1_10 Reverse -185 -192 14.1988 0.0123
NP_442262.1_10 Forward -210 -203 9.47889 0.187
NP_442262.1_10 Reverse -392 -399 8.59391 0.22
NP_441689.1_5 Reverse -182 -192 5.87944 0.197
NP_440344.1_10 Forward -200 -183 -0.452814 0.0426
NP_440344.1_10 Forward -263 -246 -11.6625 0.223
NP_440344.1_10 Forward -218 -201 -12.5475 0.257
NP_440282.1_10 Reverse -193 -212 -9.63698 0.286
NP_441965.1_3 Reverse -174 -193 -1.57384 0.286
NP_441965.1_10 Reverse -181 -197 8.41667 0.125
NP_442693.1_7 Reverse -258 -277 8.75091 0.266
NP_440297.1_9 Reverse -203 -213 -0.118297 0.282
NP_440297.1_9 Reverse -185 -195 -0.118297 0.282
NP_440297.1_9 Forward -192 -182 -0.216628 0.282
NP_441896.1_3 Reverse -175 -194 1.86774 0.209
NP_440894.1_4 Reverse -112 -131 5.01433 0.219
NP_440999.1_9 Forward -197 -183 2.5562 0.148
NP_440888.1_2 Forward -193 -179 17.1085 0.00462
NP_440888.1_2 Reverse -184 -198 7.47213 0.194
NP_442892.1_5 Reverse -96 -114 20.0732 0.114
NP_440179.1_6 Forward -192 -173 2.65439 0.298
NP_442033.1_10 Forward -195 -176 -14.2585 0.298
NP_440575.1_8 Forward -46 -27 1.67108 0.173
NP_441543.1_2 Reverse -185 -194 18.486 0.00236
NP_441543.1_2 Forward -192 -183 16.9127 0.00359
NP_442845.1_2 Reverse -178 -192 6.88276 0.201
NP_441469.1_8 Forward -194 -185 16.126 0.00797
NP_441469.1_8 Reverse -183 -192 6.48957 0.227
NP_441548.1_5 Reverse -243 -261 18.5054 0.226
NP_443064.1_6 Forward -193 -183 12.5669 0.0796
NP_443064.1_6 Reverse -344 -354 11.2095 0.13
NP_442578.1_7 Forward -192 -185 14.5921 0.026
NP_442578.1_7 Reverse -185 -192 14.5921 0.026
NP_442578.1_7 Reverse -374 -381 6.72562 0.18
NP_441462.1_2 Forward -193 -183 11.5831 0.00406
NP_441462.1_2 Reverse -184 -194 11.5831 0.00406
NP_441462.1_2 Reverse -202 -212 -1.19994 0.291
NP_441621.1_7 Forward -195 -181 -3.34366 0.188
NP_441621.1_7 Reverse -182 -196 -3.34366 0.188
NP_443062.1_1 Forward -211 -193 6.01073 0.211
NP_443062.1_6 Forward -201 -182 2.0644 0.262
NP_441601.1_2 Forward -199 -180 -4.32711 0.286
NP_441351.1_1 Reverse -328 -347 8.75091 0.259
NP_442487.1_2 Forward -201 -182 6.39016 0.232
NP_440516.1_2 Forward -199 -181 6.41066 0.122
NP_440516.1_8 Forward -193 -184 16.9127 0.00442
NP_440516.1_8 Reverse -184 -193 16.9127 0.00442
NP_442428.1_5 Forward -192 -185 15.8704 0.0124
NP_442428.1_5 Reverse -185 -192 15.8704 0.0124
NP_440783.1_5 Forward -381 -362 -1.7705 0.251
NP_441443.1_1 Reverse -284 -303 -2.55715 0.271
NP_441443.1_2 Forward -302 -283 -6.88371 0.292
NP_442120.1_10 Forward -268 -249 -4.22878 0.199
NP_440673.1_3 Forward -191 -184 12.4288 0.0426
NP_440673.1_3 Reverse -186 -193 12.4288 0.0426
NP_441052.1_2 Forward -193 -183 19.9412 0.00106
NP_441052.1_2 Reverse -184 -194 10.5014 0.0285
NP_442219.1_9 Forward -192 -183 17.7976 0.00718
NP_442219.1_9 Reverse -185 -194 8.35786 0.0681
NP_440436.1_4 Reverse -185 -194 18.1905 0.00233
NP_440436.1_4 Forward -192 -183 17.2072 0.00233
NP_441884.1_8 Reverse -183 -202 -8.94866 0.265
NP_441884.1_9 Forward -196 -177 -22.2233 0.277
NP_442086.1_3 Forward -192 -173 10.1275 0.217
NP_441719.1_4 Forward -192 -185 16.3621 0.0124
NP_441719.1_4 Reverse -185 -192 16.3621 0.0124
NP_441733.1_10 Reverse -181 -194 10.639 0.106
NP_441004.1_1 Reverse -328 -347 -15.6352 0.276
NP_441577.1_10 Reverse -180 -199 9.83255 0.198
NP_442366.1_5 Forward -196 -186 15.2208 0.0375
NP_442366.1_5 Reverse -341 -351 10.4026 0.271
NP_440328.1_4 Forward -199 -180 3.53937 0.176
NP_443054.1_2 Forward -258 -244 2.75286 0.241
NP_443054.1_2 Reverse -182 -196 1.76955 0.245
NP_441851.1_10 Forward -194 -184 16.008 0.00552
NP_441851.1_10 Reverse -183 -193 15.8113 0.00552
NP_442208.1_5 Reverse -257 -276 -7.17871 0.27
NP_442026.1_1 Reverse -240 -259 7.07928 0.129
NP_442622.1_8 Reverse -184 -202 -18.6637 0.243
NP_441668.1_4 Reverse -18 -37 -2.0655 0.286
NP_442515.1_1 Forward -194 -180 10.3243 0.0533
NP_442515.1_1 Reverse -183 -197 3.14618 0.124
NP_440593.1_3 Reverse -179 -198 -4.81876 0.253
NP_441349.1_10 Forward -203 -184 -3.14714 0.134
NP_441349.1_10 Reverse -174 -193 -8.35868 0.274
NP_440432.1_9 Forward -192 -177 -1.88839 0.167
NP_440432.1_9 Forward -210 -195 -4.64166 0.216
NP_442843.1_1 Reverse -185 -204 -7.17871 0.245
NP_442843.1_1 Forward -375 -356 -7.76869 0.252
NP_442843.1_1 Reverse -328 -347 -11.0136 0.285
NP_442843.1_1 Reverse -248 -267 -11.8986 0.295
NP_442450.1_5 Forward -195 -185 7.55152 0.13
NP_440588.1_2 Forward -362 -343 -5.80207 0.262
NP_441570.1_1 Reverse -184 -202 -5.48739 0.0756
NP_441570.1_1 Forward -193 -175 -8.63398 0.117
NP_441078.1_4 Forward -193 -184 19.6659 0.0007
NP_441078.1_4 Reverse -184 -193 19.6659 0.0007
NP_441078.1_4 Reverse -202 -211 -1.6719 0.266
NP_441078.1_4 Forward -400 -391 -1.6719 0.266
NP_441078.1_4 Forward -211 -202 -1.77023 0.266
NP_442348.1_2 Reverse -315 -324 14.356 0.159
NP_440707.1_6 Forward -254 -235 11.0117 0.274
NP_442443.1_1 Reverse -341 -360 -5.21209 0.282
NP_440526.1_3 Forward -192 -181 10.6779 0.0646
NP_441432.1_8 Reverse -183 -192 16.8143 0.00595
NP_441432.1_8 Forward -194 -185 8.25953 0.0755
NP_441432.1_8 Reverse -201 -210 3.44131 0.245
NP_442320.1_8 Reverse -178 -192 6.78443 0.0237
NP_441732.1_2 Forward -197 -181 11.7599 0.00594
NP_441732.1_2 Reverse -180 -196 -15.8711 0.163
NP_441732.1_2 Forward -272 -256 -17.346 0.253
NP_441030.1_6 Forward -213 -194 12.7552 0.23
NP_440629.1_6 Reverse -178 -197 13.1886 0.265
NP_442003.1_4 Reverse -185 -204 10.8159 0.288
NP_440760.1_1 Forward -193 -174 -4.03212 0.0386
NP_440760.1_1 Reverse -184 -203 -14.3569 0.129
NP_442797.1_1 Forward -335 -316 -6.68705 0.296
NP_442353.1_4 Forward -199 -180 -0.197979 0.287
NP_442751.1_2 Forward -326 -307 7.4718 0.206
NP_440713.1_4 Forward -376 -357 8.84924 0.159
NP_442489.1_2 Forward -204 -185 6.4893 0.175
NP_442489.1_7 Forward -193 -184 20.1576 0.000695
NP_442489.1_7 Reverse -184 -193 20.1576 0.000695
NP_442489.1_7 Forward -400 -391 5.3096 0.0708
NP_442489.1_7 Forward -211 -202 -1.57357 0.213
NP_442489.1_7 Reverse -202 -211 -1.6719 0.235
NP_442489.1_7 Reverse -391 -400 -1.96689 0.28
NP_441706.1_10 Reverse -181 -200 6.88262 0.3
NP_440559.1_1 Forward -192 -183 17.4043 0.00658
NP_440559.1_1 Reverse -185 -194 8.75118 0.0586
NP_441659.2_8 Forward -193 -183 18.1713 0.00133
NP_441659.2_8 Reverse -184 -194 11.9764 0.0147
NP_441659.2_8 Forward -211 -201 5.97822 0.0909
NP_441659.2_8 Forward -20 -10 2.83163 0.187
NP_441659.2_8 Forward -268 -258 0.373358 0.268
NP_440786.1_9 Forward -112 -93 16.0274 0.18
NP_442749.1_5 Reverse -307 -324 12.9476 0.159
NP_442913.1_10 Forward -202 -183 0.0977854 0.156
NP_442008.1_2 Reverse -341 -360 3.93269 0.245
NP_442346.1_5 Reverse -183 -193 16.6963 0.00248
NP_442346.1_5 Forward -194 -184 9.02648 0.118
NP_442346.1_5 Forward -212 -202 6.17489 0.212
NP_442346.1_5 Reverse -201 -211 5.19158 0.256
NP_440545.1_3 Reverse -180 -197 5.9387 0.0587
NP_440545.1_3 Forward -197 -180 -1.43612 0.168
NP_440025.1_1 Forward -197 -178 8.55425 0.221
NP_441786.1_10 Forward -202 -183 6.39097 0.284
NP_441923.1_6 Reverse -224 -238 9.2427 0.278
NP_440459.1_2 Forward -202 -185 9.57695 0.224
NP_440459.1_2 Forward -265 -248 8.00365 0.272
NP_441653.1_2 Reverse -173 -192 7.7815 0.21
NP_440010.1_4 Forward -197 -178 -0.00131823 0.25
NP_440010.1_4 Reverse -174 -193 -0.29631 0.25
NP_442551.1_4 Reverse -200 -215 -3.36336 0.287
NP_440449.1_6 Forward -219 -201 14.7725 0.0924
NP_440449.1_6 Forward -361 -343 6.11605 0.259
NP_441948.1_4 Forward -200 -182 18.112 0.014
NP_441948.1_4 Forward -253 -235 1.88744 0.129
NP_441833.1_4 Forward -192 -185 15.9687 0.0124
NP_441833.1_4 Reverse -185 -192 15.9687 0.0124
NP_442162.1_9 Forward -192 -185 16.2637 0.0124
NP_442162.1_9 Reverse -185 -192 16.2637 0.0124
NP_442199.1_5 Reverse -176 -195 -0.983855 0.179
NP_442199.1_5 Forward -219 -200 -2.16383 0.185
NP_442140.1_3 Reverse -185 -195 16.2046 0.0255
NP_442140.1_3 Forward -192 -182 13.5497 0.0542
NP_440875.1_9 Forward -254 -244 12.4602 0.117
NP_440875.1_9 Forward -221 -211 6.91198 0.294
NP_441813.1_5 Forward -195 -185 9.91146 0.021
NP_441813.1_5 Reverse -182 -192 8.73149 0.0367
NP_440590.1_4 Reverse -185 -198 12.3107 0.0148
NP_440590.1_4 Forward -192 -179 11.524 0.0197
NP_440567.1_1 Forward -192 -178 4.71948 0.114
NP_442497.1_10 Forward -192 -183 10.4228 0.0087
NP_442497.1_10 Reverse -185 -194 10.4228 0.0087
NP_440821.1_4 Reverse -182 -192 17.9746 0.00497
NP_440821.1_4 Forward -195 -185 10.2065 0.0163
NP_441239.1_9 Forward -195 -183 12.3303 0.0477
NP_441239.1_9 Forward -258 -246 12.232 0.0494
NP_441239.1_9 Forward -220 -208 10.6587 0.0742
NP_441239.1_9 Reverse -182 -194 9.67541 0.0987
NP_441239.1_9 Forward -213 -201 9.57708 0.102
NP_441239.1_9 Reverse -200 -212 8.79043 0.122
NP_441727.1_3 Forward -218 -199 13.4708 0.117
NP_441892.1_1 Forward -220 -203 2.49712 0.14
NP_441892.1_1 Forward -202 -185 1.51381 0.152
NP_442193.1_1 Reverse -247 -265 7.68896 0.282
NP_442270.1_9 Forward -204 -185 -7.86702 0.214
NP_441017.1_6 Forward -260 -246 12.192 0.224
NP_440833.1_6 Forward -326 -312 11.602 0.218
NP_440354.1_7 Reverse -178 -196 9.36059 0.227
NP_440354.1_7 Reverse -196 -214 6.80398 0.278
NP_442138.1_9 Reverse -355 -374 7.07848 0.299
NP_442052.1_8 Reverse -239 -249 12.6647 0.258
NP_440546.1_4 Reverse -184 -194 11.8882 0.0679
NP_440546.1_4 Reverse -202 -212 11.5973 0.0774
NP_440546.1_4 Forward -193 -183 10.046 0.109
NP_440546.1_4 Forward -211 -201 8.6886 0.176
NP_442041.1_5 Reverse -191 -210 -1.57384 0.286
NP_441230.1_5 Reverse -242 -261 3.24438 0.204
NP_441656.1_6 Forward -383 -364 11.7992 0.193
NP_440462.1_6 Reverse -182 -192 10.3048 0.0396
NP_440462.1_6 Forward -195 -185 9.02648 0.0498
NP_442611.1_3 Reverse -249 -267 16.7354 0.159
NP_440705.1_4 Reverse -373 -392 8.55425 0.296
NP_440868.1_4 Forward -197 -185 18.0335 0.0124
NP_440868.1_4 Reverse -180 -192 16.7552 0.0136
NP_441582.1_5 Reverse -182 -201 16.3215 0.101
NP_441868.1_4 Reverse -26 -40 13.7659 0.282
NP_441848.1_5 Reverse -58 -77 12.9988 0.269
NP_440696.1_3 Reverse -237 -255 11.2289 0.136
NP_440696.1_3 Forward -375 -357 2.0841 0.217
NP_440696.1_3 Reverse -184 -202 0.510803 0.229
NP_442039.1_4 Forward -192 -185 15.1821 0.0124
NP_442039.1_4 Reverse -185 -192 15.1821 0.0124
NP_441811.1_8 Reverse -178 -192 9.73436 0.225
NP_440825.1_7 Reverse -185 -195 12.4217 0.155
NP_442837.1_3 Forward -192 -185 15.7721 0.0124
NP_442837.1_3 Reverse -185 -192 15.7721 0.0124
NP_442837.1_3 Forward -245 -238 7.11894 0.173
NP_440160.1_2 Reverse -355 -374 -9.34199 0.293
NP_442053.1_1 Forward -193 -184 18.3876 0.0007
NP_442053.1_1 Reverse -184 -193 18.3876 0.0007
NP_442053.1_1 Reverse -237 -246 4.32629 0.254
NP_440505.1_3 Reverse -182 -192 16.598 0.00683
NP_440505.1_3 Forward -195 -185 6.76487 0.169
NP_440505.1_7 Forward -230 -211 3.04771 0.222
NP_442532.1_7 Forward -193 -179 5.60446 0.171
NP_440914.1_1 Forward -193 -183 17.5935 0.000537
NP_440914.1_1 Reverse -357 -367 8.71269 0.186
NP_440914.1_1 Reverse -184 -194 8.6151 0.186
NP_441011.1_8 Reverse -185 -194 16.9127 0.00602
NP_441011.1_8 Forward -192 -183 8.25953 0.144
NP_442533.1_6 Forward -193 -184 17.2076 0.00137
NP_442533.1_6 Reverse -184 -193 17.2076 0.00137
NP_442533.1_6 Forward -211 -202 13.5694 0.021
NP_442533.1_6 Reverse -202 -211 6.78456 0.103
NP_442533.1_6 Reverse -237 -246 2.26134 0.266
NP_442541.1_10 Forward -193 -179 2.65393 0.254
NP_442232.1_3 Reverse -176 -195 -12.8819 0.282
NP_442322.1_4 Reverse -354 -371 -2.81344 0.236
NP_442229.1_1 Reverse -182 -196 9.43874 0.184
NP_441482.1_7 Reverse -178 -192 -8.5552 0.193
NP_439944.1_9 Forward -192 -182 19.1546 0.00329
NP_441697.1_5 Reverse -92 -111 -3.48588 0.217
NP_441697.1_5 Forward -110 -91 -5.20473 0.225
NP_441697.1_5 Reverse -36 -55 -8.35597 0.258
NP_441028.1_6 Forward -381 -371 5.78111 0.243
NP_442202.1_4 Reverse -182 -196 17.4893 0.116
NP_440115.1_6 Reverse -181 -191 17.9746 0.0163
NP_440007.1_9 Reverse -205 -219 3.44117 0.269
NP_441602.1_3 Reverse -242 -261 2.3594 0.199
NP_442890.1_2 Reverse -245 -264 7.66927 0.271
NP_441972.1_5 Reverse -242 -261 0.294447 0.154
NP_441972.1_5 Reverse -185 -204 -6.29373 0.229
NP_441106.1_1 Forward -194 -185 18.191 0.0028
NP_441106.1_1 Reverse -183 -192 9.63616 0.0311
NP_441420.1_4 Reverse -254 -273 14.8474 0.282
NP_442306.1_10 Forward -198 -179 -9.047 0.11
NP_442306.1_10 Forward -251 -232 -20.945 0.237
NP_441286.1_1 Forward -194 -182 12.1337 0.0104
NP_441286.1_1 Reverse -183 -195 6.03717 0.0258
NP_442674.1_3 Reverse -20 -39 3.24359 0.294
NP_440670.1_8 Forward -193 -184 18.3876 0.000699
NP_440670.1_8 Reverse -184 -193 18.3876 0.000699
NP_441705.1_3 Reverse -309 -328 -5.21209 0.291
NP_440886.1_7 Forward -194 -184 17.7774 0.0011
NP_440886.1_7 Reverse -183 -193 7.94438 0.0805
NP_442614.1_2 Forward -268 -254 8.25939 0.255
NP_442072.1_9 Forward -194 -176 -12.5672 0.0852
NP_440028.1_6 Reverse -335 -353 11.4255 0.261
NP_440907.2_8 Reverse -185 -195 14.2375 0.0312
NP_440907.2_8 Forward -192 -182 10.8943 0.0969
NP_441021.1_1 Forward -192 -173 -9.73531 0.219
NP_441021.1_8 Forward -198 -180 4.73903 0.22
NP_441021.1_8 Reverse -179 -197 4.6407 0.222
NP_441463.1_3 Reverse -249 -268 -4.72043 0.211
NP_441463.1_3 Reverse -174 -193 -9.24366 0.278
NP_441626.1_2 Forward -192 -185 15.7721 0.0124
NP_441626.1_2 Reverse -185 -192 15.7721 0.0124
NP_442211.1_3 Forward -267 -248 8.15285 0.275
NP_442615.1_1 Reverse -175 -193 3.65739 0.0528
NP_442615.1_1 Forward -202 -184 -3.42244 0.161
NP_441962.1_4 Reverse -179 -198 -12.9802 0.268
NP_440387.1_1 Forward -193 -177 12.5466 0.0118
NP_440387.1_1 Reverse -184 -200 -3.28472 0.157
NP_441431.1_2 Forward -196 -182 13.077 0.0984
NP_441431.1_2 Reverse -181 -195 11.307 0.141
NP_441431.1_3 Reverse -316 -335 9.93088 0.236
NP_441993.1_1 Forward -193 -174 2.23906 0.261
NP_441993.1_1 Forward -256 -237 0.777198 0.292
NP_441174.1_1 Reverse -277 -292 14.0412 0.231
NP_441174.1_2 Reverse -181 -195 15.1426 0.126
NP_441174.1_2 Forward -249 -235 12.7826 0.239
NP_442805.1_5 Forward -335 -316 2.45694 0.246
NP_440467.1_3 Forward -222 -203 10.7679 0.296
NP_440114.1_10 Reverse -184 -198 11.701 0.106
NP_440114.1_10 Forward -193 -179 9.73436 0.164
NP_440114.1_10 Reverse -202 -216 5.89945 0.292
NP_442437.1_8 Reverse -248 -267 2.85105 0.296
NP_441720.1_2 Reverse -180 -199 7.96345 0.213
NP_440766.1_4 Reverse -180 -194 7.66941 0.0884
NP_439988.1_3 Reverse -198 -212 10.4227 0.225
NP_441237.1_9 Forward -192 -182 14.9263 0.0242
NP_441979.1_5 Reverse -357 -376 -16.9135 0.233
NP_442743.1_4 Reverse -185 -204 -6.78538 0.279
NP_442635.1_9 Reverse -43 -62 12.7681 0.262
NP_439910.1_2 Forward -201 -184 -13.4325 0.162
NP_439910.1_2 Reverse -176 -193 -13.5308 0.162
NP_440457.1_1 Reverse -180 -192 0.23564 0.25
NP_440798.1_2 Reverse -81 -95 15.8302 0.235
NP_440798.1_6 Reverse -185 -198 14.0806 0.0436
NP_440798.1_6 Forward -192 -179 3.26421 0.151
NP_441984.1_3 Reverse -198 -216 18.5054 0.0928
NP_441984.1_3 Forward -136 -118 8.37728 0.232
NP_441984.1_3 Reverse -237 -255 7.88563 0.239
NP_442509.1_9 Reverse -184 -194 16.2041 0.00739
NP_442509.1_9 Forward -353 -343 11.091 0.147
NP_442509.1_9 Forward -193 -183 8.14104 0.192
NP_440524.1_2 Reverse -249 -268 -4.6221 0.277
NP_442514.1_5 Forward -219 -200 -1.47628 0.201
NP_440554.1_4 Reverse -185 -195 7.35486 0.103
NP_440554.1_4 Forward -192 -182 6.37155 0.123
NP_441885.1_5 Forward -193 -183 20.9245 0.000538
NP_441885.1_5 Reverse -184 -194 11.4848 0.00668
NP_440478.1_10 Forward -195 -181 10.521 0.193
NP_442341.1_7 Forward -194 -180 10.226 0.0678
NP_442341.1_7 Reverse -183 -197 9.63603 0.0726
NP_442341.1_7 Reverse -343 -357 1.96621 0.274
NP_442341.1_9 Forward -195 -181 6.0955 0.243
NP_443000.1_7 Reverse -182 -192 10.4031 0.0345
NP_443000.1_7 Forward -195 -185 1.94665 0.226
NP_440507.2_3 Reverse -175 -194 9.43841 0.221
NP_442513.1_5 Reverse -176 -195 12.585 0.265
NP_440275.1_3 Reverse -182 -192 17.6796 0.0102
NP_440275.1_3 Forward -195 -185 8.33817 0.0602
NP_440091.1_1 Reverse -180 -192 15.8703 0.0161
NP_440091.1_1 Forward -197 -185 8.29878 0.0653
NP_441397.1_8 Forward -82 -69 12.7622 0.256
NP_441359.1_5 Reverse -341 -360 2.75272 0.264
NP_442451.1_2 Forward -201 -182 -6.1954 0.232
NP_441389.1_5 Forward -206 -187 9.93088 0.286
NP_439962.1_4 Forward -264 -245 -0.983855 0.206
NP_439962.1_6 Reverse -250 -268 7.78729 0.275
NP_442495.1_4 Reverse -201 -211 13.1564 0.198
NP_442495.1_5 Forward -222 -203 7.7676 0.291
NP_440149.1_8 Reverse -184 -203 6.58763 0.0656
NP_440149.1_8 Forward -193 -174 -1.96717 0.162
NP_440149.1_8 Forward -366 -347 -5.01543 0.218
NP_441105.1_3 Forward -222 -203 -5.99873 0.227
NP_441105.1_3 Forward -217 -198 -5.99873 0.227
NP_440216.1_1 Reverse -184 -198 6.78443 0.0124
NP_440216.1_1 Forward -193 -179 -1.5737 0.034
NP_440216.1_1 Reverse -237 -251 -11.1118 0.163
NP_440216.1_9 Reverse -29 -38 11.3078 0.269
NP_440172.1_1 Forward -193 -183 15.0247 0.00945
NP_440172.1_1 Reverse -184 -194 8.73149 0.0586
NP_440172.1_1 Forward -211 -201 2.24165 0.279
NP_440249.1_2 Forward -103 -93 15.0242 0.268
NP_442015.1_10 Forward -197 -184 10.8357 0.0391
NP_442015.1_10 Reverse -180 -193 2.87088 0.187
NP_441226.1_7 Forward -192 -185 14.4934 0.0123
NP_441226.1_7 Reverse -185 -192 14.4934 0.0123
NP_441111.1_7 Forward -192 -184 18.7023 0.00294
NP_441111.1_7 Reverse -185 -193 18.7023 0.00294
NP_442379.1_10 Reverse -177 -194 -0.649475 0.223
NP_441177.1_7 Reverse -346 -365 12.0933 0.199
NP_441766.1_2 Forward -193 -184 17.5026 0.00297
NP_441766.1_2 Reverse -184 -193 17.5026 0.00297
NP_443052.1_8 Reverse -174 -193 -6.58872 0.143
NP_441135.1_4 Forward -200 -181 1.27776 0.289
NP_442154.1_1 Reverse -248 -266 -17.1888 0.249
NP_442154.1_1 Forward -368 -350 -19.0571 0.289
NP_440261.1_5 Forward -192 -179 -2.73398 0.0924
NP_440261.1_5 Reverse -185 -198 -4.50394 0.151
NP_440261.1_5 Forward -399 -386 -4.79893 0.17
NP_440988.1_10 Reverse -182 -196 8.4809 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTCAATGGCCCAGAATAGATTTACCGCCGTGGGTCGGGTTTGGCGTAGCTGATCCGCCACAAATTCCAACTGCACCACAAATTCCCTTAATTCCGTAGTTTGAATCCTCCTGGCCCCCAAATACATACCGTAGGCCGCCGCAACTCCAATGGCCGGTGCTCCCCGCACTACCATGGATTTAATCGCATGGCCCATGGCCTCATAGTCGGCGATCGCCACCTCTTTATATTCCAAAGGTAAACGGGTCTGGTCAATCAGAATTACTTGATCATCTCGCCACTGTACTGGATAAACATCATCAAAATTTGTAGATTGGGTCATGTTAAAAGTAACTTCTTAGCAGAGTGATAAATAGAAAATTGTTTCCCTTGCCAATATTAGCCCCTCGTCTTACTTAACC

CDS

ATGGAAATCTTTAATAATTGGCAAATTATTGCGAAGGGTTGGTATATCGTTTGTCCTAGCCGGACATTACGGCGGGGTCAAGCTAAATCCCTGGCCCTTTGTGGGCAAAAAATTGTCGTGTTTCGGGGAGAAGATGGAAAGGCTCGGGCCCTCCACGGCTACTGTCCCCACCTTGGCACAGACCTAGGTTTAGGGCAAGTTGAAGACAGCTGGATTCGTTGTAACTTTCATCGTTGGGCCTTTGATGAAACGGGTAAATGTCGCCATATTCCCTGTCAGTCGGAAATTCCCCCCAAAGCACAATTAGCGCCCTATGCCACCGCCGAAAAATATGGCTTTATTTGGATTTTTCCAGAGGAAATTGCCCCCAATGATTTACCAGAATTTGATGAACTCCAGGGTCAGAAACTGGTCACCCAAGCGGATAAAGCCTTTGAAAGAAAATGTCACCATCATATTTGCATGATGAACGGCATTGATGCCCAACATTTGAAGACAGTTCATCATCTTGACATCAAAATGGACTTATCCCTCCGACAAAACGCATCAGGAACCCAGATTGATTTCACCATGAAAGGCAATGTTCCAAACACCACCTTAAGAGAGAGCTTCATACATTATAGTAGTTTCAAATAA

Protein

MEIFNNWQIIAKGWYIVCPSRTLRRGQAKSLALCGQKIVVFRGEDGKARALHGYCPHLGTDLGLGQVEDSWIRCNFHRWAFDETGKCRHIPCQSEIPPKAQLAPYATAEKYGFIWIFPEEIAPNDLPEFDELQGQKLVTQADKAFERKCHHHICMMNGIDAQHLKTVHHLDIKMDLSLRQNASGTQIDFTMKGNVPNTTLRESFIHYSSFK