Your browser is old and dusty. Try Google Chrome!

Details for sll1848

ORF sll1848
Accession NP_441924.1
Symbol
Category Other
Definition putative acyltransferas
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -72 -58 8.25939 0.0917
NP_441061.1_2 Reverse -291 -305 -1.37704 0.258
NP_441418.1_6 Reverse -356 -375 -29.1065 0.216
NP_440897.1_6 Reverse -107 -126 0.0970122 0.18
NP_441453.1_4 Reverse -356 -364 6.80426 0.121
NP_441960.1_3 Reverse -356 -375 16.2791 0.162
NP_442151.1_6 Forward -73 -59 10.6193 0.119
NP_440226.1_1 Forward -365 -346 4.71934 0.181
NP_441630.1_3 Reverse -348 -367 7.17762 0.122
NP_441976.1_6 Reverse -95 -114 19.0757 0.281
NP_442173.1_1 Forward -364 -356 5.72262 0.203
NP_442752.1_4 Reverse -356 -363 13.8055 0.0199
NP_441812.1_3 Reverse -355 -369 11.8976 0.21
NP_442975.1_10 Forward -369 -355 3.44058 0.259
NP_440784.1_7 Reverse -357 -364 6.23397 0.241
NP_440784.1_7 Forward -364 -357 6.13563 0.241
NP_442000.2_3 Forward -81 -62 9.43923 0.294
NP_440061.1_6 Forward -187 -169 11.0314 0.283
NP_441476.1_5 Reverse -59 -78 -2.85214 0.231
NP_442062.1_8 Reverse -356 -366 8.73149 0.0721
NP_440761.1_4 Forward -84 -65 -20.5517 0.289
NP_441859.1_3 Reverse -355 -374 6.68515 0.171
NP_440304.1_4 Forward -307 -297 12.5664 0.051
NP_442242.1_4 Forward -364 -357 10.8555 0.127
NP_441208.1_1 Reverse -211 -230 -3.54046 0.259
NP_441594.1_6 Reverse -165 -184 4.03102 0.223
NP_440518.1_6 Reverse -151 -170 14.3549 0.217
NP_442110.1_7 Forward -79 -65 2.06454 0.222
NP_441082.1_10 Reverse -205 -218 10.7374 0.236
NP_441925.1_2 Reverse -226 -245 22.9106 0.0179
NP_440330.1_2 Forward -73 -54 10.7175 0.297
NP_441083.1_5 Forward -365 -355 0.766681 0.218
NP_441434.1_6 Reverse -222 -232 13.8447 0.295
NP_441571.1_8 Reverse -335 -354 13.1758 0.0985
NP_441738.1_2 Forward -363 -356 15.28 0.0102
NP_441738.1_2 Reverse -54 -61 8.29857 0.176
NP_440209.1_1 Forward -365 -357 11.9175 0.0184
NP_440209.1_1 Reverse -356 -364 8.57422 0.0425
NP_439953.1_2 Forward -123 -105 14.5721 0.183
NP_441327.1_5 Forward -236 -227 16.2243 0.164
NP_442111.1_1 Forward -58 -39 11.3067 0.291
NP_440343.1_3 Forward -115 -97 5.22993 0.257
NP_440343.1_3 Forward -226 -208 3.8533 0.266
NP_440906.1_5 Reverse -357 -364 6.23397 0.234
NP_440906.1_5 Forward -364 -357 6.13563 0.241
NP_441486.1_1 Reverse -353 -367 -5.50694 0.242
NP_441486.1_1 Forward -368 -354 -5.90027 0.266
NP_442634.1_4 Reverse -160 -174 -5.60527 0.264
NP_440057.1_8 Reverse -165 -184 13.1758 0.266
NP_441014.1_10 Forward -178 -159 3.04693 0.215
NP_443018.1_3 Reverse -357 -364 12.6255 0.0471
NP_443018.1_3 Forward -100 -93 7.11894 0.16
NP_443018.1_3 Forward -364 -357 5.25066 0.214
NP_441634.1_8 Reverse -354 -368 2.5562 0.167
NP_441634.1_9 Forward -161 -142 13.47 0.189
NP_440376.1_1 Reverse -356 -365 0.0980582 0.285
NP_440376.1_1 Forward -365 -356 -0.196935 0.285
NP_441588.1_4 Forward -363 -353 7.25653 0.178
NP_442687.1_7 Forward -395 -385 4.60159 0.243
NP_442485.1_3 Forward -78 -59 -5.60541 0.293
NP_442530.1_2 Forward -236 -226 15.2213 0.203
NP_441013.1_3 Forward -119 -100 5.99764 0.281
NP_441029.1_3 Reverse -59 -78 1.17943 0.277
NP_442658.1_1 Forward -367 -357 6.96107 0.214
NP_442658.1_1 Reverse -354 -364 6.17443 0.235
NP_442782.1_2 Reverse -183 -197 0.491246 0.289
NP_440800.1_7 Reverse -291 -305 17.4042 0.227
NP_439968.1_8 Forward -161 -145 14.9065 0.204
NP_441958.1_5 Reverse -355 -365 -6.31315 0.28
NP_440203.1_5 Reverse -299 -309 10.5993 0.218
NP_439905.1_1 Reverse -64 -77 10.8357 0.209
NP_439905.1_1 Forward -170 -157 7.98409 0.239
NP_440984.1_7 Reverse -351 -365 7.86607 0.161
NP_442690.1_1 Forward -194 -175 -4.81876 0.157
NP_440369.1_6 Reverse -105 -124 8.65258 0.284
NP_442536.1_9 Forward -120 -101 17.0107 0.171
NP_443055.1_6 Forward -373 -355 8.27817 0.146
NP_440993.1_4 Reverse -58 -75 2.79211 0.298
NP_440602.1_1 Reverse -251 -270 16.1257 0.0989
NP_443044.1_1 Forward -235 -216 6.58763 0.261
NP_443044.1_1 Reverse -314 -333 1.67108 0.296
NP_442002.1_9 Forward -306 -299 11.3472 0.185
NP_442002.1_9 Reverse -355 -362 10.7572 0.185
NP_441000.1_6 Forward -366 -352 4.71948 0.0933
NP_441000.1_6 Reverse -355 -369 -4.62196 0.248
NP_440147.1_4 Reverse -354 -367 2.08423 0.21
NP_441916.1_7 Forward -365 -355 6.96153 0.0784
NP_441916.1_7 Reverse -70 -80 2.92996 0.235
NP_441041.1_4 Reverse -64 -83 -7.4737 0.188
NP_441041.1_4 Forward -305 -286 -11.5053 0.248
NP_441041.1_7 Forward -368 -356 7.22324 0.171
NP_441547.1_2 Forward -343 -325 3.46073 0.286
NP_441725.1_5 Reverse -297 -307 0.176696 0.206
NP_439966.1_7 Forward -367 -357 15.9091 0.0124
NP_439966.1_9 Forward -367 -358 9.83282 0.215
NP_439966.1_9 Forward -75 -66 6.98123 0.253
NP_439966.1_9 Reverse -354 -363 0.884706 0.253
NP_440289.1_2 Forward -368 -355 2.77255 0.0883
NP_441514.1_1 Reverse -172 -182 14.727 0.274
NP_442281.1_1 Forward -310 -296 2.5556 0.263
NP_440177.1_1 Reverse -59 -77 5.91901 0.272
NP_442256.1_2 Forward -367 -349 -6.07737 0.214
NP_443049.1_6 Reverse -355 -365 13.6904 0.149
NP_442215.1_2 Reverse -282 -298 -4.46469 0.233
NP_442215.1_2 Forward -75 -59 -7.31629 0.291
NP_442215.1_2 Forward -110 -94 -7.61128 0.3
NP_440253.1_2 Reverse -356 -374 8.57394 0.0559
NP_440253.1_2 Reverse -64 -82 -2.53746 0.268
NP_440253.1_2 Forward -146 -128 -3.71743 0.3
NP_442933.1_10 Forward -365 -356 6.48957 0.119
NP_441751.2_8 Reverse -297 -311 -6.58858 0.273
NP_442926.1_3 Reverse -151 -170 11.4058 0.119
NP_442554.1_8 Forward -72 -62 5.38824 0.15
NP_442554.1_8 Forward -364 -354 3.42162 0.226
NP_441586.1_6 Forward -75 -56 2.85105 0.282
NP_441762.1_7 Reverse -355 -367 13.9036 0.0142
NP_441762.1_7 Forward -366 -354 2.0056 0.0705
NP_441762.1_7 Reverse -2 -14 -6.64753 0.284
NP_442142.1_4 Forward -368 -355 10.5401 0.0712
NP_442142.1_4 Reverse -38 -51 3.55864 0.251
NP_442142.1_4 Forward -53 -40 2.67367 0.281
NP_442292.1_1 Forward -364 -355 -0.196935 0.239
NP_442406.1_1 Forward -374 -355 12.9783 0.185
NP_442406.1_9 Reverse -56 -75 4.62101 0.271
NP_441371.1_3 Forward -115 -97 4.44404 0.295
NP_440357.1_3 Forward -75 -56 7.96426 0.206
NP_440279.1_8 Forward -240 -221 12.6841 0.242
NP_440379.1_5 Reverse -158 -177 -2.55715 0.199
NP_440379.1_5 Forward -76 -57 -3.54046 0.204
NP_440464.1_10 Reverse -143 -153 11.8623 0.275
NP_441468.1_1 Reverse -357 -364 6.13563 0.209
NP_441468.1_1 Forward -364 -357 6.0373 0.223
NP_439939.1_3 Reverse -218 -237 -4.32711 0.297
NP_441020.2_9 Reverse -207 -226 14.7491 0.289
NP_441015.1_10 Reverse -59 -78 -10.817 0.288
NP_441673.1_1 Reverse -356 -365 1.37636 0.114
NP_441673.1_1 Forward -365 -356 1.1797 0.163
NP_442253.1_5 Forward -120 -103 -6.05768 0.297
NP_441826.1_2 Reverse -64 -78 -3.44199 0.285
NP_441826.1_5 Forward -78 -59 0.58944 0.3
NP_441330.1_1 Forward -385 -366 -15.1435 0.265
NP_442719.1_2 Forward -191 -173 -9.81463 0.267
NP_442719.1_2 Forward -190 -172 -10.6013 0.278
NP_441251.1_8 Forward -279 -266 15.5315 0.254
NP_442227.1_2 Forward -175 -156 6.19431 0.201
NP_442227.1_2 Forward -80 -61 0.491109 0.252
NP_442808.1_1 Forward -366 -356 17.5808 0.00507
NP_442808.1_1 Forward -13 -3 3.61784 0.234
NP_442808.1_1 Reverse -106 -116 3.12618 0.248
NP_442050.1_5 Reverse -181 -191 6.86274 0.28
NP_441114.1_3 Reverse -109 -118 7.66954 0.231
NP_440558.1_2 Reverse -104 -123 0.196116 0.194
NP_441518.1_3 Forward -375 -356 -15.4385 0.293
NP_441036.1_8 Reverse -355 -365 7.05986 0.21
NP_441036.1_8 Forward -366 -356 6.07655 0.242
NP_441557.1_5 Reverse -356 -365 1.08137 0.0794
NP_441557.1_5 Forward -365 -356 0.589713 0.134
NP_442419.1_2 Reverse -59 -78 -4.32711 0.285
NP_441739.1_2 Reverse -296 -312 4.28609 0.245
NP_441458.1_10 Reverse -105 -124 3.34271 0.251
NP_442183.1_1 Reverse -356 -370 14.5526 0.0311
NP_441407.1_5 Forward -375 -356 6.58763 0.188
NP_442397.1_9 Reverse -296 -315 3.83436 0.262
NP_441574.1_1 Forward -85 -66 -4.52377 0.252
NP_440157.1_5 Forward -282 -263 15.135 0.265
NP_442170.1_5 Reverse -356 -375 3.53937 0.172
NP_442347.1_2 Forward -364 -355 10.9145 0.0571
NP_440235.1_2 Forward -106 -87 18.8781 0.281
NP_440151.1_2 Reverse -57 -75 13.588 0.277
NP_442317.1_6 Forward -240 -221 3.04771 0.264
NP_441633.1_3 Reverse -354 -367 1.10092 0.109
NP_440136.1_2 Reverse -357 -364 6.23397 0.171
NP_440136.1_2 Forward -364 -357 6.13563 0.193
NP_442998.1_10 Forward -363 -356 15.5754 0.0102
NP_441799.1_1 Reverse -352 -366 7.07881 0.153
NP_440640.1_6 Reverse -58 -77 0.687771 0.27
NP_442201.1_10 Forward -395 -376 -6.09707 0.184
NP_442201.1_10 Reverse -345 -364 -6.68705 0.184
NP_441559.1_8 Reverse -103 -117 -4.52363 0.227
NP_441559.1_8 Forward -101 -87 -5.50694 0.264
NP_441559.1_8 Reverse -291 -305 -7.76856 0.299
NP_442158.1_4 Forward -302 -292 10.7964 0.283
NP_442866.1_1 Forward -78 -59 -1.18052 0.202
NP_442866.1_4 Reverse -297 -316 3.73603 0.28
NP_440748.1_5 Reverse -287 -306 -2.45882 0.274
NP_441494.1_6 Forward -310 -297 9.16406 0.227
NP_441417.1_5 Forward -272 -253 16.1257 0.0961
NP_442386.1_9 Forward -366 -357 7.96411 0.213
NP_442386.1_9 Reverse -355 -364 5.9975 0.23
NP_442386.1_9 Forward -13 -4 4.62087 0.294
NP_441750.1_1 Reverse -58 -77 0.687771 0.182
NP_441750.1_1 Reverse -153 -172 -4.52377 0.204
NP_441750.1_7 Reverse -210 -220 14.1397 0.254
NP_441340.1_5 Reverse -357 -364 6.23397 0.132
NP_441340.1_5 Forward -364 -357 5.84064 0.208
NP_442240.1_1 Reverse -56 -75 10.7167 0.197
NP_442240.1_1 Reverse -380 -399 4.12856 0.274
NP_442240.1_2 Forward -364 -345 -16.7168 0.249
NP_440586.1_8 Reverse -357 -364 14.69 0.026
NP_440586.1_8 Forward -170 -163 7.51192 0.239
NP_440586.1_8 Forward -49 -42 5.8403 0.283
NP_442251.1_6 Forward -364 -357 12.0355 0.0627
NP_441262.1_3 Reverse -356 -363 14.7888 0.0223
NP_440523.1_3 Forward -102 -83 20.2548 0.0346
NP_443051.1_1 Reverse -355 -364 0.884706 0.125
NP_439937.1_8 Reverse -354 -373 -2.45882 0.259
NP_439937.1_9 Reverse -106 -123 4.36469 0.0798
NP_439937.1_9 Reverse -283 -300 -13.3348 0.285
NP_440439.1_1 Reverse -382 -395 -0.570702 0.226
NP_439943.1_1 Forward -107 -88 3.34271 0.112
NP_440372.1_2 Reverse -357 -364 6.82395 0.0854
NP_440372.1_2 Forward -364 -357 6.52896 0.188
NP_441803.1_2 Forward -125 -106 0.392778 0.253
NP_439977.1_5 Forward -79 -60 3.44104 0.159
NP_442384.1_10 Reverse -162 -175 3.95252 0.172
NP_442035.1_2 Forward -373 -354 17.0099 0.202
NP_442262.1_10 Reverse -357 -364 12.9205 0.0422
NP_442262.1_10 Forward -100 -93 8.20058 0.25
NP_440344.1_10 Forward -372 -355 6.33202 0.0183
NP_440344.1_10 Reverse -380 -397 -1.92778 0.0588
NP_440297.1_9 Reverse -303 -313 -0.216628 0.282
NP_440937.1_5 Forward -79 -60 8.65258 0.278
NP_440999.1_9 Reverse -107 -121 -2.85201 0.279
NP_440888.1_2 Forward -73 -59 5.1122 0.293
NP_442948.1_2 Reverse -355 -374 15.1424 0.106
NP_441759.1_2 Forward -373 -354 2.45773 0.186
NP_441543.1_2 Forward -364 -355 8.65285 0.0968
NP_441543.1_2 Reverse -357 -366 7.07956 0.131
NP_441918.1_7 Reverse -63 -82 -2.16383 0.297
NP_441469.1_8 Reverse -355 -364 6.39124 0.227
NP_441469.1_8 Forward -366 -357 5.60459 0.258
NP_442337.1_8 Forward -323 -304 -1.47551 0.284
NP_442578.1_7 Reverse -357 -364 14.6904 0.026
NP_440071.1_6 Forward -316 -302 15.0653 0.241
NP_440220.1_4 Reverse -289 -308 1.57197 0.238
NP_441462.1_2 Reverse -356 -366 -0.0199663 0.177
NP_441621.1_7 Reverse -354 -368 -2.16369 0.188
NP_441621.1_7 Forward -367 -353 -3.73699 0.193
NP_441621.1_7 Forward -75 -61 -4.4253 0.223
NP_441929.1_3 Forward -234 -215 5.30933 0.266
NP_443062.1_1 Forward -50 -32 9.42349 0.134
NP_440516.1_8 Reverse -356 -365 10.5211 0.00816
NP_440104.1_8 Reverse -222 -236 21.3367 0.0322
NP_442428.1_5 Reverse -357 -364 6.13563 0.209
NP_442428.1_5 Forward -364 -357 6.0373 0.212
NP_442120.1_10 Reverse -70 -89 -1.18052 0.167
NP_442120.1_10 Forward -311 -292 -11.5053 0.262
NP_442120.1_10 Forward -79 -60 -15.9302 0.296
NP_440673.1_3 Forward -363 -356 12.4288 0.0426
NP_440673.1_7 Reverse -59 -78 12.5858 0.097
NP_440077.1_2 Forward -117 -99 20.2745 0.175
NP_441052.1_2 Forward -365 -355 1.25834 0.249
NP_440436.1_4 Forward -364 -355 8.55409 0.0997
NP_441321.1_5 Reverse -172 -191 2.55606 0.285
NP_441719.1_4 Reverse -357 -364 13.5105 0.026
NP_441719.1_4 Forward -364 -357 6.52896 0.188
NP_441733.1_10 Forward -368 -355 8.57408 0.14
NP_441004.1_1 Reverse -58 -77 -9.14533 0.206
NP_441004.1_5 Reverse -60 -74 9.83269 0.248
NP_442366.1_3 Forward -366 -348 -5.88071 0.298
NP_442366.1_5 Reverse -353 -363 15.2208 0.0375
NP_442206.1_10 Forward -50 -35 2.33984 0.202
NP_443054.1_2 Reverse -383 -397 2.45787 0.245
NP_443054.1_2 Forward -118 -104 0.491246 0.262
NP_441851.1_10 Reverse -355 -365 4.60159 0.259
NP_442208.1_5 Forward -399 -380 -6.78538 0.269
NP_440593.1_3 Reverse -59 -78 0.392778 0.194
NP_442689.1_8 Forward -190 -173 3.87375 0.167
NP_440432.1_9 Reverse -357 -372 -2.28172 0.169
NP_442843.1_1 Reverse -195 -214 -7.4737 0.248
NP_439960.1_10 Reverse -57 -75 -2.83245 0.258
NP_440431.1_3 Reverse -161 -180 -3.24547 0.178
NP_440431.1_7 Forward -304 -285 9.24257 0.108
NP_440195.1_4 Reverse -58 -77 10.7175 0.158
NP_441078.1_4 Reverse -356 -365 0.196389 0.205
NP_441078.1_4 Forward -365 -356 -0.000272808 0.205
NP_442443.1_4 Forward -238 -228 13.4509 0.233
NP_441432.1_8 Reverse -63 -72 5.21127 0.185
NP_442320.1_8 Forward -371 -357 5.01447 0.0442
NP_442320.1_8 Reverse -350 -364 -3.44199 0.122
NP_442447.1_6 Reverse -226 -240 16.4651 0.291
NP_441030.1_6 Forward -313 -294 14.488 0.193
NP_442797.1_7 Forward -74 -56 0.117479 0.278
NP_441057.1_4 Forward -400 -382 0.707465 0.253
NP_442400.1_10 Reverse -175 -188 14.672 0.173
NP_442489.1_7 Forward -365 -356 7.47288 0.0613
NP_442489.1_7 Reverse -356 -365 0.688044 0.152
NP_441800.1_3 Reverse -303 -321 4.44404 0.289
NP_441800.1_10 Reverse -63 -82 0.786102 0.283
NP_440779.1_5 Reverse -356 -373 -14.8091 0.274
NP_442346.1_5 Forward -51 -41 9.02648 0.118
NP_440545.1_3 Reverse -98 -115 -0.354483 0.152
NP_440025.1_1 Reverse -352 -371 5.60432 0.288
NP_440459.1_2 Reverse -347 -364 9.28195 0.23
NP_440459.1_2 Forward -75 -58 8.00365 0.272
NP_441050.1_7 Forward -71 -53 8.96727 0.231
NP_441948.1_4 Reverse -349 -367 -2.63579 0.173
NP_441047.1_1 Reverse -56 -75 1.27776 0.243
NP_441833.1_3 Forward -280 -266 18.3875 0.133
NP_441833.1_4 Forward -364 -357 6.52896 0.0924
NP_441833.1_4 Reverse -357 -364 6.23397 0.163
NP_442799.1_2 Reverse -56 -75 0.0977854 0.276
NP_441112.1_6 Reverse -6 -25 -4.22878 0.296
NP_442162.1_9 Reverse -357 -364 6.62729 0.142
NP_442162.1_9 Forward -364 -357 6.52896 0.178
NP_442055.1_6 Forward -119 -100 15.0441 0.221
NP_442073.1_6 Reverse -378 -397 1.17943 0.25
NP_442073.1_6 Forward -374 -355 -1.27885 0.271
NP_442140.1_3 Reverse -357 -367 10.0098 0.0949
NP_442140.1_3 Forward -364 -354 6.66654 0.159
NP_442140.1_3 Reverse -65 -75 6.56821 0.162
NP_441813.1_5 Forward -367 -357 0.373358 0.203
NP_441813.1_5 Reverse -354 -364 0.176696 0.215
NP_440590.1_4 Forward -364 -351 0.707601 0.144
NP_440567.1_1 Forward -364 -350 7.37441 0.0726
NP_440567.1_1 Reverse -357 -371 2.2612 0.179
NP_442497.1_10 Forward -364 -355 0.589713 0.153
NP_440821.1_4 Forward -367 -357 6.56821 0.0853
NP_440821.1_4 Reverse -354 -364 0.471689 0.174
NP_441239.1_9 Forward -367 -355 8.9871 0.117
NP_441951.1_4 Reverse -58 -77 6.09597 0.273
NP_441951.1_4 Reverse -64 -83 5.89931 0.273
NP_442639.1_5 Forward -79 -60 13.7658 0.222
NP_441017.1_8 Forward -150 -135 11.8779 0.188
NP_442216.1_4 Reverse -53 -61 8.1805 0.255
NP_440546.1_4 Forward -50 -40 8.20381 0.199
NP_442041.1_5 Forward -119 -100 0.491109 0.257
NP_441230.1_5 Forward -78 -59 0.392778 0.269
NP_440055.1_5 Reverse -337 -356 14.3605 0.261
NP_440462.1_6 Forward -367 -357 7.35486 0.0803
NP_440462.1_6 Reverse -354 -364 5.78156 0.138
NP_442340.1_3 Reverse -283 -302 -7.08038 0.23
NP_440868.1_4 Forward -369 -357 9.47875 0.0482
NP_440868.1_4 Reverse -352 -364 8.49544 0.0602
NP_441249.1_3 Reverse -62 -81 0.392778 0.285
NP_441582.1_5 Forward -367 -348 18.4848 0.0852
NP_442402.1_4 Reverse -379 -398 -5.60616 0.245
NP_441084.1_6 Reverse -39 -53 10.2167 0.25
NP_440653.1_10 Forward -72 -53 9.83255 0.16
NP_440843.1_8 Forward -311 -292 14.9458 0.297
NP_442039.1_7 Reverse -66 -76 13.648 0.211
NP_442679.1_1 Forward -285 -266 -2.75381 0.242
NP_442679.1_1 Forward -277 -258 -4.52377 0.281
NP_440825.1_6 Forward -75 -56 7.7676 0.285
NP_440825.1_7 Forward -364 -354 12.5193 0.155
NP_442696.1_6 Reverse -104 -123 -13.2752 0.27
NP_442837.1_3 Forward -364 -357 12.1338 0.0702
NP_442837.1_3 Reverse -357 -364 6.0373 0.25
NP_442053.1_1 Forward -365 -356 14.1594 0.0136
NP_442053.1_1 Reverse -356 -365 7.86621 0.0863
NP_442532.1_7 Reverse -64 -78 4.91614 0.171
NP_442532.1_7 Reverse -356 -370 2.94952 0.214
NP_441408.2_7 Forward -382 -363 -5.31042 0.292
NP_441011.1_8 Forward -364 -355 7.07956 0.179
NP_441011.1_8 Reverse -357 -366 5.70292 0.237
NP_441028.1_6 Reverse -230 -240 7.74772 0.218
NP_441028.1_6 Reverse -276 -286 4.7978 0.277
NP_442202.1_4 Forward -367 -353 19.1375 0.104
NP_442202.1_10 Reverse -62 -76 5.30946 0.255
NP_442202.1_10 Reverse -147 -161 3.44117 0.278
NP_440116.1_4 Forward -314 -295 6.19431 0.293
NP_440116.1_8 Forward -78 -59 -8.45701 0.253
NP_441527.1_4 Reverse -169 -188 -12.3666 0.285
NP_441347.1_5 Reverse -46 -60 9.83206 0.269
NP_442492.1_2 Reverse -356 -375 4.22769 0.214
NP_441961.1_4 Reverse -99 -118 2.85105 0.281
NP_441602.1_3 Forward -78 -59 5.211 0.142
NP_441106.1_1 Reverse -355 -364 8.45619 0.0548
NP_441106.1_1 Reverse -161 -170 2.16301 0.297
NP_439903.1_6 Forward -195 -176 5.11187 0.186
NP_439903.1_6 Reverse -185 -204 2.45694 0.226
NP_442306.1_10 Reverse -380 -399 -11.2103 0.121
NP_441286.1_1 Reverse -355 -367 -5.17256 0.192
NP_442674.1_3 Forward -211 -192 11.7 0.174
NP_440886.1_7 Forward -366 -356 8.43603 0.0805
NP_440886.1_7 Reverse -355 -365 6.86274 0.113
NP_440886.1_7 Forward -220 -210 3.71617 0.267
NP_440404.1_9 Reverse -172 -191 7.87766 0.263
NP_442072.1_9 Reverse -69 -87 -22.892 0.266
NP_440907.2_8 Reverse -357 -367 5.09279 0.222
NP_440907.2_8 Forward -364 -354 4.7978 0.243
NP_441021.1_8 Reverse -351 -369 8.37728 0.181
NP_441463.1_3 Forward -71 -52 -6.58872 0.246
NP_441463.1_3 Forward -375 -356 -9.047 0.276
NP_441626.1_2 Reverse -357 -364 6.13563 0.177
NP_441626.1_2 Forward -364 -357 5.93897 0.231
NP_442211.1_3 Forward -78 -59 8.15285 0.275
NP_442238.1_1 Forward -305 -286 -0.000545616 0.295
NP_442794.1_1 Reverse -60 -72 5.93884 0.198
NP_441962.1_4 Forward -78 -59 -9.53865 0.218
NP_441962.1_4 Reverse -59 -78 -11.6036 0.243
NP_441742.1_7 Reverse -381 -400 16.7157 0.245
NP_440855.1_5 Forward -398 -379 6.48849 0.285
NP_441431.1_2 Forward -368 -354 8.25877 0.221
NP_441431.1_3 Forward -73 -54 5.50599 0.263
NP_441488.1_2 Forward -38 -19 15.9291 0.26
NP_441836.1_2 Reverse -156 -175 12.9791 0.0686
NP_441836.1_2 Forward -174 -155 -6.58872 0.3
NP_440634.1_6 Reverse -97 -111 14.8476 0.28
NP_441174.1_4 Forward -276 -266 12.6647 0.276
NP_442323.1_7 Reverse -291 -310 1.6703 0.278
NP_441272.1_7 Forward -126 -116 13.7464 0.257
NP_440766.1_4 Forward -369 -355 5.40779 0.112
NP_439988.1_3 Forward -161 -147 3.63784 0.298
NP_439910.1_2 Forward -373 -356 -22.2823 0.22
NP_440798.1_6 Forward -364 -351 14.5723 0.0423
NP_442680.1_5 Forward -286 -267 -1.00237 0.297
NP_441984.1_3 Forward -83 -65 15.4571 0.119
NP_441436.1_8 Forward -395 -376 9.3409 0.266
NP_442514.1_5 Reverse -300 -319 -5.40949 0.259
NP_440756.1_3 Reverse -211 -229 18.6037 0.163
NP_440185.1_1 Reverse -131 -150 17.7965 0.11
NP_442341.1_5 Forward -398 -379 10.8159 0.297
NP_442341.1_7 Forward -366 -352 1.47456 0.288
NP_443000.1_3 Forward -294 -275 10.6499 0.267
NP_441842.1_1 Forward -363 -350 10.7368 0.291
NP_441842.1_10 Reverse -349 -363 6.78443 0.272
NP_440091.1_1 Forward -369 -357 3.87389 0.146
NP_439962.1_4 Forward -81 -62 -2.36049 0.226
NP_439962.1_4 Forward -166 -147 -6.29373 0.283
NP_440175.1_7 Forward -76 -58 11.9981 0.228
NP_441105.1_3 Forward -112 -93 -5.01543 0.211
NP_442373.1_2 Reverse -96 -115 -6.68705 0.233
NP_440216.1_1 Forward -365 -351 -2.85201 0.0608
NP_440216.1_9 Reverse -169 -178 12.5861 0.227
NP_440216.1_9 Reverse -43 -52 5.99792 0.289
NP_440172.1_1 Forward -305 -295 2.83163 0.264
NP_441852.1_6 Reverse -62 -81 10.9142 0.241
NP_440167.1_3 Reverse -381 -400 9.43923 0.256
NP_441111.1_7 Forward -364 -356 8.86921 0.0589
NP_441766.1_2 Forward -365 -356 8.55452 0.054
NP_440416.1_1 Reverse -356 -375 -13.6686 0.281
NP_440416.1_9 Reverse -56 -75 -18.3884 0.256
NP_443052.1_8 Forward -375 -356 -8.55534 0.175
NP_442154.1_1 Reverse -202 -220 -19.2537 0.294
NP_442564.1_10 Forward -393 -379 8.94771 0.296
NP_440261.1_5 Forward -364 -351 -12.4687 0.297
NP_440988.1_10 Reverse -56 -70 7.51277 0.216
NP_440988.1_10 Forward -75 -61 6.35102 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCTGGGGCACCCGGCGGCAAACCATTTCTAAAGCCTCGATCGCCGACTGATATTCTTGATTTTGCAGGGCTTTAAGTCCCTTTTGCAGGGTCAGGGCAATTTCATGGGCATTCATGGAAGTAAAAGCGGAGAAACGAGAACAGAGGAGCCGGAACTAGTATGGAGGCAAAAATTCCATTCTCCCACCCCCAATATGAGTTATGGAAAAGCGTTTTGCTTAATTTTCCTTGCCATCATCTGCACGACTTGGGGCGGAAGTATCCAGTTAGTCCAGTTTTCGGCGGGCAATGCTGGCTCCTCCCATGGATTCCAAAGATAGAAGCTGCCGCCATTGGCACGGGGATTTACTCGCCATGGTTTTGATAAAGTGTTGAGGCAAGTATTTTCCGGGAAAGCTCA

CDS

GTGGATTCCGAGATTAATCATCGTGGTGGTTTGAGTGCTCCCCGCCCAAGGGAAACGTCACTTAATTTAGCTCTCTACCGGGGCTTGAAATGGGGGGTGGTGCGGCCACTGCTCCATGGATTGTTCCAGGCCCAGGTATATGGTCAGGAATTGGTGCCAACCCGGGGGCCGGCCTTGGTGGTGAGCAACCATGCCAGTTATTTTGACCCCCCATTTTTGTCCTGTGCCATGGCCCGGCCGGTGGCCTTTATGGCCAAGGAAGAGTTATTTAATGTGCCCCTGCTGGGTCCAGCCATTCGCCTCTATGGGGCCTATCCAGTCAAACGGGGCAGTGGCGATCGGGGAGCATTGCGGGCCGCCTTGACGGCGCTGGGGGATGGTTGGTTAGTGGGGGTCTTTCTGGAGGGAACCAGAACAAAGGATGGCCGCATTCACCAGCCAAAATTGGGGGCTGCCATGATTGCAGCTAAAGCCCAAGTGCCCATTATTCCCGTCAGCCTAGGGGGAGTAGAGCAAATTTTTCAGCCCGGTTCCCCCTGGCCCCATCCTGTGCCTTTAACTATTCGCATTGGTAAGGCGATCGCCCCTCCAGTAAAGAATAGGAAACCCGAATTGGAAGCGGTTACTAAAGCTTGCCAAGCCCAAATTCACGAGATGCTGGATTTAGGCAGGGATTAG

Protein

MDSEINHRGGLSAPRPRETSLNLALYRGLKWGVVRPLLHGLFQAQVYGQELVPTRGPALVVSNHASYFDPPFLSCAMARPVAFMAKEELFNVPLLGPAIRLYGAYPVKRGSGDRGALRAALTALGDGWLVGVFLEGTRTKDGRIHQPKLGAAMIAAKAQVPIIPVSLGGVEQIFQPGSPWPHPVPLTIRIGKAIAPPVKNRKPELEAVTKACQAQIHEMLDLGRD