Your browser is old and dusty. Try Google Chrome!

Details for sll1834

ORF sll1834
Accession NP_440458.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -125 -111 1.76955 0.183
NP_440795.1_7 Forward -125 -118 14.6904 0.0123
NP_440795.1_7 Reverse -118 -125 14.6904 0.0123
NP_442100.1_1 Reverse -297 -316 8.83258 0.24
NP_441418.1_6 Forward -126 -107 -9.24366 0.0278
NP_441418.1_6 Reverse -117 -136 -11.1119 0.0445
NP_442291.1_5 Forward -127 -111 8.41667 0.0558
NP_440897.1_6 Reverse -51 -70 1.76863 0.17
NP_441453.1_4 Reverse -117 -125 16.539 0.00633
NP_441453.1_4 Forward -126 -118 16.539 0.00633
NP_441453.1_7 Forward -247 -240 12.9205 0.23
NP_441453.1_8 Reverse -183 -200 11.2486 0.217
NP_441623.1_1 Forward -82 -64 10.7372 0.0912
NP_441960.1_2 Reverse -24 -43 17.404 0.261
NP_440561.1_1 Reverse -173 -192 9.83173 0.284
NP_441818.1_1 Forward -125 -114 9.79292 0.232
NP_441818.1_1 Reverse -118 -129 8.90795 0.271
NP_440226.1_1 Reverse -117 -136 14.1591 0.0325
NP_440226.1_1 Forward -126 -107 12.0942 0.0476
NP_440259.1_4 Forward -78 -64 9.21432 0.278
NP_440150.1_6 Reverse -114 -133 12.9791 0.106
NP_440150.1_6 Forward -129 -110 8.84924 0.19
NP_442287.1_1 Forward -254 -244 15.2208 0.22
NP_442173.1_1 Forward -125 -117 15.4574 0.00633
NP_442173.1_1 Reverse -118 -126 15.4574 0.00633
NP_442752.1_4 Forward -126 -119 13.8055 0.0199
NP_442752.1_4 Reverse -117 -124 13.8055 0.0199
NP_443027.1_4 Forward -128 -118 11.8781 0.0872
NP_443027.1_4 Reverse -115 -125 11.0914 0.107
NP_441812.1_3 Reverse -116 -130 6.88276 0.287
NP_442975.1_10 Forward -130 -116 4.22722 0.245
NP_441470.1_4 Forward -319 -300 13.4708 0.162
NP_441225.1_4 Reverse -113 -132 -12.1936 0.284
NP_441675.1_4 Forward -315 -296 4.32602 0.257
NP_440784.1_7 Forward -125 -118 15.9687 0.0123
NP_440784.1_7 Reverse -118 -125 15.9687 0.0123
NP_442861.1_1 Forward -354 -335 9.83255 0.295
NP_441250.1_3 Forward -317 -298 5.211 0.241
NP_440061.1_9 Forward -128 -114 19.6651 0.00478
NP_440061.1_9 Reverse -115 -129 14.7486 0.0595
NP_441054.1_4 Forward -136 -118 12.1139 0.0619
NP_440774.1_4 Reverse -201 -220 11.4058 0.279
NP_442062.1_3 Forward -317 -298 -1.27885 0.256
NP_442062.1_8 Reverse -117 -127 19.4496 0.000558
NP_442062.1_8 Forward -126 -116 17.3846 0.00193
NP_441859.1_3 Forward -127 -108 5.01354 0.209
NP_441859.1_7 Forward -130 -111 3.83436 0.278
NP_441802.1_1 Forward -244 -225 3.93269 0.298
NP_440304.1_4 Reverse -49 -59 2.04498 0.299
NP_440304.1_4 Forward -128 -118 1.84832 0.299
NP_440304.1_4 Reverse -115 -125 1.84832 0.299
NP_442242.1_4 Forward -125 -118 14.3954 0.0124
NP_442242.1_4 Reverse -118 -125 14.3954 0.0124
NP_441619.1_2 Forward -253 -234 18.5831 0.177
NP_441208.1_9 Reverse -71 -85 7.27608 0.223
NP_441208.1_9 Reverse -114 -128 5.99778 0.254
NP_440370.1_10 Reverse -108 -127 8.06259 0.243
NP_441546.1_2 Reverse -377 -396 17.3057 0.244
NP_441082.1_10 Reverse -239 -252 10.344 0.236
NP_441083.1_5 Forward -126 -116 20.3345 0.00053
NP_441083.1_5 Reverse -117 -127 11.3864 0.0159
NP_441434.1_1 Reverse -350 -364 9.7518 0.238
NP_441434.1_8 Reverse -337 -356 15.6058 0.122
NP_441738.1_2 Forward -124 -117 15.28 0.0102
NP_441738.1_2 Reverse -119 -126 15.28 0.0102
NP_441738.1_2 Forward -57 -50 6.72528 0.236
NP_441738.1_2 Reverse -234 -241 6.23363 0.264
NP_441558.1_5 Reverse -115 -134 17.699 0.0191
NP_441558.1_5 Reverse -182 -201 8.25926 0.155
NP_440209.1_1 Reverse -117 -125 18.1123 0.00295
NP_440209.1_1 Forward -126 -118 18.1123 0.00295
NP_442889.1_8 Forward -129 -115 5.89884 0.211
NP_441713.1_1 Reverse -111 -130 -14.4552 0.259
NP_441713.1_1 Forward -132 -113 -14.9469 0.26
NP_441770.1_4 Forward -192 -173 -7.17871 0.229
NP_441716.1_1 Forward -126 -112 8.84938 0.13
NP_441716.1_1 Reverse -117 -131 5.1128 0.24
NP_441327.1_5 Reverse -154 -163 16.2243 0.164
NP_442111.1_4 Reverse -116 -130 10.3243 0.0545
NP_440906.1_5 Forward -125 -118 15.8704 0.0124
NP_440906.1_5 Reverse -118 -125 15.8704 0.0124
NP_440747.1_10 Reverse -114 -126 26.5883 0.000317
NP_440747.1_10 Forward -129 -117 7.31547 0.00577
NP_441130.1_10 Reverse -115 -129 16.1259 0.0261
NP_441130.1_10 Forward -128 -114 9.43936 0.125
NP_441486.1_1 Forward -129 -115 4.81781 0.0406
NP_441486.1_1 Reverse -114 -128 -4.13031 0.189
NP_441880.2_10 Reverse -118 -136 13.4905 0.111
NP_442330.1_4 Forward -242 -223 15.8244 0.233
NP_442330.1_4 Reverse -122 -141 12.5063 0.286
NP_442634.1_2 Forward -132 -113 9.0459 0.144
NP_442634.1_4 Forward -128 -114 -1.27871 0.149
NP_440403.1_4 Reverse -108 -127 -7.86702 0.248
NP_441014.1_5 Forward -258 -240 9.26226 0.282
NP_441014.1_8 Reverse -114 -133 -3.54046 0.242
NP_442848.1_1 Reverse -111 -125 -0.885388 0.263
NP_443018.1_3 Forward -125 -118 14.8871 0.0123
NP_443018.1_3 Reverse -118 -125 14.8871 0.0123
NP_443018.1_3 Forward -192 -185 10.2655 0.107
NP_441316.1_7 Forward -128 -113 -2.8717 0.273
NP_441634.1_8 Reverse -115 -129 15.5359 0.0248
NP_440376.1_1 Forward -126 -117 19.4693 0.000692
NP_440376.1_1 Reverse -117 -126 19.4693 0.000692
NP_440376.1_1 Reverse -244 -253 8.06287 0.0463
NP_441857.1_6 Reverse -243 -253 14.1397 0.254
NP_442687.1_7 Forward -127 -117 15.8113 0.0125
NP_442687.1_7 Reverse -116 -126 8.92815 0.0994
NP_442191.1_4 Forward -252 -238 13.7079 0.132
NP_442191.1_4 Forward -135 -121 11.187 0.268
NP_441077.1_6 Forward -375 -359 5.88689 0.244
NP_441077.1_6 Forward -399 -383 2.12702 0.289
NP_442958.1_3 Forward -137 -118 -0.39387 0.267
NP_440642.1_8 Reverse -119 -138 15.0712 0.171
NP_441422.1_3 Reverse -112 -131 18.9655 0.103
NP_441422.1_7 Forward -128 -111 7.61033 0.0992
NP_440533.1_6 Forward -245 -226 10.2259 0.274
NP_441763.1_10 Forward -137 -118 7.96345 0.225
NP_442658.1_1 Forward -128 -118 17.0891 0.00615
NP_442658.1_1 Reverse -115 -125 7.94438 0.199
NP_442198.1_3 Forward -296 -277 3.6377 0.285
NP_442782.1_2 Forward -318 -304 0.589577 0.288
NP_441414.1_9 Forward -126 -107 -2.75381 0.122
NP_441414.1_9 Reverse -117 -136 -5.9004 0.182
NP_441958.1_5 Forward -127 -117 12.2714 0.00183
NP_441958.1_5 Reverse -116 -126 12.2714 0.00183
NP_441127.1_1 Reverse -127 -141 7.86607 0.3
NP_442836.1_5 Reverse -111 -130 2.75272 0.248
NP_439905.1_1 Reverse -118 -131 20.5705 0.00954
NP_439905.1_1 Reverse -51 -64 7.88576 0.241
NP_440984.1_7 Forward -131 -117 11.7993 0.122
NP_440984.1_7 Reverse -112 -126 9.34103 0.127
NP_441162.1_3 Reverse -233 -252 8.55425 0.258
NP_439990.1_5 Reverse -112 -125 10.5407 0.128
NP_442690.1_1 Reverse -338 -357 -5.99873 0.164
NP_442690.1_1 Forward -316 -297 -15.6352 0.28
NP_442911.1_2 Reverse -107 -126 -3.63879 0.115
NP_442911.1_2 Forward -136 -117 -4.52377 0.136
NP_440602.1_5 Reverse -188 -207 16.3224 0.205
NP_441099.1_5 Reverse -107 -126 6.98095 0.0429
NP_441099.1_5 Forward -136 -117 -7.76869 0.18
NP_442002.1_9 Forward -127 -120 10.7572 0.185
NP_440809.1_9 Forward -135 -117 1.88744 0.118
NP_440021.1_4 Forward -73 -54 10.2251 0.251
NP_441294.1_7 Reverse -97 -111 11.9383 0.12
NP_441294.1_7 Forward -130 -116 11.5544 0.137
NP_440411.1_4 Reverse -65 -84 9.43923 0.181
NP_442438.1_10 Forward -228 -214 -0.197071 0.253
NP_442438.1_10 Forward -192 -178 -1.08205 0.291
NP_442566.1_2 Forward -131 -112 1.27776 0.289
NP_441000.1_6 Reverse -116 -130 5.70279 0.0933
NP_441000.1_6 Forward -127 -113 -3.93365 0.225
NP_440147.1_4 Forward -128 -115 17.6205 0.00602
NP_440147.1_4 Reverse -115 -128 15.0639 0.0197
NP_441550.1_8 Reverse -115 -125 15.1225 0.0132
NP_441550.1_8 Forward -128 -118 8.82935 0.112
NP_441916.1_7 Reverse -117 -127 18.4663 0.00144
NP_441916.1_7 Forward -126 -116 10.3048 0.0261
NP_441041.1_4 Reverse -117 -136 -3.3438 0.121
NP_441041.1_4 Forward -126 -107 -11.1119 0.241
NP_441041.1_7 Forward -129 -117 8.58373 0.133
NP_441041.1_7 Reverse -114 -126 7.51478 0.162
NP_440016.1_3 Reverse -41 -60 10.9142 0.291
NP_441725.1_4 Reverse -112 -126 3.53891 0.278
NP_441725.1_5 Forward -125 -115 2.04498 0.115
NP_441725.1_5 Reverse -118 -128 2.04498 0.115
NP_439966.1_7 Forward -128 -118 17.9741 0.00631
NP_439966.1_7 Reverse -115 -125 15.3192 0.0152
NP_439966.1_9 Forward -119 -110 4.52295 0.253
NP_439966.1_9 Forward -128 -119 0.884706 0.253
NP_442941.1_3 Forward -125 -115 19.2529 0.00262
NP_442941.1_3 Reverse -118 -128 10.7964 0.0116
NP_440674.1_3 Reverse -121 -140 2.16274 0.267
NP_440289.1_2 Forward -129 -116 11.229 0.021
NP_440289.1_2 Reverse -114 -127 -3.61896 0.267
NP_440983.1_9 Reverse -108 -127 9.14423 0.202
NP_441514.1_1 Reverse -378 -388 15.0135 0.274
NP_442281.1_1 Reverse -112 -126 16.6169 0.00772
NP_442281.1_1 Forward -131 -117 2.06395 0.278
NP_441079.1_7 Reverse -348 -367 -4.1312 0.241
NP_442256.1_2 Reverse -115 -133 -7.45401 0.214
NP_001035871.2_7 Reverse -241 -251 17.6796 0.105
NP_442049.1_10 Forward -134 -115 1.76941 0.289
NP_441556.1_10 Forward -131 -117 15.6727 0.144
NP_440498.1_1 Reverse -108 -126 -0.275845 0.218
NP_442982.1_5 Reverse -174 -193 -0.39387 0.254
NP_442068.1_4 Reverse -93 -112 3.83357 0.299
NP_441644.1_6 Forward -126 -116 17.3841 0.00127
NP_441644.1_6 Reverse -117 -127 10.1076 0.0628
NP_442215.1_2 Reverse -202 -218 -2.20308 0.193
NP_442215.1_2 Forward -128 -112 -5.84132 0.26
NP_442247.1_5 Reverse -287 -301 15.3463 0.234
NP_440929.1_8 Forward -126 -117 19.2726 0.000701
NP_440929.1_8 Reverse -117 -126 19.2726 0.000701
NP_442933.1_1 Reverse -345 -364 7.30471 0.253
NP_442933.1_2 Forward -336 -318 8.78724 0.257
NP_442933.1_10 Forward -126 -117 17.601 0.00325
NP_442933.1_10 Reverse -117 -126 17.601 0.00325
NP_441310.1_9 Forward -161 -142 5.11266 0.128
NP_440430.1_5 Reverse -22 -41 11.7008 0.248
NP_441751.2_8 Forward -125 -111 13.6676 0.0162
NP_441751.2_8 Reverse -118 -132 -5.50694 0.214
NP_442554.1_8 Forward -125 -115 16.2046 0.0065
NP_442554.1_8 Reverse -118 -128 14.1397 0.0144
NP_441762.1_7 Reverse -116 -128 2.98891 0.0676
NP_441762.1_7 Forward -127 -115 2.39892 0.0676
NP_442142.1_4 Reverse -114 -127 16.0466 0.0264
NP_442142.1_4 Forward -129 -116 6.0169 0.175
NP_442292.1_1 Forward -125 -116 18.486 0.00229
NP_442292.1_1 Reverse -118 -127 9.63616 0.0183
NP_440919.1_7 Forward -295 -277 5.45093 0.286
NP_441024.1_6 Reverse -335 -354 6.92274 0.292
NP_442476.1_6 Reverse -118 -132 15.3392 0.037
NP_442476.1_6 Forward -125 -111 15.2409 0.037
NP_442381.1_8 Forward -129 -110 -7.37537 0.188
NP_441523.1_6 Reverse -113 -132 2.45773 0.291
NP_443009.1_5 Reverse -116 -127 18.3477 0.00265
NP_440807.1_7 Forward -258 -239 -0.787193 0.204
NP_440397.1_3 Forward -308 -289 11.0125 0.273
NP_441715.1_4 Reverse -118 -128 18.8596 0.00741
NP_441715.1_4 Forward -125 -115 17.3846 0.0106
NP_440881.1_10 Forward -125 -112 11.229 0.253
NP_441468.1_1 Forward -125 -118 15.8704 0.0124
NP_441468.1_1 Reverse -118 -125 15.8704 0.0124
NP_441673.1_1 Forward -126 -117 20.8459 0.000698
NP_441673.1_1 Reverse -117 -126 20.8459 0.000698
NP_441731.1_7 Forward -144 -125 9.0459 0.147
NP_441826.1_2 Reverse -111 -125 2.06454 0.136
NP_442043.1_1 Reverse -136 -155 4.71934 0.236
NP_442868.1_6 Reverse -115 -125 19.2529 0.00563
NP_442868.1_6 Forward -128 -118 10.3048 0.038
NP_442719.1_2 Forward -145 -127 7.29487 0.119
NP_442719.1_2 Reverse -280 -298 -3.42315 0.2
NP_442719.1_2 Forward -213 -195 -5.48809 0.219
NP_442719.1_2 Reverse -279 -297 -9.12632 0.259
NP_441056.1_1 Forward -126 -107 -8.45701 0.282
NP_440785.1_2 Forward -339 -320 13.6675 0.203
NP_440051.1_5 Forward -354 -340 14.3517 0.285
NP_441612.1_2 Forward -126 -116 8.54929 0.21
NP_442808.1_1 Forward -127 -117 18.4657 0.00201
NP_442808.1_1 Reverse -116 -126 8.63269 0.0481
NP_442808.1_1 Forward -254 -244 2.83119 0.254
NP_441101.1_10 Reverse -113 -132 -0.688862 0.189
NP_440031.1_10 Reverse -239 -258 3.93269 0.256
NP_442542.1_2 Forward -128 -115 15.6539 0.0793
NP_442050.1_5 Reverse -115 -125 14.3359 0.0206
NP_442050.1_5 Forward -128 -118 6.96107 0.27
NP_442903.1_2 Reverse -5 -24 3.19856 0.253
NP_442342.1_9 Forward -62 -46 7.2367 0.209
NP_440558.1_2 Reverse -108 -127 -5.60541 0.262
NP_442593.1_9 Reverse -373 -392 15.0073 0.278
NP_441878.1_6 Forward -127 -117 10.4031 0.0176
NP_441878.1_6 Reverse -116 -126 10.4031 0.0176
NP_441878.1_6 Reverse -73 -83 -7.59145 0.245
NP_441036.1_8 Forward -127 -117 17.7779 0.000554
NP_441036.1_8 Reverse -116 -126 8.33817 0.174
NP_441557.1_5 Forward -126 -117 19.9609 0.000699
NP_441557.1_5 Reverse -117 -126 19.9609 0.000699
NP_441445.1_1 Forward -135 -116 10.0292 0.0983
NP_441590.1_4 Forward -252 -233 4.81688 0.279
NP_442066.2_9 Forward -130 -117 11.229 0.154
NP_442066.2_9 Reverse -113 -126 10.8357 0.154
NP_441433.1_8 Forward -52 -33 -0.197208 0.244
NP_441433.1_8 Forward -253 -234 -1.7705 0.263
NP_440101.1_3 Forward -131 -112 6.09597 0.185
NP_442183.1_1 Forward -126 -112 8.94771 0.105
NP_440979.1_3 Reverse -118 -136 11.7205 0.234
NP_441638.1_8 Forward -298 -279 14.3558 0.277
NP_442347.1_2 Forward -125 -116 12.4878 0.056
NP_442347.1_2 Reverse -118 -127 11.1111 0.056
NP_442645.1_2 Reverse -109 -128 -12.9802 0.144
NP_441037.1_4 Forward -128 -118 6.92787 0.237
NP_441633.1_3 Reverse -115 -128 10.8357 0.0286
NP_441633.1_3 Forward -128 -115 5.72248 0.0481
NP_440136.1_2 Forward -125 -118 15.9687 0.0123
NP_440136.1_2 Reverse -118 -125 15.9687 0.0123
NP_442590.1_10 Forward -133 -114 5.50599 0.258
NP_442998.1_5 Forward -340 -330 11.8781 0.176
NP_442998.1_5 Reverse -175 -185 11.1898 0.191
NP_442998.1_10 Forward -124 -117 15.5754 0.0102
NP_442998.1_10 Reverse -119 -126 15.5754 0.0102
NP_440299.1_1 Reverse -113 -126 10.5401 0.0569
NP_440299.1_1 Forward -130 -117 6.0169 0.155
NP_441799.1_1 Reverse -113 -127 17.9935 0.00957
NP_441799.1_1 Forward -130 -116 16.0269 0.0153
NP_441799.1_9 Reverse -116 -135 -2.45882 0.213
NP_441007.1_5 Forward -125 -106 10.7175 0.214
NP_441007.1_10 Reverse -112 -125 8.57408 0.112
NP_441449.1_8 Reverse -103 -122 12.8237 0.298
NP_440256.1_1 Reverse -114 -133 2.16274 0.0669
NP_440087.1_1 Forward -135 -116 -5.01543 0.249
NP_441559.1_8 Forward -131 -117 12.1926 0.0574
NP_441559.1_8 Reverse -239 -253 -0.000409212 0.171
NP_441559.1_8 Forward -64 -50 -3.147 0.198
NP_441559.1_8 Reverse -122 -136 -4.91696 0.241
NP_441559.1_8 Reverse -112 -126 -6.49025 0.279
NP_440915.1_6 Reverse -113 -127 0.982901 0.148
NP_440915.1_6 Reverse -240 -254 -2.36035 0.268
NP_442158.1_4 Forward -294 -284 10.7964 0.283
NP_442785.1_7 Reverse -115 -129 10.816 0.228
NP_441866.1_4 Reverse -33 -46 12.7586 0.28
NP_442069.1_6 Reverse -102 -121 9.0459 0.165
NP_440787.1_5 Reverse -66 -80 9.93102 0.256
NP_440695.1_5 Reverse -117 -136 2.65439 0.254
NP_441939.1_3 Forward -125 -106 10.4225 0.126
NP_441939.1_3 Reverse -39 -58 7.96426 0.186
NP_442993.1_1 Reverse -117 -133 -9.77456 0.194
NP_442386.1_9 Forward -127 -118 15.7322 0.0144
NP_442386.1_9 Reverse -116 -125 13.8639 0.0289
NP_441340.1_5 Forward -125 -118 15.6737 0.0124
NP_441340.1_5 Reverse -118 -125 15.6737 0.0124
NP_441340.1_9 Forward -351 -341 7.29115 0.289
NP_442484.1_2 Reverse -106 -125 5.50599 0.168
NP_441132.1_3 Reverse -235 -254 2.26107 0.294
NP_440211.1_7 Forward -77 -59 7.09898 0.267
NP_440586.1_8 Forward -125 -118 13.2151 0.026
NP_440586.1_8 Reverse -118 -125 13.2151 0.026
NP_440586.1_8 Forward -192 -185 9.08521 0.178
NP_440586.1_9 Reverse -110 -129 9.53756 0.261
NP_442251.1_6 Forward -125 -118 15.2804 0.0124
NP_442251.1_6 Reverse -118 -125 15.2804 0.0124
NP_441262.1_3 Reverse -117 -124 14.7888 0.0223
NP_441262.1_3 Forward -126 -119 14.7888 0.0223
NP_443051.1_1 Reverse -116 -125 10.4228 0.00754
NP_443051.1_1 Forward -127 -118 10.4228 0.00754
NP_439937.1_9 Reverse -116 -133 -6.64833 0.157
NP_440439.1_1 Forward -129 -116 12.5073 0.0244
NP_440439.1_1 Reverse -114 -127 9.16406 0.0465
NP_440372.1_2 Forward -125 -118 16.3621 0.0124
NP_440372.1_2 Reverse -118 -125 16.3621 0.0124
NP_440819.1_5 Reverse -62 -70 8.08256 0.185
NP_439977.1_5 Forward -66 -47 4.81767 0.15
NP_441572.1_7 Forward -132 -113 -5.60541 0.265
NP_442384.1_10 Forward -126 -113 18.9972 0.00338
NP_442384.1_10 Reverse -117 -130 18.8988 0.00338
NP_442384.1_10 Forward -253 -240 0.60927 0.286
NP_442114.1_4 Reverse -117 -128 9.20345 0.17
NP_442262.1_10 Forward -125 -118 14.1988 0.0123
NP_442262.1_10 Reverse -118 -125 14.1988 0.0123
NP_442262.1_10 Forward -192 -185 9.18389 0.211
NP_441689.1_5 Reverse -115 -125 5.78111 0.197
NP_440344.1_10 Forward -133 -116 -6.05768 0.111
NP_440282.1_10 Reverse -107 -126 -6.09707 0.25
NP_440531.1_6 Reverse -109 -128 10.0292 0.0694
NP_440531.1_6 Forward -134 -115 1.17943 0.179
NP_442910.1_1 Reverse -110 -129 -4.52377 0.254
NP_441965.1_10 Forward -129 -113 19.9214 0.0179
NP_441965.1_10 Reverse -114 -130 6.15506 0.185
NP_442693.1_7 Forward -127 -108 7.66927 0.282
NP_440297.1_9 Reverse -185 -195 0.0783647 0.282
NP_440297.1_9 Forward -125 -115 -0.118297 0.282
NP_440297.1_9 Reverse -118 -128 -0.118297 0.282
NP_441896.1_3 Forward -135 -116 -2.65548 0.287
NP_442378.1_10 Reverse -343 -362 20.1006 0.165
NP_440999.1_9 Forward -130 -116 15.9292 0.0222
NP_440999.1_9 Reverse -113 -127 -1.96703 0.254
NP_440888.1_2 Reverse -117 -131 13.5686 0.027
NP_440888.1_2 Forward -126 -112 11.5037 0.0657
NP_442892.1_9 Reverse -314 -328 11.7987 0.296
NP_442454.1_2 Forward -176 -157 8.83258 0.291
NP_439969.1_1 Forward -254 -235 -5.80207 0.288
NP_442033.1_10 Forward -138 -119 -5.01543 0.179
NP_442033.1_10 Forward -128 -109 -9.24366 0.212
NP_441949.1_5 Forward -365 -346 10.8728 0.28
NP_440575.1_8 Forward -366 -347 -6.49039 0.283
NP_442077.1_9 Forward -175 -156 1.37609 0.218
NP_441543.1_2 Reverse -118 -127 18.486 0.00236
NP_441543.1_2 Forward -125 -116 16.9127 0.00359
NP_441551.1_5 Forward -130 -114 9.10428 0.218
NP_441469.1_8 Forward -127 -118 16.126 0.00797
NP_441469.1_8 Reverse -116 -125 6.48957 0.227
NP_442315.1_3 Forward -318 -299 14.4541 0.148
NP_443064.1_6 Forward -126 -116 12.5669 0.0796
NP_442578.1_7 Forward -125 -118 14.5921 0.026
NP_442578.1_7 Reverse -118 -125 14.5921 0.026
NP_441462.1_2 Forward -126 -116 11.5831 0.00406
NP_441462.1_2 Reverse -117 -127 11.5831 0.00406
NP_441621.1_7 Forward -128 -114 -3.24533 0.188
NP_440668.1_9 Reverse -183 -202 10.4225 0.249
NP_443062.1_1 Reverse -117 -135 7.18082 0.182
NP_443062.1_1 Forward -126 -108 4.93815 0.244
NP_443062.1_6 Reverse -109 -128 16.9124 0.0638
NP_443062.1_6 Forward -134 -115 10.0292 0.119
NP_441423.1_5 Forward -163 -150 18.5049 0.18
NP_440911.1_9 Reverse -92 -111 13.1758 0.122
NP_442204.1_1 Reverse -366 -377 4.97522 0.225
NP_442204.1_1 Reverse -240 -251 3.40192 0.266
NP_442204.1_1 Reverse -113 -124 1.7303 0.266
NP_442204.1_1 Forward -130 -119 -0.0396598 0.285
NP_442204.1_2 Reverse -234 -253 5.80098 0.292
NP_440255.1_5 Forward -373 -359 15.8633 0.246
NP_440516.1_2 Forward -132 -114 14.9655 0.0514
NP_440516.1_2 Reverse -111 -129 13.2938 0.0588
NP_440516.1_8 Forward -126 -117 16.9127 0.00442
NP_440516.1_8 Reverse -117 -126 16.9127 0.00442
NP_442428.1_5 Forward -125 -118 15.8704 0.0124
NP_442428.1_5 Reverse -118 -125 15.8704 0.0124
NP_441443.1_2 Forward -68 -49 -2.65548 0.26
NP_442120.1_10 Reverse -137 -156 -6.29373 0.208
NP_440673.1_3 Forward -124 -117 12.4288 0.0426
NP_440673.1_3 Reverse -119 -126 12.4288 0.0426
NP_441052.1_2 Forward -126 -116 19.9412 0.00106
NP_441052.1_2 Reverse -117 -127 10.5014 0.0285
NP_442219.1_9 Forward -125 -116 17.7976 0.00718
NP_442219.1_9 Reverse -118 -127 8.35786 0.0681
NP_440436.1_4 Reverse -118 -127 18.1905 0.00233
NP_440436.1_4 Forward -125 -116 17.2072 0.00233
NP_441884.1_8 Forward -127 -108 -7.67036 0.254
NP_441884.1_9 Forward -129 -110 -15.9302 0.138
NP_442864.1_7 Forward -247 -229 5.62401 0.274
NP_440314.1_9 Reverse -118 -137 0.982764 0.0947
NP_440314.1_9 Reverse -279 -298 -4.72043 0.213
NP_441719.1_4 Forward -125 -118 16.3621 0.0124
NP_441719.1_4 Reverse -118 -125 16.3621 0.0124
NP_441733.1_10 Reverse -114 -127 7.39411 0.153
NP_441004.1_1 Reverse -45 -64 -7.08038 0.194
NP_441004.1_1 Forward -246 -227 -9.047 0.206
NP_441004.1_1 Forward -108 -89 -12.7836 0.251
NP_442873.1_5 Forward -247 -228 11.11 0.246
NP_440296.1_10 Reverse -47 -66 -12.6852 0.269
NP_442694.1_4 Forward -297 -288 15.536 0.164
NP_442694.1_4 Reverse -217 -226 12.6844 0.248
NP_442694.1_4 Reverse -80 -89 11.7011 0.277
NP_442206.1_10 Forward -126 -111 13.3529 0.0799
NP_440328.1_4 Reverse -111 -130 -0.0988766 0.267
NP_443054.1_2 Reverse -115 -129 1.08123 0.251
NP_441851.1_10 Forward -127 -117 16.008 0.00552
NP_441851.1_10 Reverse -116 -126 15.8113 0.00552
NP_442208.1_5 Forward -255 -236 -10.4236 0.299
NP_442939.1_7 Forward -217 -198 9.73422 0.292
NP_442622.1_8 Forward -126 -108 -18.7621 0.268
NP_442856.1_6 Reverse -187 -205 14.5713 0.238
NP_441668.1_4 Reverse -64 -83 -0.688862 0.261
NP_442515.1_1 Reverse -116 -130 11.406 0.0412
NP_442515.1_1 Forward -127 -113 2.35953 0.137
NP_440593.1_3 Forward -58 -39 8.84924 0.109
NP_441982.1_6 Reverse -153 -162 13.2493 0.274
NP_441982.1_6 Forward -308 -299 11.3395 0.288
NP_442709.1_3 Reverse -110 -129 8.35759 0.121
NP_442709.1_3 Forward -260 -241 2.85105 0.288
NP_442689.1_8 Reverse -342 -359 0.432165 0.191
NP_442689.1_8 Forward -46 -29 -7.53264 0.292
NP_442689.1_8 Forward -355 -338 -8.41762 0.294
NP_441349.1_10 Reverse -107 -126 -8.35868 0.274
NP_441409.1_6 Forward -132 -113 2.0644 0.0584
NP_441409.1_8 Forward -331 -312 7.88415 0.277
NP_440432.1_9 Forward -125 -110 -3.26502 0.179
NP_442843.1_1 Forward -125 -106 -3.73712 0.228
NP_442843.1_1 Reverse -45 -64 -9.53865 0.266
NP_439960.1_6 Forward -106 -87 14.0608 0.176
NP_439960.1_10 Reverse -110 -128 3.3624 0.163
NP_441124.1_5 Forward -369 -359 15.5864 0.188
NP_441124.1_5 Forward -340 -330 14.345 0.215
NP_441124.1_5 Reverse -354 -364 12.3397 0.225
NP_440431.1_7 Reverse -380 -399 10.9142 0.0785
NP_440588.1_2 Reverse -108 -127 -2.26216 0.163
NP_440483.1_1 Reverse -239 -258 -0.787193 0.208
NP_440483.1_4 Forward -132 -113 7.47261 0.271
NP_442243.1_1 Forward -53 -35 -3.22649 0.299
NP_441570.1_1 Forward -126 -108 2.87075 0.023
NP_441078.1_4 Forward -126 -117 19.6659 0.0007
NP_441078.1_4 Reverse -117 -126 19.6659 0.0007
NP_442729.1_5 Forward -194 -184 7.74818 0.271
NP_441539.1_1 Reverse -160 -174 14.4536 0.284
NP_441663.1_8 Reverse -238 -257 3.24438 0.187
NP_441663.1_8 Forward -132 -113 -2.65548 0.271
NP_442348.1_2 Reverse -216 -225 11.8978 0.225
NP_442348.1_2 Forward -298 -289 7.37455 0.28
NP_440526.1_3 Forward -125 -114 8.02298 0.126
NP_440526.1_3 Forward -59 -48 0.746521 0.271
NP_441432.1_8 Reverse -116 -125 16.8143 0.00595
NP_441432.1_8 Forward -127 -118 8.25953 0.0755
NP_441732.1_2 Reverse -113 -129 -16.0677 0.164
NP_441732.1_2 Forward -130 -114 -16.3627 0.165
NP_442003.1_4 Reverse -118 -137 12.0942 0.272
NP_440685.1_6 Reverse -114 -133 21.0414 0.0454
NP_440760.1_1 Forward -126 -107 -5.31042 0.0493
NP_442353.1_4 Forward -132 -113 6.88182 0.17
NP_440913.1_1 Forward -128 -110 6.214 0.229
NP_440713.1_4 Reverse -107 -126 5.89931 0.2
NP_442489.1_7 Forward -126 -117 20.1576 0.000695
NP_442489.1_7 Reverse -117 -126 20.1576 0.000695
NP_442079.1_6 Reverse -237 -256 14.2574 0.273
NP_442079.1_7 Forward -125 -106 -0.295539 0.29
NP_440559.1_1 Forward -125 -116 17.4043 0.00658
NP_440559.1_1 Reverse -118 -127 8.75118 0.0586
NP_441659.2_8 Forward -126 -116 18.1713 0.00133
NP_441659.2_8 Reverse -117 -127 11.9764 0.0147
NP_441022.1_1 Forward -348 -339 12.8891 0.222
NP_441040.1_2 Forward -68 -49 -2.45882 0.139
NP_441040.1_2 Reverse -235 -254 -9.93197 0.241
NP_441968.1_1 Reverse -62 -70 14.1787 0.286
NP_439956.1_7 Forward -122 -103 4.916 0.257
NP_442008.1_2 Forward -244 -225 10.2259 0.15
NP_442008.1_2 Reverse -47 -66 5.11266 0.228
NP_442008.1_2 Forward -256 -237 2.3594 0.289
NP_440708.1_6 Forward -57 -38 -10.227 0.278
NP_442346.1_5 Reverse -116 -126 16.6963 0.00248
NP_442346.1_5 Forward -127 -117 9.02648 0.118
NP_440352.1_5 Reverse -368 -387 9.63828 0.294
NP_440545.1_3 Reverse -113 -130 3.87375 0.0775
NP_440545.1_3 Forward -288 -271 -6.746 0.287
NP_441856.1_3 Reverse -114 -133 -0.000545616 0.216
NP_440250.1_4 Reverse -317 -336 3.63691 0.265
NP_440459.1_1 Reverse -133 -152 23.7955 0.00961
NP_440459.1_2 Reverse -182 -199 8.10198 0.27
NP_440459.1_3 Reverse -369 -388 22.1239 0.00896
NP_441653.1_2 Reverse -106 -125 12.5166 0.0959
NP_440010.1_3 Reverse -232 -251 -6.29373 0.25
NP_441943.1_10 Forward -358 -344 18.7801 0.197
NP_442603.1_7 Forward -126 -112 13.6669 0.0819
NP_442603.1_7 Reverse -117 -131 8.55376 0.171
NP_442603.1_10 Forward -118 -101 16.4036 0.244
NP_441888.1_7 Forward -131 -117 4.03116 0.225
NP_441888.1_7 Reverse -112 -126 3.44117 0.225
NP_441888.1_7 Reverse -122 -136 0.88457 0.276
NP_441948.1_4 Reverse -110 -128 -1.16082 0.143
NP_441833.1_4 Forward -125 -118 15.9687 0.0124
NP_441833.1_4 Reverse -118 -125 15.9687 0.0124
NP_441329.1_6 Forward -328 -309 0.524783 0.253
NP_442436.1_4 Reverse -343 -357 12.9793 0.218
NP_442699.1_8 Forward -49 -30 -3.44213 0.238
NP_442162.1_9 Forward -125 -118 16.2637 0.0124
NP_442162.1_9 Reverse -118 -125 16.2637 0.0124
NP_440671.1_1 Reverse -335 -354 5.84395 0.26
NP_442140.1_3 Reverse -118 -128 14.238 0.0486
NP_442140.1_3 Forward -125 -115 10.3048 0.0902
NP_440875.1_9 Reverse -119 -129 14.3096 0.0453
NP_440875.1_9 Forward -124 -114 8.37203 0.233
NP_441813.1_5 Forward -128 -118 19.4496 0.00647
NP_441813.1_5 Reverse -115 -125 18.1713 0.00743
NP_440594.1_8 Reverse -118 -131 11.2284 0.153
NP_442028.1_1 Reverse -383 -396 9.32449 0.251
NP_440590.1_4 Reverse -118 -131 14.2773 0.011
NP_440590.1_4 Forward -125 -112 -4.01229 0.257
NP_440567.1_1 Reverse -118 -132 2.85119 0.16
NP_442497.1_10 Forward -125 -116 10.4228 0.0087
NP_442497.1_10 Reverse -118 -127 10.4228 0.0087
NP_440821.1_4 Forward -128 -118 10.2065 0.0163
NP_440821.1_4 Reverse -115 -125 9.41981 0.0286
NP_441239.1_9 Forward -128 -116 14.1986 0.0288
NP_441239.1_9 Reverse -115 -127 7.80712 0.148
NP_440665.1_1 Forward -123 -104 -14.2585 0.261
NP_440833.1_6 Reverse -65 -79 6.58715 0.299
NP_442216.1_4 Reverse -233 -241 8.1805 0.255
NP_442138.1_10 Forward -126 -107 -8.16202 0.299
NP_440546.1_4 Reverse -117 -127 11.8882 0.0679
NP_440546.1_4 Forward -126 -116 10.046 0.109
NP_440546.1_4 Reverse -74 -84 8.10685 0.203
NP_440546.1_4 Forward -83 -73 6.74945 0.282
NP_440462.1_4 Forward -118 -104 9.63603 0.243
NP_440462.1_6 Forward -128 -118 17.2863 0.00752
NP_440462.1_6 Reverse -115 -125 9.61647 0.0429
NP_442611.1_1 Forward -253 -234 -3.24547 0.3
NP_440868.1_4 Forward -130 -118 22.1634 0.00629
NP_440868.1_4 Reverse -113 -125 17.0502 0.0124
NP_440868.1_8 Forward -130 -111 -4.52377 0.263
NP_442499.1_1 Reverse -112 -131 2.0644 0.294
NP_442499.1_4 Reverse -42 -56 12.6843 0.226
NP_441474.1_1 Reverse -107 -126 -0.39464 0.255
NP_442402.1_10 Reverse -234 -244 11.8776 0.231
NP_442402.1_10 Forward -143 -133 11.6809 0.241
NP_442402.1_10 Reverse -331 -341 10.206 0.299
NP_441848.1_4 Forward -345 -329 11.3703 0.224
NP_441848.1_7 Reverse -304 -323 -3.73788 0.284
NP_442039.1_4 Forward -125 -118 15.1821 0.0124
NP_442039.1_4 Reverse -118 -125 15.1821 0.0124
NP_442039.1_7 Forward -246 -236 10.8948 0.257
NP_442039.1_7 Forward -108 -98 6.96153 0.286
NP_441811.1_8 Reverse -247 -261 6.19444 0.283
NP_442679.1_3 Forward -344 -326 1.98577 0.239
NP_442829.1_2 Forward -328 -312 8.43099 0.287
NP_440825.1_6 Reverse -64 -83 6.78429 0.3
NP_442837.1_3 Forward -125 -118 15.7721 0.0124
NP_442837.1_3 Reverse -118 -125 15.7721 0.0124
NP_442053.1_1 Forward -126 -117 18.3876 0.0007
NP_442053.1_1 Reverse -117 -126 18.3876 0.0007
NP_440505.1_3 Reverse -115 -125 18.3679 0.00213
NP_440505.1_3 Forward -128 -118 15.9097 0.00857
NP_442174.1_9 Forward -320 -301 6.09597 0.292
NP_440914.1_1 Forward -126 -116 17.5935 0.000537
NP_440914.1_1 Reverse -117 -127 8.6151 0.186
NP_441011.1_8 Reverse -118 -127 16.9127 0.00602
NP_441011.1_8 Forward -125 -116 8.25953 0.144
NP_442931.1_8 Forward -76 -57 3.93269 0.232
NP_442533.1_6 Forward -126 -117 17.2076 0.00137
NP_442533.1_6 Reverse -117 -126 17.2076 0.00137
NP_442533.1_6 Forward -253 -244 4.62128 0.179
NP_442322.1_4 Forward -256 -239 -10.1882 0.298
NP_442535.1_2 Reverse -121 -140 6.78429 0.253
NP_441482.1_7 Reverse -111 -125 6.58777 0.0271
NP_439944.1_9 Forward -125 -115 10.5014 0.0887
NP_440816.1_2 Reverse -345 -364 8.37121 0.246
NP_441028.1_6 Forward -384 -374 5.19112 0.265
NP_441028.1_6 Reverse -313 -323 5.19112 0.265
NP_442664.1_3 Forward -282 -268 12.6843 0.246
NP_440115.1_6 Reverse -114 -124 16.008 0.0325
NP_440115.1_6 Forward -129 -119 6.66654 0.172
NP_441059.1_2 Forward -252 -233 3.24438 0.14
NP_441972.1_5 Forward -125 -106 -9.83364 0.293
NP_441106.1_1 Forward -127 -118 18.191 0.0028
NP_441106.1_1 Reverse -116 -125 9.63616 0.0311
NP_442928.1_3 Forward -255 -236 20.4405 0.0881
NP_442306.1_10 Forward -131 -112 -19.2734 0.197
NP_441286.1_1 Reverse -116 -128 6.03717 0.0258
NP_441286.1_1 Forward -127 -115 3.38223 0.0467
NP_440670.1_8 Forward -126 -117 18.3876 0.000699
NP_440670.1_8 Reverse -117 -126 18.3876 0.000699
NP_442463.1_1 Forward -242 -223 17.404 0.21
NP_441705.1_3 Reverse -121 -140 -4.13045 0.291
NP_440886.1_7 Forward -127 -117 17.7774 0.0011
NP_440886.1_7 Reverse -116 -126 7.94438 0.0805
NP_442614.1_2 Forward -126 -112 9.83269 0.242
NP_442614.1_2 Reverse -117 -131 8.35772 0.255
NP_442072.1_9 Reverse -116 -134 -21.8103 0.212
NP_440907.2_8 Reverse -118 -128 7.94438 0.117
NP_441021.1_1 Forward -59 -40 -11.1119 0.257
NP_441463.1_3 Forward -136 -117 -7.96535 0.262
NP_441463.1_3 Reverse -107 -126 -9.14533 0.277
NP_441626.1_2 Forward -125 -118 15.7721 0.0124
NP_441626.1_2 Reverse -118 -125 15.7721 0.0124
NP_441901.1_9 Forward -195 -176 19.2723 0.0247
NP_442365.1_7 Forward -130 -111 1.76941 0.168
NP_442365.1_7 Reverse -113 -132 -0.0988766 0.177
NP_442238.1_7 Forward -30 -11 9.63507 0.224
NP_442794.1_1 Reverse -113 -125 10.1671 0.0721
NP_442794.1_1 Forward -51 -39 4.16888 0.276
NP_442615.1_1 Forward -135 -117 -3.02911 0.154
NP_440387.1_1 Forward -126 -110 2.51681 0.0784
NP_440387.1_1 Reverse -117 -133 -2.5964 0.148
NP_441431.1_2 Forward -129 -115 10.1271 0.169
NP_441836.1_2 Forward -132 -113 25.9588 0.00274
NP_441836.1_2 Forward -290 -271 -5.9004 0.288
NP_440114.1_10 Reverse -117 -131 11.701 0.106
NP_441853.1_6 Reverse -304 -323 21.1873 0.0813
NP_440632.1_7 Forward -98 -79 3.14605 0.284
NP_440458.1_2 Forward -150 -131 27.4338 0.000821
NP_440458.1_10 Forward -230 -212 18.3087 0.239
NP_439910.1_2 Forward -134 -117 -2.91109 0.0305
NP_440457.1_1 Forward -197 -185 1.90727 0.223
NP_440457.1_1 Forward -130 -118 1.12062 0.245
NP_440457.1_1 Reverse -113 -125 0.530633 0.25
NP_442940.1_2 Reverse -96 -115 2.45773 0.276
NP_442680.1_5 Forward -241 -222 0.658372 0.26
NP_441984.1_3 Reverse -63 -81 7.98396 0.239
NP_440473.1_1 Reverse -114 -133 16.4634 0.106
NP_442509.1_9 Reverse -117 -127 16.2041 0.00739
NP_442509.1_9 Forward -126 -116 8.14104 0.192
NP_442582.1_3 Forward -346 -332 16.1498 0.144
NP_442514.1_5 Forward -55 -36 -9.44104 0.296
NP_440554.1_4 Reverse -118 -128 16.4996 0.0189
NP_440554.1_4 Forward -125 -115 8.92815 0.0646
NP_441885.1_1 Forward -324 -310 16.7406 0.282
NP_441885.1_5 Forward -126 -116 20.9245 0.000538
NP_441885.1_5 Reverse -117 -127 11.4848 0.00668
NP_440478.1_10 Forward -128 -114 15.7325 0.107
NP_442128.1_6 Forward -32 -18 16.9125 0.29
NP_442341.1_7 Reverse -116 -130 8.75105 0.0848
NP_442341.1_7 Forward -127 -113 5.50613 0.154
NP_442341.1_9 Forward -128 -114 11.2087 0.129
NP_442341.1_9 Forward -85 -71 5.60385 0.263
NP_441173.1_9 Reverse -334 -342 9.95045 0.266
NP_441173.1_9 Forward -353 -345 9.85212 0.275
NP_440750.1_5 Forward -347 -333 4.81781 0.294
NP_440423.1_6 Reverse -109 -128 -15.6352 0.229
NP_440423.1_10 Reverse -110 -129 11.7008 0.218
NP_443000.1_3 Reverse -50 -69 11.1347 0.255
NP_443000.1_7 Reverse -115 -125 19.9412 0.00223
NP_443000.1_7 Forward -128 -118 11.5831 0.0344
NP_441842.1_1 Reverse -119 -132 19.9798 0.0111
NP_440275.1_3 Forward -128 -118 15.418 0.0178
NP_440275.1_3 Reverse -115 -125 15.123 0.0182
NP_440091.1_1 Forward -130 -118 0.727295 0.233
NP_442275.1_1 Reverse -117 -136 1.47442 0.284
NP_443010.1_10 Forward -129 -112 3.9304 0.246
NP_442638.1_3 Forward -363 -344 17.8088 0.209
NP_441207.1_7 Forward -337 -323 12.3534 0.241
NP_442495.1_4 Reverse -188 -198 12.0747 0.25
NP_440149.1_8 Forward -126 -107 7.57094 0.0628
NP_441105.1_3 Reverse -68 -87 -0.885524 0.143
NP_442373.1_2 Forward -290 -271 -4.13045 0.205
NP_440216.1_1 Reverse -117 -131 8.65272 0.00592
NP_440216.1_1 Forward -126 -112 -0.590395 0.0284
NP_440216.1_9 Forward -177 -168 6.09625 0.289
NP_440216.1_9 Reverse -186 -195 5.89959 0.289
NP_440172.1_1 Forward -126 -116 15.0247 0.00945
NP_440172.1_1 Reverse -117 -127 8.73149 0.0586
NP_442418.1_4 Reverse -292 -310 12.7979 0.217
NP_442015.1_10 Forward -130 -117 12.0157 0.0372
NP_442015.1_10 Reverse -113 -126 11.3273 0.0372
NP_441226.1_7 Forward -125 -118 14.4934 0.0123
NP_441226.1_7 Reverse -118 -125 14.4934 0.0123
NP_441226.1_7 Forward -252 -245 5.34865 0.289
NP_442222.1_3 Reverse -234 -253 13.0775 0.228
NP_441111.1_7 Forward -125 -117 18.7023 0.00294
NP_441111.1_7 Reverse -118 -126 18.7023 0.00294
NP_440244.1_8 Reverse -337 -356 3.34271 0.27
NP_439971.2_9 Forward -66 -47 17.994 0.229
NP_441766.1_2 Forward -126 -117 17.5026 0.00297
NP_441766.1_2 Reverse -117 -126 17.5026 0.00297
NP_440416.1_9 Reverse -110 -129 -6.98204 0.0951
NP_440416.1_9 Reverse -225 -244 -19.3717 0.274
NP_443052.1_8 Forward -136 -117 -7.76869 0.164
NP_441135.1_4 Forward -133 -114 1.57275 0.284
NP_440261.1_5 Reverse -118 -131 12.8023 0.0244
NP_440261.1_5 Forward -125 -112 6.80412 0.0316
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATTAAAAACCAATAATTTACCTCGATCAACTATGAAAATTTAGTAATTTAGCAAAAGTTTGTGAAAATCTAAAATAATAGAGGCAAAAGATTTGTTGAAAATGGGATTTTTGGGAGACCTTAGCTTGGGTGCCTCAGTCGAATCGTGCCCAACCCCTGGGGGAACTAAAGGGGCACAAAGACCCTCTGTATTGACAGAAGACCCCGTGCCATGGAGTTCTTCCCATTGTAAAACTTATTTTTGCCTAGCAAAATACGGTTTCCCGAATTTGCCGGCGATCGCCAGGATTGTGGTTGGCAGACCGGTCTTGAAACAAGCCCATAGGCCAGTTTTTCCTGCCGACATTCCCCCTGACTAAGGCTAAAATTACAACTGATTCAGATCCTGTTCAGAGTTGAA

CDS

ATGATGTCTTTTTTAAGTCCCTTGTTATCTTTGCCAAAACGTCGCTACTGGGCGATCGCCTTGGCGGTGACATCGGCGGTACTACCTTGGCCCATTGCTGGTCTCCACAAGCTTTACCTGGGGCAACCCGTGTGGGCAGGAATCTATTGGTTACTGTGGAACACCCCCATACCTAGAATTGCCTGCGCCATTGATGCAGTGTGGTATTTCGTCCAGGGAGAAGAGGATTTTAACCGACAGTTCAACGATCTTGGGGGAGCCTGGCACCAAAATGGAGACAGCCTGCAACCGTCCCAACAGGTTATTACCATGGCCGAAGCTATGCGGGAGTTGGAACAGTTGCGACTAGAAGGACTACTCACAGAATACGAATTTGAACAAAAACGTAGACAATTATTGGGCTAA

Protein

MMSFLSPLLSLPKRRYWAIALAVTSAVLPWPIAGLHKLYLGQPVWAGIYWLLWNTPIPRIACAIDAVWYFVQGEEDFNRQFNDLGGAWHQNGDSLQPSQQVITMAEAMRELEQLRLEGLLTEYEFEQKRRQLLG